end of school Word Searches

Exercise Physiology 2 2026-03-31

26 Items: SunHeatLossHipsDietInputIntakeOutputRegionHabitsProteinBalanceGlucoseMovementPlasticityExpenditureDehydrationOver-eatingBurning ZoneUnder-eatingCarbohydratesEffect of FoodNeuroendocrineof Thermodynamicsof Exercise IntensityComponents of Energy Output

Harry Potter Wordsearch 2023-09-26

16 Items: ronscarStonePotterMalfoyPrinceof FireHallowsKnow Whohogwartshermionegryffindordumbledoreof Secretsof Azkabanof the Phoenix

School subjects 2022-09-11

14 Items: artmathmusicgermanbiologyenglishphysicslatvianhistoryeducationchemistryeconomicsgeographyliterature

School suppiles 2022-10-12

15 Items: pencasebookdeskgluerulerchairpaperpaintpencilerasercrayonbackpacknotebookscissors

School objects 2023-09-05

15 Items: pengluegluedeskboardrulerpencilrubbereraserspongecrayonscissorssharpenerpencilcasefelttippen

Trade School 2024-05-20

14 Items: hvactradehealthbeautymedicaldiplomavocationaviationplumbingbusinessveterinaryautomotivetechnologycertification

School subjects 2024-09-10

14 Items: mathmusicethicssciencespanishenglishreligiongeometrytechnologyhandicraftschairofpeacesocialstudiesbodyexpressionphysicaleducation

school supplies 2025-04-10

14 Items: PenBagGlueRulerPouchPencilEraserMarkerCrayonsNotebookScissorsSharpenerCalculatorHighlighter

SCHOOL THINGS 2025-07-21

15 Items: tapecaserulerstickmarkerpencilerasercrayonstaplernotebookbackpacklunchboxtextbooksharpenerpaintbrush

School supplies 2025-11-28

14 Items: boxbordGlueDeskPaperRulerBooksChairIpadsMarkerEraserPencilFolderBackpack

school food 2025-12-12

14 Items: BanHabitSelectImpactCalorieObesityPreventEpidemicRestrictAppealingExpensiveNutritionAvailablePrevention

School Objects 2026-03-01

14 Items: penbagbookdeskchalkrulerchairpencilerasermarkernotebookscissorspencilcaseblackboard

SIMPLE PAST VERBS 2025-01-17

9 Items: snacksin a racetug of wara milkshakea sack racea team posterteam T shirtswater balloonsthe school song

Some of Rochester Finest High School 2024-03-12

13 Items: rcsdeastuprepverusedisonmonroeallcityfranklinmarshallnorthstarbrockportcharlotteleadership

Mr. & Mrs. Trivia 2026-04-02

10 Items: Go-to sweet treatNumber of years togetherJudy's western zodiac signOne of James's funny quirksJames's eastern zodiac signFavorite fast-food menu itemFirst date was near this local landmarkReason for Judy's chest of crafting suppliesDistance (miles) between their childhood homesHigh school they both attended but didn't meet at

How well do you know me? 2025-03-28

23 Items: My last name?My eye color?Dogs or cats?Marvel or DC?My first name?My middle name?My sisters name?My schools name?My favorite color?My favorite season?My favorite animal?My 1st brothers name?My 2nd brothers name?Month of my birthday?Sport I used to play?The day of my birthday?What number car am I on?Where was our first date?...

Rachel & Matthew 2024-07-18

20 Items: THEIR OCCUPATIONTHE APP THEY MET ONBRIDE'S MIDDLE NAMETHEIR FAVOURITE FOODNAME OF THE BEST MANTHE NAME OF THEIR DOGCOLOUR OF GROOM'S EYESTHE MONTH MATT PROPOSEDTHE NAME OF THEIR STREETA SPORT THEY PLAY TOGETHERMASCOT OF THEIR UNIVERSITYTHE LOCATION OF THEIR HONEYMOONTHE LOCATION OF THEIR FIRST DATETHE MONTH THEY BOUGHT THEIR HOME...

Damanuel 2025-11-11

12 Items: The god of warThe god of loveThe god of fireThe god of musicThe god of the seaThe god of lightingThe god of celebrationThe messengers of godsThe god of war and wisdomThe god of animals and huntingThe gods of fields and farmingA person who can speak to gods

Bamidbar 5.0 2025-05-25

23 Items: “Mishkan”Hebrew, “Bamidbar”The Rosh of a man?Aaron’s firstborn.The son of Shedeur.Eleazar and IthamarThe chief prince of the Levites.The Levites belong to _________???This tribe numbered 41,500in the census.This tribe numbered 59,300 in the census.This tribe numbered 45,650 In the census.This tribe numbered 57,400 in the census....

St. Joan of Arc Secondary School 2025-08-18

16 Items: RoomRoomHallMMLCRoomRangeCourtOfficeChapelCentreLibraryCarparkTheatreArt RoomGymnasiumCulture Room

Science Vocabulary Word Search chapter 11 (Lin) 2024-05-07

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Famous Landmarks Word Search 2023-04-14

20 Items: petrabig-bentaj-mahalcolosseumstonehengeeiffel-towermachu-picchugrand-canyontower-bridgeburj-khalifachichen-itzaniagara-fallsmount-rushmorepyramids-of-gizastatue-of-libertysydney-opera-housegolden-gate-bridgegreat-wall-of-chinachrist-the-redeemeracropolis-of-athens

minecraft bioms 2019-03-20

5 Items: endkõrbnetherfriikadtasanndik

Mat 2024-01-09

5 Items: onmatsamendthe

101-133 Fry Words 2018-12-03

33 Items: airanyaskbigboyendalsoawaybackcamedoesevenformgivegoodhandhelpherehomeafteragainfoundgreatanimalansweraroundbeforechangefollowAmericaanotherbecausedifferent

Nettybell 2024-03-06

30 Items: redendinkdongdingemmablueshopballdingbellpinkyreddyglasswinkysummergarnetoceanspurplemiddleemeralddiamondperidotamethystsapphiregirllogosubscribenettybelltourmalinesunsetnetty

Debating 2026-02-11

19 Items: arguerolesviewsmotiondebatepointsopposeropinionspeakercurrentargumentaudienceconcludeproposerprevioussecretarytimekeeperchairperson(e.g., point of order, point of information, point of inquiry)

SAT Quack 8 2025-06-14

20 Items: rowdyhorrifiedenthusiasmin separate partsruined; destroyedcircle of friendsto scold severelydead end (impassable)false; wrong; incorrecthard; tiresome; difficulteasily angered; irritableto be troubled or botheredfriendly, agreeable, sociablean environment or surroundingsunrealistic, far out, or bizarreoff course; twisted to one side; wrong...

Top Drugs T1W8 2026-03-04

10 Items: Generic of RequipGeneric of ZofranGeneric of BiaxinBrand of clonidineGeneric of HumalogGeneric of BystolicBrand of nabumetoneBrand of olanzapineBrand of dicyclomineBrand of losartan + HCTZ

Mogopa Word Search 2026-04-13

19 Items: King of BakgatlaFamous King Of BasothoKing of Bafokeng NationCapital City of LesothoA famous King of Bapedi NationWho was Kgosi Moshoeshoe's FatherWho is the father of Kgosi MogôpaKgosi Moshoeshoe's famous MountainWhich village is Kgosi Khama from?Which village is Kgosi Sebele from?Which village is Kgosi Bathoen from?...

Shopping 2026-05-04

16 Items: baker'stoy shopchemist'sbook shopflorist'ssports shopnewsagent'stravelagent'sgreengrocer'sa tin of tunaa bag of flourdepartment storea carton of milka bottle of watera packet of biscuitsa jar of tomato sauce

ServSafe Review 2025-09-10

20 Items: Big nine allergenBig nine allergenBig nine allergenCooked to 165 degreesCooked to 155 degreesCooked to 145 degreesCooked to 135 degreesFirst step of washing dishesThird step of washing dishesFifth step of washing dishesSecond step of washing dishesFourth step of washing dishesReducing pathogens on a surfacePlaced on the top shelf of the fridge...

Ch 4 The Muscular System 2025-04-20

24 Items: Inflammation of a fasciaArm or leg toward midlineArm or leg away from midlineExtreme slowness in movementAbnormal involuntary movementSurgical suturing of a muscleSurgical suturing of a tendonParalysis of all 4 extremitiesA condition of abnormal muscle toneAbnormally increased muscle activityLacking normal muscle tone or strength...

Current Events 2025 2025-10-22

31 Items: EndWarCarNatoViceDownFireVisaTrumpVancePlaysCeaseVisitPutinStressBehindIsrealSummitBlamesUkraineFallingStudentChangesDwindleHousingPaymentsCanceledShortageAmericansPresidentHomebuilders

Adoration, Word Search 2024-02-13

25 Items: a in acts 1c in acts 2t in acts 3s in acts 41st in 7 sacraments 82nd in 7 sacraments 93rd in 7 sacraments 104th in 7 sacraments 115th in 7 sacraments 126th in 7 sacraments 137th in 7 sacraments 14latin of Our Father 17communication with go 5tagalog of Our Father 18is an "action" of the whole Christ 151 of the 3 mysteries of faith starts with 7...

ITS THE END OF THE YEAR YAY! 2026-05-14

10 Items: Miacatsabcsmathhellobreadyippierainbowflowersbutterfly

Maginferrando Word Search 2025-10-01

20 Items: EMPIREPACIANOJOSEBECHJOSERIZALDONFRANCISCOWho opposed the idea of sending Rizal to the UST?Who returned to Lipa and later married Manuel Luz?Who was Rizal’s favorite mentor and lifelong friend?Who is the author of José Rizal’s first favorite novel?Who was the school registrar who refused to admit Rizal?...

3D printer word search 2025-05-22

10 Items: endbedaxisaxisaxisboardplasticprinterextruderfilament

Oregon Word Search 2025-09-22

29 Items: Groom's hometownBride's hometownJulia's middle nameTaren's middle nameTaren's birth monthJulia's birth monthMonth Taren proposedHoneymoon destinationTaren's favorite treeTaren's favorite sportCouple's college mascotCity where the couple metTaren and Julia's eye colorWhere the couple got engagedWho's more likely to be late?...

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Vayakhel 5.0 2025-03-15

16 Items: “Sh’mot”“Kippur”“Shittim””Yochanan”Son of BuziSon of Ahisamach“And he assembled”“To assemble together”Respond, sil vous plaitThe Holy One’s wedding ringHis name means, “In the shadow of G-d”to do, fashion, accomplish, to make, to build.This piece of furniture was made out of pure gold.The second piece of furniture made for the Mishkan....

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Chapter 7, Part 1: Digestive System Terms 2026-04-30

26 Items: PERTAINING TO BILEAN ENZYME OF STARCHPERTAINING TO CHYLETHE ACT OF BELCHINGTO CUT OUT THE COLONTHE ACT OF DEFECATINGTO CUT OUT INTESTINESTO PUNCTURE THE ABDOMENPERTAINING TO THE CHEEKPROCESS OF FECES EATINGFIXATION OF THE ABOMASUMA STATE WITHOUT APPETITEPERTAINING TO INTESTINESINFLAMMATION OF THE COLONPERTAINING TO FLESH EATING...

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciónhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

HR 3B Crossword 2025-10-15

18 Items: LawWorthRightsRightsof LawEthicalJusticeJusticeContractLibertiesof PowersGovernmentParliamentand Balancesprocess of lawresponsibilityof the GovernedJudeo-Christian

Mt. Calvary #2 150th Celebration (Word Search #5) 2025-09-14

30 Items: SingTrustSaviorSermonTithesUshersRevivalSeniorsWorshipSeminarsServicesTrusteesVisitorsWeddingsSalvationSanctuarySpiritualUpliftingSanctifiedScripturesSisterhoodVolunteersWatch-NightYouth-groupSunday-SchoolScholarship-FundWomens-AuxiliarySummer-EnrichmentVisionary-NewsletterVacation-Bible-School)

END OF THE YEAR FRENCH WORD SEARCH! BY: BEN & GORDON 2013-06-19

24 Items: JEETLAMOIDITESTFINVOITAVECGENIELOUISETANGDESIRVOICIADOREC'ESTFILLEHABITEMARCHEBONJOURD'OPERAFRANCAISBALLERINEGRENOUILLE

Backfield Word Search 2025-01-30

27 Items: OFFDOWNZONEGOALPUNTSACKSNAPDRIVEPOINTCATCHGUARDCENTERFUMBLERETURNHUDDLESAFETYTACKLERUSHINGKICKOFFFULLBACKHALFBACKTIGHTENDBACKFIELDCORNERBACKLINEBACKERQUARTERBACKINTERCEPTION

This is for Peyton 2025-09-04

32 Items: UpCatDogGasYetDadJetSheHasCupMomWetEndThatLoveThemJumpUntoSomeHomeYeetDrawShowWordMaybeHappyPeytonHudsonLaVoieOfficePhillipAnnaleigh

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

Weather Word Search 2024-05-06

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Wedding 2024-07-08

34 Items: Name of Trevor's baby nephewCaseys uncle who lives in WashingtonName of Casey's brother who loves musicCaseys cousin who is a Barre instructorCasey's cousin who has been to AntarticaName of Casey's brother who loves to golfPlayed baseball with Trevor in high schoolMark's wife who played softball in collegeName of Casey's niece who played volleyball...

Big Foot and Little Foot 2026-03-05

12 Items: Hugo's smart friendHugo's older sisterThe curious young SasquatchThe species of Hugo and his familyThe river that flows near Hugo's homeThe place Hugo dreams of roaming freeThe name of the cavern where Hugo livesWhat Hugo longs for in the Big Wide WorldThe human boy who wants to find a SasquatchThe underground home of the the Sasquatch community...

June Wordsearch 2025-05-03

19 Items: Public celebrationBioluminescent insectsA period of travel or restThe warmest season of the yearA period of unusually hot weatherThe zodiac sign starting around June 21.A popular outdoor cooking event in summerThe zodiac sign from late May to mid-June.A seasonal fruit harvested in early summer.A ceremony for completing an academic degree...

Tangerine Vocab Set 1 Word Search 2023-01-24

10 Items: steadilyopposite of beliefsynonym for restlesswork jointly toward the same enda word to describe a wild animalyou usually do this before sportssounds like a government/political wordmake full use of and derive benefit fromWhen the old lady crossed the street, I stopped _____go or move back or further away from a previous position

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Athletic training vocab 2024-03-06

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

BIO 345 Chapter 1 Word Search - MC 2025-09-05

20 Items: - A group of people- The cause of a disease- The physiology of altered health- Defects that are present at birth- A complication of signs and symptoms- Death rates for a specific population- A manifestation that is noted by an observer- Aggravation of symptoms and severity of the disease- The study of disease occurrence in human populations...

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Athletic training vocab 2022-08-29

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

junior 2026-04-27

34 Items: PINECLUBPETTSFAITHKELTONSCHOOLALBURYHOFFMANKIMBALLTRINITYRESPECTSERVICESCHOOL.WODONGAHUMEDAMANGLICANDEBATINGSPEAKINGLAKEHUMELANKESTERINCLUSIONTHURGOONARFSCADETSSTEELFANSTHURGOONAETTAMOGAHLAVINGTONROSBOROUGHEXCELLENCEHOVELLTREEMURRAYRIVERMONUMENTHILLBOTANICGARDENSELIZABETHMITCHELLDRIVE

HELLO 2023-02-28

5 Items: the meat of cowsomeone who educates studentsa poultry that lots of people eatthe name of my chicken (impossible)a person studying in a school or university

End Violence Against Women 2025-10-14

13 Items: MenWomenAbusePowerTrialFranceRightsImpactProtestVictimsPelicotViolenceMovement

U.11 2023-01-24

27 Items: bunsickburylosssternmarrygravedeathclosefurrysweepcancerfuneralcompanygive-inloyaltydesigneractuallyfamiliarfaithfuldevotionsympathypass-awaygraveyarddistressedchurchyardin-the-end

Employee manual DL 2025-09-02

26 Items: canHplGelEndLekoAuraGoboIrisFuelbreakViperArrispolicyMartinPinspotTimecardOvertimeVacationComputerTeamworkReceiptsRoadcaseBenefitsFresnelsmanagementMaintenance

55. NETFLIXMAS OVERDOSE 2025-10-13

32 Items: TVCUPMUGHUGCRYENDWINESOFAPLAYLOVEBURPSIGHPLOTMOVIECOUCHCHAIRPAUSELIGHTSLEEPTIREDSANTASNACKCHAIRHAPPYPILLOWSCREENREMOTESERIESCOOKIEROMCOMBLANKETEPISODE

World Faiths 2026-03-09

21 Items: Jewish symbolChristian symbolMuslim Holy monthJewish day of restName of Jewish faithMuslim prayer leaderJewish religious bookMuslin religious bookJewish place of worshipJewish Spiritual LeaderHindu festival of lightMuslim place of worshipHoly day for ChristiansChristian religious bookChristian place of worshipChristianity and Judaism are examples...

Cell cycle Rogan Ciesielski 2025-01-17

24 Items: the first stage of mitosisa series of events that take place in a cellthe stage of the cell cycle when DNA is replicatedthe process by which cells increase in size and massthe first stage of the cell cycle in eukaryotic cellsthe initial stage of the cell cycle phase called interphasethe final stage of cell division in both mitosis and meiosis...

MT 115 Kinesiology Final Review 2023-03-27

16 Items: action of rectus femorisaction of fibularis brevisaction of the serratus anteriorcommon attachment of the hamstringsorigin of the forearm extensor groupaction of the psoas major at the hipreturns blood from the legs to the heartorigin at inner surfaces of lower six ribsmuscle belly between the gastrocnemius heads...

Mixed myth 2026-04-14

17 Items: Mayan rain deity.Greek Version: AresThe Norse all-father.Thor's greatest enemy.A watery guy from Greece.Greek version : AphroditeHe is a Mayan batty deity.Mayan goddess of chocolate.Zeus and Poseidon's brother.The supreme god in the Olympus world.The British triple goddess and the hearts of magic....

Connect Word Search 2025-09-09

10 Items: to endno fatTo be withTo not careto over exaggerateHigh blood pressureeats plants and animalswords with different pronunciationto discuss cultural and societal diversityparts which are similar or are all of the same

Serial Ep 8-10 vocab 2025-11-10

18 Items: acutely distressing.intended to be kept secret.mutually opposed or inconsistent.lasting for a long time or slow to end.deep regret or guilt for a wrong committed.extremely thorough, exhaustive, or accurate.the intention or desire to do evil; ill will.treating all rivals or disputants equally; fair and just....

Word Search 2025-10-22

30 Items: naar iets of iemand verwijzeniets beoordelen of inschattenvooral; voor het grootste deelhoe je over iets denkt of voeltde betekenis van iets uitleggenhet eindresultaat of de uitkomstde houding of sfeer in een tekstiets dat je van plan bent te doende reden waarom iets wordt gedaaneen gevoel van zorg of bezorgdheidiets wat helpt of een voordeel geeft...

Ethics 2026-02-25

12 Items: EthicsProcessIntegrityof Ethicsof Intrestof CommandMisconductImpartialityof DiscretionAccountabilityProfessionalismConfidentiality

End Word Search 2023-09-23

6 Items: netboardskneeingjumbotronmisconductintermission

Norse mythology Week 1 2025-03-23

12 Items: the frost giant whose sweat created the first man and womanThe world inhabited by humans, located in the middle of Yggdrasil's branches.One of the Nine Worlds, it is the home of the Aesir gods, including Odin and Thor.A majestic hall where warriors who died in battle are received by Odin, the chief god....

P2 U1A My daily life 2025-10-15

38 Items: UPCUENEWTOOYETBANDCITYFLATGOODHOMELIFELIKENEARWALKAFTERDAILYRIGHTWRONGBEFOREHAPPENSCHOOLLESSONREALLYCORRECTMORNINGSUBJECTASSEMBLYOF FLATSPRACTISEFAVOURITEFAVOURITETHE MOMENTTHE WEEKENDTHE EVENINGREGISTRATIONFORM COLLEGETHE 3RD FLOOR/ DOESN´T LIKE

End of month reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

The Roman Colosseum 2025-11-25

24 Items: RomeItalyTunnelsTourismAqueductChariotsGladiatorsExecutionsEternalCityWorldWonderAmphitheatreArchaeologicalMonumentHow long did contests last?What was the colosseum a symbol of?What the colosseum was built on top ofWho conducted the Colosseum's creation?The kind of amphitheatre the colosseum isThe flooded naval battles in the colosseum...

March Madness 2024-02-09

15 Items: UC Santa BarbaraBaylor UniversityUniversity of IowaUniversity of MiamiUniversity of TexasNC State UniversityCreighton UniversityPrinceton UniversityUniversity of AuburnTexas A&M UniversityUniversity of HoustonUniversity of IndianaUniversity of MarylandUniversity of MissouriUniversity of West Virginia

My Best Memory - School Events 2024-12-02

10 Items: sports dayschool tripschool playLake Schoolart festivalEnglish Townmusic festivalculture festivalentrance ceremonygraduation ceremony

Silent to the bone chapters 1-3 search for the words 2025-04-03

10 Items: Branwells fatherBranwells step momConnors step sisterConnor and Branwellsay it in a sentenceBranwells baby sisterBranwells thoughts of schoolBranwell during all of Connors visitsThe flag when a ship is ready to sailBranwells grandmothers and grandfathers

Civil War and Reconstruction 2024-11-18

12 Items: To end.An increase in prices.A person who fought to abolish slavery.A war between citizens of the same country.The process of making a country normal again after a war.A document signed by President Abraham Lincoln on 01/01/1863.A network of people, routes, and places that helped slaves escape....

Anime Shows 2022-11-21

57 Items: manendnotetailmoontaxiballcharaouranstonejojospieceeatergeassmaidennarutobleachknightyugiohbutlererasedrezerobasketperiodslayerkaisenclovertrigunaoashimagicapersonaat workhaikyuudurararaexorcistinuyashahellsingparasyteon titanbeastarsx hunterof kingschamploooverlordx familyneverlandof healerpunch manrevengersmegaloboxart onlinestray dogspsycho 100...

Reformation Word Search 2023-11-29

20 Items: VdietVIIIsectsTudorLutherCalvingenevaghettoCranmerof Trentof Avilatheocracyelizabethcanonizedof Loyolaindulgencewittenbergcompromisepredestination

Anatomy & Physiology: M 2026-02-12

67 Items: ChewingMuscle cellsArticular discMuscle-forming stem cellMesentery of the appendixAlso called urination/voidingFusion of many myoblast cellsAlso referred to as menstruationBlood flow through the capillariesSingle unit/monomer of carbohydratesTooth used for crushing/grinding foodMovement of food through the GI tract...

Vocab. - End of Ch. 1 2016-05-10

6 Items: GodclubghostMadamsympathymoonlight

Periodic Trends 2024-12-09

16 Items: The most electronegative of - Cu, Au, AgThe largest atomic radius out of - Cu, Au, AgThe largest atomic radius out of - P, N, B, HThe smallest atomic radius out of - K, Fr, H, LiThe largest atomic radius out of - Cr, Ca, K, TiThe smallest atomic radius out of - Sc, Mn, Zn, FeThe largest electronegativity out of - C, Fe, Fr, Ga...

Oxford Word Search 2025-01-27

11 Items: His third childHis second childHis first of three childrenThe disease that immobilized himHis Wife which he divorced in 1990Where Hawking was born and was an undergraduateHis first publish that became a popular science book and best-sellerThe topic of his thesis which explains the beginnings of the universe...

List 19 Word Search 2026-01-10

25 Items: JapanSpainEgyptCanadaMexicoAfricaBrazilEnglandGermanyIcelandEnglishSpanishChineseJapaneseAustraliaUnitedStatesNorthAmericaSouthAmericaPacificOceanAtlanticOcean- a book of maps- large bodies of land- from another country- the study of the earth- a round map of the earth

Prefix Suffix Level 2 2026-05-26

17 Items: Not legalNot respectCan be brokenFull of graceWithout thanksThe soil belowFull of cloudsFull of successNot responsibleAgainst freezingState of being illState of being lazyThe middle of the termHas to do with ceremonyAct or process of movingHas to do with finance $$Estimate less than you should

Introduction to Animals 2026-03-24

13 Items: fertilized eggorganism with vertebraeorganism without vertebraeextensions on the outside of the bodyorganims with dorsal, hollow nerve cordsense organs on anterior end called the headbody parts that extend outward from the centerlining of digestive tract and respiratory systemorganisms maintain an internal balance or equilibrium...

Incessant Word Search 2023-05-12

10 Items: - to examine or inspect closely and thoroughly. Verb.- continuing or following without interruption. Adjective- the owner of a business, or holder of a property. Noun.- to walk in a slow, relaxed manner, without hurry or effort. Verb.- showing great attention to detail or correct behavior. Adjective....

School of the world 2023-04-08

7 Items: chalkbrainpupilblackboardhomeeductionboardingschoolcorrespondenceschool