chemical reactions Word Searches

ServSafe 2014-11-11

55 Items: soyTCShandeggsmilkricetofuzonewashgnawfishaprondairybakedrinsewheatfeverglovespotatomelonsdangerairdryinsideillnesshairnetwashingpeanutsoutsideallergychemicalphysicalsanitizeoilyodorutensilsvomitingdiarrheafoodborneforty-onesixinchesshellfishbiologicalcalibratedreadytoeatcontainerssorethroatnailpolishcontaminantMedic-Alertcockroachesgarbagecans...

Work and Energy 2024-05-30

18 Items: Unit for workunit for energyEnergy that is storedThe ability to do workEnergy that's in motionenergy related to heightenergy of electric chargesenergy stored in chemical bondsenergy from electromagnetic wavesgravitational energy increases with:energy from the vibration of objectsenergy of moving particles in an object...

Order & Design Ch. 5 2016-11-12

64 Items: ofdogkindkindbirdrockreditreelifeyolksacspaleymouselyelltailscuvierlizardpocketnaturemodernharveydarwinarchesanatomynaturalorchardsciencepasteurhaeckelhomologycreationvesaliuscreationchemicalspecifiedmutationsselectionaristotleworldviewevolutionevolutionembryonicvestigialpakicetuscomplexityspeciationgenerationprotestantbiogenesistechnology...

Random Words 2019-10-28

62 Items: ZooThyRayBookRingZoomPoloMallDripGameLineWarpGrassRoverTrickGhoulPeaceBingeBingoAlarmUnityThornDizzyDiscoFocusDanishTheoryPardonCanaryKelvinPeopleSimpleNoodleEmblemPuzzleSystemPrepareQuantumOstrichTwinkleParkingThunderPlasterCaptureMonsterGenericDiamondMansionCalamityReactionCalamariReceiverChemicalSpaceshipDimensionTwentyTwoOperationDefinition...

Volition Word Search 2025-01-06

15 Items: deeply respected or honoredshowy but cheap and of poor quality.shining with light; bright or radiantreserved or uncommunicative in speech; saying littlecheated or deceived someone to take money or property.firm and steadfast in loyalty, principles, or adherence.the power of using one's will or making a conscious choice...

Med Terms 7, 8, 9 2023-11-01

18 Items: oneairlargebirthshortstomachmany, muchsmall,scantafter, behindexcessive flowdrug, chemicallack, deficiencyoutside of, beyondbefore, in front ofpuncture, aspiration ofdifficult, painful, badto eat, consume, swallowdevelopment, production, creation

Physical Science Work and Energy Module 4 2023-11-21

32 Items: workpowerforcefieldenergysystemweightnewtonmachinegravityinertiafrictionnet-forcefree-fallefficiencysimple-machinekinetic-energylaws-of-motionair-resistancecompound-machinepotential-energymechanical-energyterminal-velocitycentripetal-forcefirst-law-of-motionthird-law-of-motionmechanical-advantagesecond-law-of-motionconservation-of-energy...

Esthetics: 102 Science B 2024-01-02

63 Items: epahsvhivhpvgasgelotcfdaftcoshamrsaacidsoapquatslocalsolidporousbleachmildewactivematterliquidchangealkalisolutepowderpassivephscalephmeterneutralmixturesolventaerosolantibodyringwormsystemicphysicalchemicalelementssolutionointmentemulsionliposomehydrogelnonporoushepatitispathogenicphbalancedsuspensionfunctionalcontacttimeinfestationingredients...

8th Grade Technology Word Search 2014-06-17

64 Items: airCADoilmodelandstudroofarchbeamwoodmasstoolswaterspacejoistshearsafetydesignforcesgirderheaderraftercustompathwayprocessbridgestensiontorsionbendingprimaryplasticcuttingformingshapingthermalmachinesquizstarresearchredesignconcretechemicalmaterialsconstructmaterialssecondarycombiningfinishingmarketingfoundationsuspensionassemblingmechanical...

Order & Design Ch. 5 2016-11-12

64 Items: ofdogkindkindbirdrockreditreelifeyolksacspaleymouselyelltailscuvierlizardpocketnaturemodernharveydarwinarchesanatomynaturalorchardsciencepasteurhaeckelhomologycreationvesaliuscreationchemicalspecifiedmutationsselectionaristotleworldviewevolutionevolutionembryonicvestigialpakicetuscomplexityspeciationgenerationprotestantbiogenesistechnology...

Random Stuff 2022-12-20

6 Items: BaldThis PuzzleTeacher of 8CMy best friendThe title of this PuzzleWhat is the chemical Formula for Water

End of Year 7 Bumper Wordsearch 2024-07-22

60 Items: egggasatomboilbonecellmeltstartimewallcometforcejouleorgansolidspeedspermstatedistilenergyfilterfreezegalaxyliquidmeteormuscleplanettissueuteruscircuitcontrolcurrentelementgravitynucleusthermalvacuolevoltageasteroidchemicalcompoundcondensedistancefairtestfrictionmembranemoleculevariablevelocitycytoplasmdependentevaporatepotentialresistance...

How does dementia affect people's daily lives 2024-05-15

10 Items: Dementia feelsPhycological symptom of dementiaDementia affects a persons ______People with dementia often get _____Dementia interferes with ______ functionsSomeone with dementia may have rapid ______Dementia makes it difficult to ______ at nightPeople with dementia most likely experience ______Dementia patients often feel _______ on where they are...

Molecule Word Search 2023-01-10

13 Items: general makeuphow something is arrangedthe sum of all living matter on Earthis made up of many different kinds of atoms and moleculessubstances that cannot be separated into simpler substancessubstances formed when two or more elements are chemically joinedthe layer of gas surrounding a planet that is held in place by gravity...

Peer to Peer 2025-04-25

11 Items: Your school's mascotA smokeless tobacco productThe name of Lucas and Ray's catsThe addictive chemical in cigarettesThe part of a vape that contains the e-liquidThe more common name for electronic cigarettesThe name of your elementary school with no spacesThe part of the brain that controls decision making...

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

Fireworks 2024-11-04

2 Items: strontium magnesium chemicals shells Fireworksmetals Compounds Fuse energy reactions colourful loud barium

Chapter 7 Foundations Electricity 2025-05-17

31 Items: also known as probe1.1,000 of an amperealso known as insulatorray Tesla high-frequency currenttherapy also known as phototherapyany material that conducts electricitycurrent rapid and interrupted currentelectrode used on the area to be treatedsubstances that speed up chemical reactionsuse of electrical currents to treat the skin...

Cleaning/ Word Search 2022-11-01

20 Items: dispose of an itemhow well a product worksan item that cannot be reusedpotent disinfectant chemicalsa chemical used to whiten or sterilizethe process of removing dirt and debristhe process of killing all bacteria and microbesthe process that kills most bacteria and microbesan item that is able to be disinfected and reused...

Alcohol Vocabulary 2024-12-18

20 Items: E-cigarettesWhen you stop smokingEnlarged stuffy lungsA toxic oily substanceAn electronic cigaretteA smoldering end of a productA type of e-cigarette companyRaises nervous levels severelyCauses cancer in living tissueTobacco that hasn't been burnedWhite patches on a mucous membraneWhen people exhale smoke out of it...

Matter and Its Interactions 2024-08-27

23 Items: a change downwarda process of becoming largerThe process of becoming a vapor.The amount of space something takes up.Anything that has mass and takes up spaceSusceptible of being dissolved in a liquidThe process where water vapor becomes liquid.A combination of two or more different substances....

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Lesson 5 2023-08-25

28 Items: 의견제안자원대회주제기사줄이다버리다알맞게대부분비닐봉지쓰레기통분리하다사라지다화학물질타기,타다재활용하다놓다,장소의식,인식식물,심다생각나게하다밝은,영리한높이다,올리다절약하다,구하다보호하다,지키다재사용할 수 있는원치 않는,불필요한

Unit 1 POM- Structure of Matter 2024-08-02

21 Items: A homogenous mixtureThe ability to do workAtoms with the same number of protonsAnything that has mass and takes up spaceTwo or more atoms that are chemically bondedThe substance that the solute is dissolved inThe amount of matter in an object or substanceThis subatomic particle determines the element...

College of Engineering New Year Celebration Word Search 2024-12-23

70 Items: ESDCCNM2GBSFLEADRCivilStaffDavisCorsiEquityFutureEnergyHealthCoffeeAlumniDesignKemperBainerGhausiRespectClimateAvenueEFacultyCultureNewYearTEAMLabESEARCHKindnessOpennessResearchMobilityInspiredComputerChemicalStudentsEducationCommunitySolutionsDiversityInclusiveImpactfulAerospaceNextLevelInnovationTechnologyMechanicalBiomedicalElectricalBiological...

Breathing system 2024-04-25

12 Items: Organ that mucus comes fromAir passages inside the lungsThe major muscle of respirationThe chemical that you breath outThe chemical that you use to breathTiny air sacs at the end of the bronchiolesA cage of bones that protect your lungs and heartThe pair of spongy, pinkish-gray organs in your chest...

Final Exam Word Search 2024-05-17

68 Items: gasmassbondyearnamelighttablesolidlewisstateionicaniongroupliquidmatterfusionperiodcolumnsymbolgalaxynumberatomiccationvolumespiralprotonfamilymeltingnucleusneutralproductneutronboilingdensityvalenceclustermixturenonmetalpropertynotationequationpositivechemicaluniversecovalentcompoundbalancedreactantfreezingphysicalperiodicelectronreactionnegative...

Chapter 5 Pivot Point Chemistry 2014-06-22

71 Items: saltacidmsdsgasescohnsatomsaminotracesoapswatermattersolidsacidicrinsesaminesliquidsorganicprotonskeratinproteinpeptideproteinpowdersshampoophysicalchemicalelementsneutronscompoundalkalinehydrogenhumiditysidebondbalancedbacteriachlorineshampoosporosityammoniumsolventsinorganicelectronsmoleculesdisulfidehydroxidenitrazineemulsionsointmentssebaceous...

ICP Vocab 15 2025-03-14

15 Items: A change of one substance to anotherType of matter with a fixed compositionThe same thing as a homogeneous mixtureA substance made up of atoms that are all alikeA mixture that remains constantly and uniformly mixedA mixture in which different materials remain distinctA heterogeneous mixture with particles that never settle...

Monomer & Polymer Ch:11 2025-03-19

14 Items: MMAA nail file or bufferWhat is always coming but never arrives?Used to start the chain reaction that leads to curingHow many grains I'd sand are on the file per square inchWhat never asks a question but gets answered all the time?MMA creates the hardest and _____________ nail enhancement.When artificial products lift up or pull away from the nail...

The Bigger One 2022-09-30

72 Items: agendacinemaabandonabolishadviseralcoholarrivalarticleaveragebenefitcabinetcapitalcenturycharitycuriousdeficitdeliverdensitydepositdevelopabsoluteactivateallocateambitionapprovalaudiencebehaviorchemicalclassifycomputerconsidercreationcustomerdatabasedecisiondefenderdesignerdialoguedirectoradmissionadvantageadventureafternoonapartmentapplicant...

Living Systems Investigation 1 & 2 2025-04-21

24 Items: All of the water on Earth.Anything that takes up spaceA collection of interacting parts.To use again or continue a process.The rock and mineral part of Earth.A mixture of decayed organic matter.An organism that makes its own food.The layer of gases surrounding Earth.A reddish-brown worm found in decaying material....

Semester 2 Final Word Search 2015-05-15

74 Items: winroothaircellcellwallareaheattubefoodorganstomasugaraminoacidsxylemlightovuleovaryspermchaintissuephloempollenpetalsstigmauterusenergycarbonnucleussurfaceallelesdiploidhaploidmeiosismitosisanthersgeneticbiomassdioxidegenotypedominantmutationchemicalproducerconsumercytoplasmnutritiondiffusionmesophyllphenotyperecessiveovulationvariationherbivore...

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Ch 18 vocab Brianna Hart 2025-05-09

9 Items: Compound that is composed of two elements.Force that holds atoms together in a compound.Attraction formed between atoms when they share electrons.Positively or negatively charged, covalently bonded group of atoms.Charged particle that has either more or fewer electrons than protons....

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

Dillon Singleton Ch.18 Vocab 2025-05-08

9 Items: Compound that is composed of two elements.Force that holds atoms together in a compound.Attraction formed between atoms when they share electrons.Positively or negatively charged, covalently bonded group of atoms.Charged particles that has either more or fewer electrons than protons....

Science review 2014-01-13

78 Items: SungasnewdatadarkstarbabydustmarsnasamoonfulltideneapapronEarthrockyvenusplutocometspacemethodglovessafetyhazardplanetnebulaspiralbarredheliumoxygencarbonSaturnUranusKuipermeteortheoryphaseswaxingwaningspringgogglesmercuryJupiterNeptunestationbigbangquartergibbouslowtidechemicalconstantuniversemilkywayemissionhydrogennitrogenasteroidcrescent...

1. Word Search 2024-04-04

35 Items: BasicIonicAqueousGaseousAlkaline9.dilute17.polarSaturated- ТвердыйInorganic5.chemical14.neutral15.organic26.viscous7.corrosive13.isotopic- Токсичный27.volatile28.aromatic10.flammable16.oxidative- СубатомныйNonflammable8.crystalline- Растворимый30.catalystic31.conductive33.dehydrated6.concentrated18.radioactive25.transparent- Синтетический...

types of reaction 2023-05-04

4 Items: reactionsreactionsreactionsreactions

Rain/Easter Articles Word List 2024-03-24

9 Items: a small piecewater as a gasconnected withwhen a holiday is celebratedsomething that can’t be seena person who creates a companywhen a place overflows with watersomething made by a chemical processhow water changes between different forms

Immunology Word Search 2024-03-13

15 Items: Immunoglobulin producing cellsProtein encoded by HIV gag geneGold standard test for screening SLECells responding to parasitic infectionsSarcoma associated with HHV-8 infectionsAntibody is in excess compared to antigenMost abundant immunoglobulin in adult serumRegion of immunoglobulin that binds antigensMediator of Type I hypersensitivity reactions...

Matter unit 1 5th grade 2024-08-27

9 Items: how hot or cold something isbe able to be dissolved in a liquidanything that has mass takes up spacethe amount of space something takes upmatter in which a substance does not have a Divine shape or volumestate of matter in which a substance has a Divine shape and divine volume...

Science DCP 1 2024-10-03

81 Items: netgaspushpullleftodorChopdullatomsforcespeedrightspeedcurveshapearrowtotalLightcolorsteammixedmetalshinywiresCrickOrtizoxygenchangefreezeelementNewtonsgravitysittingrollinglandingbubblesbubblesboilingRustingRottingtoastedbrittleductilethermalremainsscienceJohnsoncompoundhydrogennitrogenbalancedincreasedecreaseconstantfrictionswingingphysical...

Science Week Word Search 2024-06-26

80 Items: atomcelldatalawsmassscalebotanyburnerenergyfossilfunnelmattermotionprotonretorttheorytissuevolumebiologycircuitcontrolcuvettedensityelementgeologygravityneutronnucleusosmosisphysicspipetteproductzoologychemicalcompoundelectrongeneticsheredityorganismparticlereactanttesttubevariablevelocityastronomychemistryconductordiffusionmagnetismradiology...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

ICP Vocab 4 2025-02-26

16 Items: The ability to cause changeenergy, Energy due to motionIs force applied through a distanceThe rate at which energy is convertedThe ratio of output work to input workadvantage, The ratio of output force to input forceIs anything around which you can imagine a boundarypotential energy, Energy that is due to chemical bonds...

Energy Word Search 2025-05-01

10 Items: heat energymore kinetic energyless kinetic energyenergy of moving thingssaved energy to use laterpotential and kinetic energyenergy that travels in waveshow hot or cold something isenergy from food, fuel, or batteriesThe power to make things move or work

Year 7 so far! 2023-05-26

28 Items: Organelle that contains DNA (n)The smallest unit of matter (a)The force caused by gravity (w)Multiple atoms bonded together (m)Different atoms bonded together (c)Used to separate soluble solids (c)Change of state from solid to gas (s)Type of energy linked to movement (k)The unit of measurement for force (n)Change of state from gas to liquid (c)...

Nervous System 2025-02-11

23 Items: Relating to movementRelating to the synapseAnother term for a neuronUnpleasant sensory experienceStructure that detects stimuliSupporting cells of the nervous systemRelating to sensation or sensory organsThe control center of the nervous systemInsulating layer around some nerve fibersThe fundamental unit of the nervous system...

Science week 2024-07-01

80 Items: atomcelldatalawsmassscalebotanyburnerenergyfossilfunnelmattermotionprotonretorttheorytissuevolumebiologycircuitcontrolcuvettedensityelementgeologygravityneutronnucleusosmosisphysicspipetteproductzoologychemicalcompoundelectrongeneticsheredityorganismparticlereactanttesttubevariablevelocityastronomychemistryconductordiffusionmagnetismradiology...

Mindset Word Search 2025-05-20

5 Items: What happens when confidence meets clarity and action follows.The invisible framework shaping your actions, reactions, and success.The curated rhythm of your daily choices — from habits to aesthetics.What powers innovation, automates the mundane, and lives in your pocket?...

Redox Vocabulary (paired with Holt PDF Textbook) 2023-05-01

15 Items: site of reductionsite of oxidationelectric potentialThe gain of electronsThe disintegration of metalsone half of the overall redox reactionaccept electrons easily and are reducedtwo electrodes separated by an electrolyteThe loss, wholly or in part, of one or more electronscause reduction to happen and are themselves oxidized...

Chemical in our SDS inventory, or character from a '90s sci-fi/fantasy film? 2023-04-22

42 Items: cyraxecreaeosinsarekbeldargiemsahazorbhexxusmarlaxtsaintxayidexylenezeframzordonamevivearranoncasoronfirazyrhalavenjetvananinlaroovidrelprymattquelleksaxendatoluenevalorumzanosarmathesarmetatronmorpheuszephiransirolimushydroholicsolucorteftrisborateadviacentaurbufordtannencobasintegrathackerybinxinvegasustennanerdluckbupkus

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Disinfection Word Search 2023-01-14

20 Items: the action of making something clean.a chemical liquid that destroys bacteria.intended or suitable for more than once use.(staph) a bacterium with antibiotic resistance.smooth and sealed so liquid and air cannot move.get rid of something as no longer useful or desirable.designed to be used once and then disposed of or destroyed....

Physics and Chemistry Wonders 2025-04-14

10 Items: VALENCY : The combining power of an element to form chemical bonds.IONIZATION : The process of gaining or losing electrons to form ions.ISOTOPE : Atoms of the same element with different numbers of neutrons.INERTIA : The resistance of an object to a change in its state of motion....

Substance Abuse* 2024-12-18

11 Items: The percentage of alcohol in your blood.Psychological desire for the effects of a drug.The chemical in cannabis that makes you feel high.Something a person feels when they stop taking a drug.The organ in the body responsible for detoxifying alcohol.A group of drugs that includes Fentanyl, Codeine and Oxycodone...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-25

90 Items: StyeLiceSitzViralEdemaLaserTineaLymphEczemaImmuneAsthmaOcularSulfurHerpesAureusStressUlcerspilarisRosaceaAllergyPruriusSteroidPinkeyeScabiesBullousSimplexFatigueIllnessSurgeryGeneticsChemicalPerioralErythemaVascularPeroxideImpetigoRingwormAxillaryRetinoidHormonalAbrasionPyogenesDiabetesBlistersNaproxenInfectionKeratosisPsoriasisBacterialFilaggrin...

Aerospace Word Search 2022-09-22

77 Items: ivappdnacellraysscanmarsmoonnasarisktoolstormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganvesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareaerospaceastronautbiologistcolleague...

Science 2025-01-16

89 Items: labatomcelldatafactlawsmassdatumflaskphasescaleweighbeakerbotanyenergyfossilfunnelmattermotionretorttheorytissuevolumebiologyburetteclimatecontrolcuvetteelementgeologygravitymeasuremineralobservephysicspipettescienceweatherzoologychemicalgeneticsmoleculeorganismparticleresearchtesttubevariableastronomychemistryevolutionglasswaremagnetismPetridish...

Weathering erosion deposition 2022-11-03

46 Items: 91iceFLi'€7•07•glwindlavasoilrockwaterfaultmagmarOCKSfaultforcesfloodsmeltedgravityerosionerosionchangespassingphysicalchemicalglacierschanginglandformscoastlinecollidingmountainslandformsweatheringdepositionlandslidesconvergentearthquakehurricaneslava 13. solltransformationcracks 26. divergentsediments 45. pressuredeposition 6. glaciers...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-26

90 Items: LiceSitzStyeEdemaLaserLymphTineaViralAsthmaAureusEczemaHerpesImmuneOcularStressSulfurUlcersAllergyBullousFatigueIllnessPilarisPinkeyePruriusRosaceaScabiesSimplexSteroidSurgeryAbrasionAxillaryBlistersChemicalDiabetesErythemaGeneticsHormonalImpetigoNaproxenPerioralPeroxidePyogenesRetinoidRingwormVascularAcyclovirAntiviralBacterialFilaggrinIbuprofen...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

CHEMISTERY 2023-05-28

10 Items: Collect and analyze evidence from a crime scene.Are responsible for researching marine ecosystems.Study and analyze both natural and manmade items to learn more.Responsible for examining and monitoring the presence of chemicals in water.Study the appearance, movement, and effect of chemical compounds on the earth....

Nutrition assignment 2024-11-29

10 Items: not made by mannutritious substancesomeone with a high IQa substance added to foodsomething said that is falsesomething that provides energythe body has a chemical reactionwhat you do when you go to the storesomeone that only eats dairy and plant productssomething that enhances something when added to food

Word Search puzzle grade 6 2024-12-06

20 Items: A new idea or creationPowers your home and devicesA story about someone’s lifeA home for animals or plantsA giant reptile from the pastThe study of stars and planetsA mountain that erupts with lavaTurning waste into something newThe force that keeps us on EarthAn exciting journey or experienceA group of people living together...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

7th Grade Science 2024 2024-05-01

100 Items: gasmassmasspureheatrockfuelteentalkmuirmodelscalegramsgizmoclaimsolidatomscyclewaterfloodimpactmattervolumelitersstatesliquidenergyvolumesymbolpangeawegnerokeefefossilcarbonhazardmiddleschoolproductpatternconceptcelciusnearpodquizzizkineticformulamineralmixtureerosioncrystalpolymermonomerigneousaquifervolcanospeciesresourceevidencepressureelements...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

spelling list 2024-09-13

14 Items: having 2 leaveshaving 8 leavesto strip of leaveshaving five leavesa three leaf cloverhaving only one leafpages of a manuscripta thin sheet of metalall the leaves of a plantthe process of forming a leafa leaf composed of four leafletsa chemical that causes green leaves to dropa portable case for carrying sheets of paper...

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Sci 2024-05-21

10 Items: of, worked by, charged with, or producing electricity.energy which a body possesses by virtue of being in motion.the chemical element of atomic number 30, a silvery-white metala coherent, typically large body of matter with no definite shape.the energy contained within a system that is responsible for its temperature...

Fundamental Forces 2022-10-25

5 Items: force that holds together the protons and the neutrons.force that determines the orbits of the planets around the Sun.force responsible for the attraction and repulsion of opposite electric charges.any of the four basic forces that govern how objects or particles interact and how some particles break down....

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

Final Review Word Search 2024-05-16

15 Items: solid to a gasgas to a solidEnergy of motionMr.Ferdinandi's birthdayhow tightly packed atoms arethe building blocks of matterwhen thermal energy is releasedwhen thermal energy is releasedhow much space an object takes upthis goes on the y axis of a graphthe ability to do work or cause changechange in the chemical structure of matter...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Atom Word Search 2025-04-16

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Bond Word Search 2023-08-14

9 Items: It's a type of clayDon't do drugs kids!"What's the ______ dear"the names ____ James ____Einsteins______ of relativityYou can put them on your fridge(of a reaction or process) accompanied by the release of heat.each of two or more different physical forms in which an element can exist...

Kitchen Scientist 2025-01-13

9 Items: Heat from the sunBacteria converts sugars to acidTogetherness due to movement and energyMeasure of a fluid's resistance to flowWheat protein that gives a chewy texturesubstance found in the cell walls of algaeFluids that break Newton's law of viscosityMixture of two liquids that normally do not mix...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

health 2024-12-16

13 Items: bigskinnynon-meat eatersugar moleculesyou are thirstycapable of dissolving in waterolive, safflower, and sunflower oila solid chemical element or compoundinformation of the number of grams of fat etcthe act or process of nourishing or being nourishedthe things that a person has to do or deal with at one time...

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Biological molecules 2024-12-18

10 Items: I contain three fatty acidsI am the pentose sugar inside RNAI am a base only in a DNA nucleotideI am what an active site is to the substrateI contain a phosphate group and two fatty acids.I transfer genetic information from the DNA to the ribosomes.I break hydrogen bonds between bases and unwind the double helix....

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Vocab 16 ICP 2025-04-24

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Names from the Class 2024-05-21

12 Items: Snowy's humanStockroom heroMakes RCO₂H from ROHMore substituted alkeneViktor's C-C bond forming name reactionThe other voice in the IR video tutorialAte the edible chemical in a safety demoSilent scientist in the always in the labOne of the voices in the IR video tutorialDraw this projection to visualize E2 anti-beta H...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...