end of school Word Searches

school 2016-02-05

8 Items: penbagbinderpencilplanermarkerscrayonsbackpack

school 2022-12-09

8 Items: gymartmathmusicsciencecomputerlanguageartssocialstudies

School 2025-03-02

8 Items: BookDeskPaperRulerPencilEraserMarkerCrayon

School 2025-05-29

8 Items: friendsteacherstudentshomeworkclassroomeducationprincipalexamination

School 2025-05-29

8 Items: friendsteacherstudentshomeworkclassroomeducationprincipalexamination

school 2025-08-06

8 Items: BOOKSPENCILRECESSTEACHERUNIFORMSUBJECTHOMEWORKCLASSROOM

school 2025-09-08

8 Items: p.estemrulerpaperlunchschoolteacherstudents

SCHOOL\ 2025-12-03

8 Items: MathTAPSlunchPreathscienceHistoryTheatorEnglishlanguagearts

School 2025-12-08

8 Items: mathplaybookmusicschoolpencilenglishfriends

school 2026-01-20

8 Items: janitorprincipalsecretarybusdrivergymteachergatekeepermusicteacherEnglishteacher

School 2026-03-29

8 Items: penbagbookrulerCrayoneraserpencilSchool

School Word Search 2026-02-06

10 Items: - to gain new knowledge or skills- a person who helps students learn- a table where students sit and work- a tool used for writing and drawing- a place where children learn and play- pages with words and pictures to read- a backpack used to carry school items- a group of students learning together- someone at school who plays and shares...

Sheffield Word Search 2025-06-10

28 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s nameMother of the Bride’s name...

Anatomy & Physiology: I 2026-02-12

27 Items: Also know as inhalationResponse of tissue to injurySuperior portion of the hip boneLoss of ability to control micturitionInsufficient blood flow to the tissuesPosteroinferior portion of the hip boneEntire life cycle of a cell, excluding mitosisPlant polysaccharide injected to determine GFRTaking food into the GI tract through the mouth...

Peer to Peer 2025-04-25

11 Items: Your school's mascotA smokeless tobacco productThe name of Lucas and Ray's catsThe addictive chemical in cigarettesThe part of a vape that contains the e-liquidThe more common name for electronic cigarettesThe name of your elementary school with no spacesThe part of the brain that controls decision making...

Nasso 5.0 2025-06-02

25 Items: “Kohen”“Asah” Englishson of Shedeur“Nasso” English“Shema” English“Shamar” EnglishThe prince of the tribe of Gad.This clan of Levi totaled 3,200.The prince of the tribe of Judah.resentment against another person.This vow separates you for Adonai.This gift can never be taken away.The Hebrew “Gershon” means _______.The prince of the tribe of Zebulun....

Physical Science Review 2025-05-19

16 Items: Mixture that is UniformEverything in the universeMixture that is Nonuniformthe budling block on matterPhase change of solid to gasPhase change of Liquid to gasPhase change of gas to liquidPhase change of solid to liquidPhase change of liquid to solida combination of two ore more atomsAtom with different numbers of neutrons...

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

collective noun 2026-04-25

11 Items: A group of fishA group of peopleA group of flowersA group of playersA group of soldiersA group of studentsA group of grapes or keysA group of birds or sheepA group of wolves or cardsA group of bees or insectsA group of cattle or elephants

Voters and Voter Behavior 2022-10-04

25 Items: having an influence on politicsa person with no party affiliationillegal voting or tampering in an electiona person who has been convicted of a serious crimethe practice of voting for candidates from only one partythe practice of voting for candidates of more than one partya set of basic beliefs about life, culture, government, and society....

WW5 U13 2024-07-22

16 Items: to form small wavesto stick out; to projectlacking energy; not activethe dead body of an animalto have or to find room forthe condition of being easily seento relax where it is pleasantly warma narrow passage between steep cliffsable to be seen; exposed to view; not hiddento strike out or swing wildly; to thrash about...

Violet Word Search 2024-05-27

12 Items: HomeCityTrainVioletMotherEasterSchoolGrandmaReserveCookbookMinisterResidential

Disneyland Word Search 2025-05-06

9 Items: The AP title I holdThe middle school I attendedMy favorite place on planet EarthIn 5th grade we took a 3-day field trip hereMy favorite band that l've seen 6 times since 2018The first film I made to be shown in film festivalsThe selective school that I spent half of my elementary school years in...

Start of the Cold War 2026-04-10

20 Items: The line that divides EuropeStopping the spread of communismLeader of the USSR, died in 1953The fear of communism in AmericaUnion of Soviet Socialist RepublicsA war to contain communism 1950-1953U.S. financial aid to Europe and AsiaA race to control more nuclear weaponsThe alliance of communist countries 1955Leader of the People's Republic of China...

Able Word Search 2025-09-17

33 Items: addaskendASLablecookdoescityfactbillalsocameaboveamongheavyearlybeginbelowalongaroundbecomebasketbetterforgotfollowcerealbetweenAmerciacertainanotherbecausebelievechildren

Baron Alexander von Humboldt 2023-10-24

20 Items: ofvontheageship17691859¨of¨baronlarrysouthamericaexplorerhumboldtspyglass"father¨¨modern¨alexanderdiscovery¨geography."

Dani & Jake 2025-05-25

30 Items: Bride's SiblingBest Man's NameGroom's SibilingCouple Coaches AtGroom's Birth MonthBride's Birth MonthPlace of EngagementMonth Groom ProposedMaid of Honor's NameHoneymoon DestinationTown Groom Grew Up InBreed of Couple's CatsCouple's 1st Cat's NameCouple's 2nd Cat's NameName of Bride's CollegeCouple's Favorite SportDating App Couple Met On...

Archery 2024-06-09

32 Items: aimbowenddrawlimbnockpileteamarrowgrouprisershaftsightzonesflightquivertargettuningbracketclickerposturearmguardalignmentbowstringfingertabfletchingrobinhoodchestguardcumulativestabilizeranchorpointcompoundbow

10 2025-06-13

32 Items: endnewbodycodenamewillfinalhumantracechoicefusionVISIONclosurecommandCONTROLfreedommachineoutcomerealityautonomydecisionidentityinstinctprotocolsequenceterminalactivationconclusionconnectionseparationdestructionconsciousness

56. EMOTIONAL DAMAGE (HOLIDAY EDITION) 2025-10-13

32 Items: ADCRYMUGENDSODALOVEJOKETEARSIGHTREEFEELWINEKISSLOOKCHAIRMOVIEPHOTOMUSICLIGHTDRAMACOUCHSMILEPAUSEHEARTCHAOSBLUSHCOUPLECANDLEPILLOWADVERTTISSUESCREEN

47. Gelosia per serie tv 2025-11-27

32 Items: TVCRYENDFAILSTOPFILMSIGHCHATPLAYSKIPPLOTCASEROOMLAUGHDRAMASTORYCHEATTITLEPAUSEANGERSERIESREMOTESTREAMCHANGENETFLIXEPISODEGIGGLESMISTAKESPOILERLAUGHINGSUBSCRIPTIONDISAPPOINTMENT

Discover Italy 2024-09-03

21 Items: Capital of ItalyItaly's currencyMeans "Cathedral"Italian famous cheeseItaly's national sportSea to the east of ItalySea to the south of ItalyLives in the Vatican CityCity famous for its fashionVolcano that destroyed PompeiTasty meal originated in Naples95% of Italians are this religionA country that borders with Italy...

Sheffield Word Search 2025-06-10

30 Items: Amelia’s ageThe Groom’s sisterThe Bride’s brotherThe Grooms hometownThe Bride’s hometownThe Bride’s maiden nameThe month they first metThe name of the best manAmelia’s favourite singerFather of the Grooms nameFather of the Brides nameThe Bride’s favourite foodThe Groom’s favourite foodThe Groom’s birthday monthMother of the Groom’s name...

Math Vocab 2023-10-05

24 Items: basetermsfactorsvariableexponentdiscretemonomialbinomialpropertyequationtrinomialrewritingexpressionsubstitutecontinuouspolynomialtrichotomyexpressionscoefficientcoefficientof equalityof a monomialof operationsof a polynomial

The end 2023-01-18

6 Items: catlionzebrahippoelephantMan's best friend

The Absolutely True-Diary of a Part-Time Indian Word Search #1 2025-09-06

13 Items: The tribe that Junior is apart of.The city where the reservation is.The state the novel takes place in.The best friend who was "born angry".The classmate that made fun of Junior’s name.The classmate who Junior punched in the face.Junior’s dog who becomes sick early on and dies.The name of the high school Junior transferred to....

Foot Pathologies - 2025 2025-10-16

25 Items: Also known as 'bunion'Also known as 'pump bumps'Also known as Tailor's bunionAnomalous fusion of two or more tarsal bonesAbnormally flattened medial longitudinal archInflammation along the entire ball of the footThis is rupture of the Posterior Tibial TendonResults in heel pain first thing in the morning...

2nd Quarter Literature 2022-11-25

28 Items: The main character of a story _____________A type or category of literature _____________Prose that tells of real people and events _____________A literary tool to make the audience laugh _____________An expression of one thing in terms of another _____________The major turning point for the main character _____________...

School Things 2023-03-29

13 Items: pengymdeskpaperbellsbooksmarkertablesteacherglassesbackpackcomputersmartboards

School supplies 2025-05-30

13 Items: PenRulerPencilEraserCompassScissorsSharpenerPencilcaseProtractorHighlighterBoardmarkerCorrectionpenCorrectiontape

school objects! 2025-09-07

15 Items: pencasebookgluerulerpencilrubberfoldernotebooktextbookscissorsbackpacksharpenersharpenercalculator

School Stuff 2025-09-21

13 Items: penrulerdiarypencilrubbernotebookcolouredscissorsfeltpensschoolbaggluestickpencilcasehighlighters

School supplies 2025-10-07

13 Items: pen,gluebook,color,ruler,pencil,eraser,scissor,markers,notebook,sharpener,dictionary,pencilcase,

School Subjects 2026-04-30

13 Items: artmusicscienceenglishhistorybiologylanguagegeographychemistrytechnologyliteraturemathematicscitizenship

Electric Vocab 2023-05-16

20 Items: the sound made by a flash of lightningThe flow of electric charges along a pathvisible electrical discharge from a cloudA path along which electric charges can flowThe build up of electric charges on an objectA circuit that has a break in its path, will not workA circuit that does not have a break in its path, will work...

№10 Discuss end-of-life care and ethical dilemmas 2025-11-27

15 Items: Kindness in careHelp for familiesReducing sufferingChoosing treatmentsMoral principles in carePatient’s right to chooseDocument of future wishesInvolving close relativesComfort-focused final careEmotional response to lossRespect for patient’s worthLegal agreement to treatmentRelief from pain and symptomsPrioritizes comfort over cure...

Finals (basically just synonyms-ish of the word "end") 2026-03-04

15 Items: HaltStopPassCloseCeaseFinaleFinishSuspendEpilogueCompleteUltimateTerminateConclusionResolutionDiscontinue

Word search (Middle Ages) 2026-05-13

19 Items: IVheresyrelicspursueremoveStatesAssisiof Wormsinterdictof BingensacramentsDominicansinvestitureGregory VIIFranciscansCisterciansInquisitionInnocent IIIFrancis of Assisi

Unit 45-46 2024-02-07

50 Items: technological(color) copper(color) silver(η) the science(το) the plasticof or made of glassof or made of plastic(η) the temperature, heat(το) the cement, concrete(η) the (female) scientistof or made of stone or rock(ο/η) the (m or f) scientist(ο/η) the (m or f) biologist(η) the chemistry (fig or lit)(η) the (genre) science fiction...

Greek Vocab 2025-10-03

31 Items: Before SocratesA circular buildingA citadel or "high city"An enigmatic facial expressionThe square top of a Doric capitalTwo handled jar with a narrow neckSlight bulge in the middle of a columnAncient Greek satue of a standing nude manAn independent city-state in ancient GreeceAncient Greek statue of a standing clothed woman...

Evolution Word Search 2024-11-14

20 Items: LyellAnningLamarckFossilRecordSexualSelectionHomologousStructure"Survival of the fittest"type of bird Darwin studiedchange is a species over timea change in the sequence of DNApreserved remains of an organismselective breeding done by humansdifferences in traits of a speciesmost broad classification of organism...

school 2014-12-17

8 Items: pepenlunchsnackmusicpencilrecesshighlighter

school 2023-08-28

8 Items: what we sit onreading materialstationary to writewhere flowers are foundthe people we learn fromwe fill it up with liquidsthe heavy weight on our backspeople we go to school to see everyday

school 2024-11-03

8 Items: penbookdeskpaperchairpencilrubbercrayon

School 2025-08-18

8 Items: PenBookOfficeToiletArabicIslamicScienceClassroom

SCHOOL\ 2025-12-03

8 Items: MathTAPSlunchPreathscienceHistoryTheatorEnglishlanguagearts

School 2026-04-06

8 Items: PenBagBookRulerPupilPencilTeacherPencil-case

Regarding Cardiogenic Shock..... by Maya Shaughnessy 2022-10-19

14 Items: Chest painMonitors for dysrhythmiaBluish discoloration of skinUrine output less than 30 mL/hrWhat does the heart fail to do?This value if over 100 is abnormalWhat happens to the pulse pressure?Medication given for pain managementWhat happens to Troponin & CK-MB lab values?Heard when auscultated d/t pulmonary congestion...

Spelling Lists 6 and 8 2026-05-13

20 Items: Preposition meaning "opposed to”.Noun meaning “area of open land”.Verb meaning “to come to a decision”.Noun meaning “series of related things”.Noun meaning “a complex human community”.Adverb meaning “completely” or “extremely”.Adverb meaning “in reality”, “truly” or “very”.Adjective meaning "belonging to the distant past”....

Ash & Bhav 2025-04-25

24 Items: Their surnameMonth they metFirst movie dateBhavik's dream carBride's middle nameCity where they metAashini's dogs nameMaid of honor's nameMonth Bhavik proposedBride's brothers nameHoneymoon destinationBhavik's brothers nameBhavik's football teamBhavik's birthday monthColour of bride's dressAashini's birthday monthDream holiday destination...

2nd Term Vocabularu Review 2024-08-21

16 Items: to shoutopposite of darkopposite of weaksynonym of crazysynonym of troublethe opposite of quicklycloth used on top a bedthe state of feeling illfirmly. Opposite of looselya bird of prey that eats dead animalssocially correct and with good mannerskind, helpful and caring for other peoplesurname of the famous author that we studied this term...

christian & shahara 2024-10-28

15 Items: Favorite SeriesSha's dream carSha's favorite colorWhere they first metChristian's dream carFirst tattoo togetherSha's Favorite dessertMonth Christian proposedFavorite ice cream flavorFirst trip together locallyChristian's favorite dessertFirst out of the country tripFavorite activity together (2)Favorite activity together (1)...

Odin Word Search 2023-06-21

34 Items: EyeGodGododinthorgeriyuleHuntymirwodanbaldrfrekimimirof Warfenrirwolvesravenswisdomhuginnmuninnasgardmidgardsleipnirmagicianof poetswandererwednesdayand Emblayggdrasilberserkerallfatherof Wisdomof Vili & Veof Bestla & Borr

Dinsdale 2026-05-30

18 Items: TempleViewAberdeen-DrFraser-HighRussleigh-DrWhatawhata-RdJukebox-DinerTill’s-LookoutBremworth-ParkKahikatea-ParkResthills-ParkAberdeen-SchoolFrankton-SchoolClassics-MuseumTuhikaramea-RoadDinsdale-LibraryLola-Breakfast-BarWoolworths-DinsdaleDinsdale-Shoppingcentre

AAC St Patrick's Day Challenge 2026-03-09

28 Items: Find 1/5 valuesFind 2/5 valuesFind 3/5 valuesFind 4/5 valuesFind 5/5 valuesTechnique on Amcor ParkingLocation of 1st meeting pointWhat department keeps machines running?What metal are Stelvin closures made from?What is the name of the company we work for?What process creates the ridges on screwcaps?What core value focuses on protecting employees?...

your next clue... 2022-11-15

12 Items: I loveradiatewomen inyou are mylife is aboutmatch made inwe both love towe are a couple ofbest way to end the daybest way to start the daywe are _ first and foremostfirst word dance, second word...

Every Summer After Vocab 2 Word Search 2023-06-02

10 Items: By reasonable assumptionNot disputed or challengedTo give a false appearance ofTo wind or twist into circlesMarked by kindness and courtesyStanding out or readily noticeableTo rise or roll in waves or surgesMaking someone annoyed or irritatedTo fail or slowly end after a startMarked by lack of plan, order, or direction

Pathophysiology, Word Search 2024-09-09

20 Items: something that is subjectivedefects that are present at birththe form and structure of organismsobjective and observed manifestationthe likely outcome or course of a diseasethe increase in severity signs or symptomsthe decreased in severity signs or symptomsthe study of reasons for certain decease phenomena...

Holocaust 2023-03-23

20 Items: Hitler's ideal raceintolerance of others' beliefsa person present but not involvedlawfully removing a group of peoplean act of extreme cruelty and wickednesslacking humanity, pity, kindness, compassionsecret state of police of Nazi occupied Europethe act of getting rid of, especially by killingthe opposition to and discrimination against Jews...

IDPE 2026 Annual Conference Wordsearch 2026-03-24

15 Items: Toucan's Workshop (3 words)'_____ in all it's forms' - Affixius workshop'Regular giving: Setting __________ that work'Leadership forum: 'Bringing you _____ on board'Alumni relations forum focused on engaging (___-_)'Identifying and engaging your future ___________)Day of the week you can attend all of these sessions?...

ENVIR 302 Final Project - Technology and its Environmental Impacts 2022-12-08

23 Items: The use of resources.The creation of gases or radiation.The act of getting rid of something.The amount of energy used per unit time.Using less energy to perform the same task.A form of energy resource like coal, oil, and natural gas.An energy resource that is not able to grow again or be made again....

Unit 2 ESS 2024-10-02

20 Items: elongated, closed curve with two fociearth-centered model of the solar systemsun-centered model of the solar systemthe Earth's motion of orbit around the Sunpoint in a planet's orbit that is closest to the suneclipse occurs when the Earth's shadow falls on the Moonthe point in a planet's orbit that is farthest from the sun...

Anatomy & Physiology: F 2026-02-12

31 Items: Thigh boneBroken boneGas in the intestineLess active form of fibroblastGradual degradation of a blood clotSemisolid waste product of digestionReplacement of muscle fibers by scar tissueShallow depression on the surface of a boneEndoderm of the embryo towards the head regionBundle of muscle fibers within a skeletal muscle...

roman gods 2025-11-17

10 Items: god of the seagoddess of loveking of the godsgoddess of grainqueen of the godsgoddess of wisdomgoddess of huntingmessenger of the godsgod of the forge / blacksmithsgod of music / the sun / healing

Unit 13 Vocabulary 2025-01-15

12 Items: to get as one's ownTo show clearly; to put on display.The cruel killing of many people or animalsdull as a result of not changing in any wayhaving to do with health;free of dirt and germsone who hates or tries to harm another; an enemyA discussion of reasons for or against something.happening in many places or to many people; fully open...

yeah 2025-10-15

16 Items: DudaTigerSchoolJuniorsSeniorsRockiesSanJuanDelNorteFootballJRSRHighColoradoFreshmenNewspaperRioGrandeSophomoresSangreDeCristos

Abgeordnete Word Search 2025-01-31

19 Items: lawto forbidto breachjudgementfemale mayorfemale judgeConstitutionto recommendrepresentativefemale citizenmale chancellormale head of stateFederal Armed Forceslower house of parliamentupper house of parliamentFederal Constitutional courtprotection of the ConstitutionGerman Basic Law, constitutionrule of law, state under the rule of law

OH BOY SCHOOL!!! 2013-12-11

32 Items: ARTTESTQUIZPAPERWORDSROCKSLUNCHPAINTSNACKGAMESADDINGDRAGONBRAINSMOVIESPENCILSNUMBERSERASERSPOPCORNMARKERSCRAYONSDIVISIONPRINTERSINTERNETCOMPUTERSSNOWCONESPLAYGROUNDGIVEMEFIVEDEVONFORESTINSTRUCTIONSUBSTRACTINGMULTIPICATIONPHYSICALEDUCATION

Back to School 2016-08-30

20 Items: PenDeskBooksRulerMathsPencilLibraryWritingStudentTeacherUniformLessonsReadingFriendsComputerBackpackLearningHomeworkClassroomWhiteboard

school bus lingo 2019-12-09

22 Items: lawshornliftseatzonestwopsiescorttenfourpretripdualairstoparmloadingthreepsichildrentiedownsphyscialbraketestradiocheckmirrorchecksafetycirclecertificationsrulesandregulations

Back to School 2022-08-19

20 Items: elaartmathbandbooknestchoirpaperschooleaglessportspencilofficesciencehistoryteacherstudentcomputerathleticscafeteria

Back to School 2023-09-01

24 Items: esmanoahrhysryantroyavayaaverykadensibeltemeltyleealfiyaelijahfatimamavludsabinasamiraselinabektashibrahimjacksonnoemilymadilynntrinnity

Back To School 2023-09-04

21 Items: miaabdigaianimoyahyaemranjasonhannaalorachaceoliverxavierasreetannikaarianarebeccapaisleysabreenlincolnsharleezelizabeth

Middle School Name 2023-12-11

64 Items: luccavaevatreymilaevangabegagejoshdrewlexiedennoahryanlilytaniacolbycadenderekjulesblakekylieangelskylarileylynzijesselogandantekalebdrakegavinmasonkamdenelijahhaydenjoshuajaydenhuntercamilaxanderjaysonmorganreginanevaehantonyashtonhaileymichaelyasminematthewstephanquentoncameronheatherbentleyjacksonmakaylajonathanisabelleivonettesebastianbellarose

School word search 2024-02-28

78 Items: ugomaxudooreidyifenoratheaverarubyivanlanademichadliamthordaraemmadukeleviucheochekemdiethankaylafleurfelixzimzobellaallanisaacaishadavidcatooaaravjamaldurgafritssoikilenyajadenojoneaishabellaerikachimnoharoldtamaradaphnefejiromoriretomiwaandreiandrewnathanlaurieinyangamandasemeeanicolekamaranathaneniolaaradhyachinedumartinijessicamichaelraphael...

School Word Search 2024-02-29

30 Items: testexamstudygrademajorminorschoollessondegreecollegestudentteacherdiplomalectureseminarlibraryscholarlearningworkshophomeworkresearchtextbookacademicclassroomknowledgeuniversitycurriculumassignmentgraduationscholarship

High School Staff 2024-04-19

22 Items: readbyrdbellkrahnlarryelliskellyhoppergarciaguidrycarsonfuentessorrelsmcmurryhinojosrobbinsjohnsonrichmondhokansoncarranzatrujillosanderson

Upper School Travellers 2024-05-06

36 Items: msdiazjamaripmrsorneamirsosamrwilkesmrtaylormrsernstmrokellyazrieldunmrswatsonmrssextonavnitanwarlucykalinazararawlyckemilywarrenwalterbolenshilohcubolharveyhuletavarosenburgezekialyusonalfizemkoskisophiarosalesloganwilliamscamdenwinterssommercolemangabiguarnieriphoenixlycanscolleenmillnslakesidelionsjuliettacooperhannahrosenburgemmalyntranberg...

School Word Search 2024-07-21

36 Items: artgymdeskquizchairbooksmathslunchpaperpencilrecesseraserbinderteachersciencereadingcrayonsmarkersanswersstudentsprintingbackpackhomeworklanguagelearningnotebookpracticealphabetassemblyclassroomlisteningquestionsprincipalfieldtripcalculatordictionary

Back to School 2024-07-30

22 Items: gluedesktapemathpaperchairmarkerfolderpencilcrayonbinderscissorsharpiesciencereadingwritingnotebookbackpackcomputerwhiteboardhighlightersocialstudies

Back to School! 2024-08-15

30 Items: ArtBusDeskMathBellBooksRulerMusicPencilRecessFolderTeacherLibraryCrayonsScienceMrMooreAshlandHomeworkBackpackLunchboxAlphabetNotebookAssemblyClassroomCafeteriaFieldTripGlueStickLexingtonPlaygroundChalkboard

Back 2 School 2024-08-19

21 Items: GusJudeLiamCleoLucyMasonAveryMasonJamesHenryLennuxCamdynKarimePaisleeAddisonBeckhamKillianEmmalynJonathanIgnatiusCatherine

Back to School 2024-09-06

23 Items: alanodenivanbellachloearieltituscalleepaytonraylancooperchanelaustinkeeganlandencrosbyjacksonmemphistimothykendallmrcripemackenziegwendalyn

IPE school jamoasi 2024-10-03

40 Items: AliOdilAzizZeboAkbarUmidaIrodaKamolOydinAzizaJaynaSevaraFotimaMaxsatNigoraAdilyaMalikaMunisaMohinaFeruzaFaridaSardorHaroonOʻktamRobiyaDilyaraDilfuzaDilnozaJamshidGuzalkaIbrohimMunojatNargizaShahinaMuslimaYoʻldoshShahnozaAbdurahmonShaxobiddinMuhammadqodir

High School Transcript 2025-01-21

25 Items: GPACoreGradeHonorsCreditsEnglishCollegeCareersSemesterFineArtsPathwaysElectivesEconomicsUSHistoryTranscriptCumulativeGraduationMathematicsWorldHistoryElectiveSciencePhysicalScienceBiologicalScienceCareerDevelopmentPhysicalEducationAmericanGovernment

School Items Vocabulary 2025-02-11

24 Items: colorlapizplumareglalibrolaptopfoldertijeracrayonpanuelotajadormochilapegatinaborradorlapiceromarcadorcuadernocargardorpegamentoboligrafoarchivadorresaltadorsacapuntasengrapadora

small garden school 2025-03-12

30 Items: domecatyouseecanyoulionlifewordsavemakezebrahipposmallwheremoneygardenschoolmonkeydonkeymondayfridaysundayramadantuesdayelephantsaturdaywednesdayMan's best friend

Morse's School "Body" 2025-03-15

38 Items: humanjointskullspinebloodheartpulsebraingermslungsheartorgansoxygennerveslasersnetworksystemssupportmusclestendonsstomachvesselshealthyskeletondiseasesvaccinescontrolsskeletonvoluntarydigestionesophagusintestineimmunitiesexercisingnutritiousinvoluntarypasteurizationophthalmologist

Cathedral High School 2025-04-02

21 Items: MPBMassFaithTrustRigorFranceSpiritPrayerRespectServiceStantonSanchezCollegeBrothersLasallianCommunityAcademicsEducationTraditionCathedralLeadership

School Word Search 2025-05-27

25 Items: BandMathReadAlderMasonChoirBrodyLearnWriteDesignAchieveKendallJacksonScienceSommersAngelinaComputerJonathanWellnessKnowledgeDiscoveryEngineeringInformationLanguageArtsSocialStudies