chemical reactions Word Searches

Alcohol Vocabulary 2024-12-18

20 Items: E-cigarettesWhen you stop smokingEnlarged stuffy lungsA toxic oily substanceAn electronic cigaretteA smoldering end of a productA type of e-cigarette companyRaises nervous levels severelyCauses cancer in living tissueTobacco that hasn't been burnedWhite patches on a mucous membraneWhen people exhale smoke out of it...

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Matter and Its Interactions 2024-08-27

23 Items: a change downwarda process of becoming largerThe process of becoming a vapor.The amount of space something takes up.Anything that has mass and takes up spaceSusceptible of being dissolved in a liquidThe process where water vapor becomes liquid.A combination of two or more different substances....

Lesson 5 2023-08-25

28 Items: 의견제안자원대회주제기사줄이다버리다알맞게대부분비닐봉지쓰레기통분리하다사라지다화학물질타기,타다재활용하다놓다,장소의식,인식식물,심다생각나게하다밝은,영리한높이다,올리다절약하다,구하다보호하다,지키다재사용할 수 있는원치 않는,불필요한

Unit 1 POM- Structure of Matter 2024-08-02

21 Items: A homogenous mixtureThe ability to do workAtoms with the same number of protonsAnything that has mass and takes up spaceTwo or more atoms that are chemically bondedThe substance that the solute is dissolved inThe amount of matter in an object or substanceThis subatomic particle determines the element...

College of Engineering New Year Celebration Word Search 2024-12-23

70 Items: ESDCCNM2GBSFLEADRCivilStaffDavisCorsiEquityFutureEnergyHealthCoffeeAlumniDesignKemperBainerGhausiRespectClimateAvenueEFacultyCultureNewYearTEAMLabESEARCHKindnessOpennessResearchMobilityInspiredComputerChemicalStudentsEducationCommunitySolutionsDiversityInclusiveImpactfulAerospaceNextLevelInnovationTechnologyMechanicalBiomedicalElectricalBiological...

Breathing system 2024-04-25

12 Items: Organ that mucus comes fromAir passages inside the lungsThe major muscle of respirationThe chemical that you breath outThe chemical that you use to breathTiny air sacs at the end of the bronchiolesA cage of bones that protect your lungs and heartThe pair of spongy, pinkish-gray organs in your chest...

Final Exam Word Search 2024-05-17

68 Items: gasmassbondyearnamelighttablesolidlewisstateionicaniongroupliquidmatterfusionperiodcolumnsymbolgalaxynumberatomiccationvolumespiralprotonfamilymeltingnucleusneutralproductneutronboilingdensityvalenceclustermixturenonmetalpropertynotationequationpositivechemicaluniversecovalentcompoundbalancedreactantfreezingphysicalperiodicelectronreactionnegative...

Chapter 5 Pivot Point Chemistry 2014-06-22

71 Items: saltacidmsdsgasescohnsatomsaminotracesoapswatermattersolidsacidicrinsesaminesliquidsorganicprotonskeratinproteinpeptideproteinpowdersshampoophysicalchemicalelementsneutronscompoundalkalinehydrogenhumiditysidebondbalancedbacteriachlorineshampoosporosityammoniumsolventsinorganicelectronsmoleculesdisulfidehydroxidenitrazineemulsionsointmentssebaceous...

ICP Vocab 15 2025-03-14

15 Items: A change of one substance to anotherType of matter with a fixed compositionThe same thing as a homogeneous mixtureA substance made up of atoms that are all alikeA mixture that remains constantly and uniformly mixedA mixture in which different materials remain distinctA heterogeneous mixture with particles that never settle...

Monomer & Polymer Ch:11 2025-03-19

14 Items: MMAA nail file or bufferWhat is always coming but never arrives?Used to start the chain reaction that leads to curingHow many grains I'd sand are on the file per square inchWhat never asks a question but gets answered all the time?MMA creates the hardest and _____________ nail enhancement.When artificial products lift up or pull away from the nail...

The Bigger One 2022-09-30

72 Items: agendacinemaabandonabolishadviseralcoholarrivalarticleaveragebenefitcabinetcapitalcenturycharitycuriousdeficitdeliverdensitydepositdevelopabsoluteactivateallocateambitionapprovalaudiencebehaviorchemicalclassifycomputerconsidercreationcustomerdatabasedecisiondefenderdesignerdialoguedirectoradmissionadvantageadventureafternoonapartmentapplicant...

Living Systems Investigation 1 & 2 2025-04-21

24 Items: All of the water on Earth.Anything that takes up spaceA collection of interacting parts.To use again or continue a process.The rock and mineral part of Earth.A mixture of decayed organic matter.An organism that makes its own food.The layer of gases surrounding Earth.A reddish-brown worm found in decaying material....

Semester 2 Final Word Search 2015-05-15

74 Items: winroothaircellcellwallareaheattubefoodorganstomasugaraminoacidsxylemlightovuleovaryspermchaintissuephloempollenpetalsstigmauterusenergycarbonnucleussurfaceallelesdiploidhaploidmeiosismitosisanthersgeneticbiomassdioxidegenotypedominantmutationchemicalproducerconsumercytoplasmnutritiondiffusionmesophyllphenotyperecessiveovulationvariationherbivore...

SM F 2025-03-27

73 Items: verybeginexcelferryofferpurserefersoundadvisechordschorusdifferechoesforbidforgotgrowthoriginplantssafetysuffervisualallowedcurtailforgiveforsakehealthymodestyomittedunhappyallottedanchoredapproachbackachebeginnerchemicaldisasterdiscipleexcelledforsakenmarriagemilitaryoriginaltransferallotmentbeginningchemistrycommitteeexcellentforbiddenforgotten...

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Ch 18 vocab Brianna Hart 2025-05-09

9 Items: Compound that is composed of two elements.Force that holds atoms together in a compound.Attraction formed between atoms when they share electrons.Positively or negatively charged, covalently bonded group of atoms.Charged particle that has either more or fewer electrons than protons....

Dillon Singleton Ch.18 Vocab 2025-05-08

9 Items: Compound that is composed of two elements.Force that holds atoms together in a compound.Attraction formed between atoms when they share electrons.Positively or negatively charged, covalently bonded group of atoms.Charged particles that has either more or fewer electrons than protons....

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

Science review 2014-01-13

78 Items: SungasnewdatadarkstarbabydustmarsnasamoonfulltideneapapronEarthrockyvenusplutocometspacemethodglovessafetyhazardplanetnebulaspiralbarredheliumoxygencarbonSaturnUranusKuipermeteortheoryphaseswaxingwaningspringgogglesmercuryJupiterNeptunestationbigbangquartergibbouslowtidechemicalconstantuniversemilkywayemissionhydrogennitrogenasteroidcrescent...

1. Word Search 2024-04-04

35 Items: BasicIonicAqueousGaseousAlkaline9.dilute17.polarSaturated- ТвердыйInorganic5.chemical14.neutral15.organic26.viscous7.corrosive13.isotopic- Токсичный27.volatile28.aromatic10.flammable16.oxidative- СубатомныйNonflammable8.crystalline- Растворимый30.catalystic31.conductive33.dehydrated6.concentrated18.radioactive25.transparent- Синтетический...

Immunology Word Search 2024-03-13

15 Items: Immunoglobulin producing cellsProtein encoded by HIV gag geneGold standard test for screening SLECells responding to parasitic infectionsSarcoma associated with HHV-8 infectionsAntibody is in excess compared to antigenMost abundant immunoglobulin in adult serumRegion of immunoglobulin that binds antigensMediator of Type I hypersensitivity reactions...

types of reaction 2023-05-04

4 Items: reactionsreactionsreactionsreactions

Rain/Easter Articles Word List 2024-03-24

9 Items: a small piecewater as a gasconnected withwhen a holiday is celebratedsomething that can’t be seena person who creates a companywhen a place overflows with watersomething made by a chemical processhow water changes between different forms

Matter unit 1 5th grade 2024-08-27

9 Items: how hot or cold something isbe able to be dissolved in a liquidanything that has mass takes up spacethe amount of space something takes upmatter in which a substance does not have a Divine shape or volumestate of matter in which a substance has a Divine shape and divine volume...

Science DCP 1 2024-10-03

81 Items: netgaspushpullleftodorChopdullatomsforcespeedrightspeedcurveshapearrowtotalLightcolorsteammixedmetalshinywiresCrickOrtizoxygenchangefreezeelementNewtonsgravitysittingrollinglandingbubblesbubblesboilingRustingRottingtoastedbrittleductilethermalremainsscienceJohnsoncompoundhydrogennitrogenbalancedincreasedecreaseconstantfrictionswingingphysical...

Science Week Word Search 2024-06-26

80 Items: atomcelldatalawsmassscalebotanyburnerenergyfossilfunnelmattermotionprotonretorttheorytissuevolumebiologycircuitcontrolcuvettedensityelementgeologygravityneutronnucleusosmosisphysicspipetteproductzoologychemicalcompoundelectrongeneticsheredityorganismparticlereactanttesttubevariablevelocityastronomychemistryconductordiffusionmagnetismradiology...

Suspensions Word Search 2025-03-26

35 Items: ion with (-) chargealso known as basesgas with pungent ordereasily absorbs moisturesubatomic with (+) chargecontraction of surface agentsion with (+) electrical chargeparticles with negative chargemixture of 2 or more substancessimplest form of chemical matterrapid oxidation of heat and lightsubatomic particles with no charge...

Energy Word Search 2025-05-01

10 Items: heat energymore kinetic energyless kinetic energyenergy of moving thingssaved energy to use laterpotential and kinetic energyenergy that travels in waveshow hot or cold something isenergy from food, fuel, or batteriesThe power to make things move or work

ICP Vocab 4 2025-02-26

16 Items: The ability to cause changeenergy, Energy due to motionIs force applied through a distanceThe rate at which energy is convertedThe ratio of output work to input workadvantage, The ratio of output force to input forceIs anything around which you can imagine a boundarypotential energy, Energy that is due to chemical bonds...

Year 7 so far! 2023-05-26

28 Items: Organelle that contains DNA (n)The smallest unit of matter (a)The force caused by gravity (w)Multiple atoms bonded together (m)Different atoms bonded together (c)Used to separate soluble solids (c)Change of state from solid to gas (s)Type of energy linked to movement (k)The unit of measurement for force (n)Change of state from gas to liquid (c)...

Nervous System 2025-02-11

23 Items: Relating to movementRelating to the synapseAnother term for a neuronUnpleasant sensory experienceStructure that detects stimuliSupporting cells of the nervous systemRelating to sensation or sensory organsThe control center of the nervous systemInsulating layer around some nerve fibersThe fundamental unit of the nervous system...

Science week 2024-07-01

80 Items: atomcelldatalawsmassscalebotanyburnerenergyfossilfunnelmattermotionprotonretorttheorytissuevolumebiologycircuitcontrolcuvettedensityelementgeologygravityneutronnucleusosmosisphysicspipetteproductzoologychemicalcompoundelectrongeneticsheredityorganismparticlereactanttesttubevariablevelocityastronomychemistryconductordiffusionmagnetismradiology...

Redox Vocabulary (paired with Holt PDF Textbook) 2023-05-01

15 Items: site of reductionsite of oxidationelectric potentialThe gain of electronsThe disintegration of metalsone half of the overall redox reactionaccept electrons easily and are reducedtwo electrodes separated by an electrolyteThe loss, wholly or in part, of one or more electronscause reduction to happen and are themselves oxidized...

Chemical in our SDS inventory, or character from a '90s sci-fi/fantasy film? 2023-04-22

42 Items: cyraxecreaeosinsarekbeldargiemsahazorbhexxusmarlaxtsaintxayidexylenezeframzordonamevivearranoncasoronfirazyrhalavenjetvananinlaroovidrelprymattquelleksaxendatoluenevalorumzanosarmathesarmetatronmorpheuszephiransirolimushydroholicsolucorteftrisborateadviacentaurbufordtannencobasintegrathackerybinxinvegasustennanerdluckbupkus

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Disinfection Word Search 2023-01-14

20 Items: the action of making something clean.a chemical liquid that destroys bacteria.intended or suitable for more than once use.(staph) a bacterium with antibiotic resistance.smooth and sealed so liquid and air cannot move.get rid of something as no longer useful or desirable.designed to be used once and then disposed of or destroyed....

Atomic Structure & Periodic Properties 2024-11-25

20 Items: The energy required to remove an electron from an atom.The distribution of electrons among the orbitals of an atom.The energy change that occurs when an atom gains an electron.The outermost electrons of an atom, involved in chemical bonding.Energy levels surrounding the nucleus where electrons are located....

Physics and Chemistry Wonders 2025-04-14

10 Items: VALENCY : The combining power of an element to form chemical bonds.IONIZATION : The process of gaining or losing electrons to form ions.ISOTOPE : Atoms of the same element with different numbers of neutrons.INERTIA : The resistance of an object to a change in its state of motion....

Substance Abuse* 2024-12-18

11 Items: The percentage of alcohol in your blood.Psychological desire for the effects of a drug.The chemical in cannabis that makes you feel high.Something a person feels when they stop taking a drug.The organ in the body responsible for detoxifying alcohol.A group of drugs that includes Fentanyl, Codeine and Oxycodone...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-25

90 Items: StyeLiceSitzViralEdemaLaserTineaLymphEczemaImmuneAsthmaOcularSulfurHerpesAureusStressUlcerspilarisRosaceaAllergyPruriusSteroidPinkeyeScabiesBullousSimplexFatigueIllnessSurgeryGeneticsChemicalPerioralErythemaVascularPeroxideImpetigoRingwormAxillaryRetinoidHormonalAbrasionPyogenesDiabetesBlistersNaproxenInfectionKeratosisPsoriasisBacterialFilaggrin...

Aerospace Word Search 2022-09-22

77 Items: ivappdnacellraysscanmarsmoonnasarisktoolstormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganvesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareaerospaceastronautbiologistcolleague...

Science 2025-01-16

89 Items: labatomcelldatafactlawsmassdatumflaskphasescaleweighbeakerbotanyenergyfossilfunnelmattermotionretorttheorytissuevolumebiologyburetteclimatecontrolcuvetteelementgeologygravitymeasuremineralobservephysicspipettescienceweatherzoologychemicalgeneticsmoleculeorganismparticleresearchtesttubevariableastronomychemistryevolutionglasswaremagnetismPetridish...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

Weathering erosion deposition 2022-11-03

46 Items: 91iceFLi'€7•07•glwindlavasoilrockwaterfaultmagmarOCKSfaultforcesfloodsmeltedgravityerosionerosionchangespassingphysicalchemicalglacierschanginglandformscoastlinecollidingmountainslandformsweatheringdepositionlandslidesconvergentearthquakehurricaneslava 13. solltransformationcracks 26. divergentsediments 45. pressuredeposition 6. glaciers...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-26

90 Items: LiceSitzStyeEdemaLaserLymphTineaViralAsthmaAureusEczemaHerpesImmuneOcularStressSulfurUlcersAllergyBullousFatigueIllnessPilarisPinkeyePruriusRosaceaScabiesSimplexSteroidSurgeryAbrasionAxillaryBlistersChemicalDiabetesErythemaGeneticsHormonalImpetigoNaproxenPerioralPeroxidePyogenesRetinoidRingwormVascularAcyclovirAntiviralBacterialFilaggrinIbuprofen...

CHEMISTERY 2023-05-28

10 Items: Collect and analyze evidence from a crime scene.Are responsible for researching marine ecosystems.Study and analyze both natural and manmade items to learn more.Responsible for examining and monitoring the presence of chemicals in water.Study the appearance, movement, and effect of chemical compounds on the earth....

Nutrition assignment 2024-11-29

10 Items: not made by mannutritious substancesomeone with a high IQa substance added to foodsomething said that is falsesomething that provides energythe body has a chemical reactionwhat you do when you go to the storesomeone that only eats dairy and plant productssomething that enhances something when added to food

Word Search puzzle grade 6 2024-12-06

20 Items: A new idea or creationPowers your home and devicesA story about someone’s lifeA home for animals or plantsA giant reptile from the pastThe study of stars and planetsA mountain that erupts with lavaTurning waste into something newThe force that keeps us on EarthAn exciting journey or experienceA group of people living together...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

7th Grade Science 2024 2024-05-01

100 Items: gasmassmasspureheatrockfuelteentalkmuirmodelscalegramsgizmoclaimsolidatomscyclewaterfloodimpactmattervolumelitersstatesliquidenergyvolumesymbolpangeawegnerokeefefossilcarbonhazardmiddleschoolproductpatternconceptcelciusnearpodquizzizkineticformulamineralmixtureerosioncrystalpolymermonomerigneousaquifervolcanospeciesresourceevidencepressureelements...

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

spelling list 2024-09-13

14 Items: having 2 leaveshaving 8 leavesto strip of leaveshaving five leavesa three leaf cloverhaving only one leafpages of a manuscripta thin sheet of metalall the leaves of a plantthe process of forming a leafa leaf composed of four leafletsa chemical that causes green leaves to dropa portable case for carrying sheets of paper...

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Fundamental Forces 2022-10-25

5 Items: force that holds together the protons and the neutrons.force that determines the orbits of the planets around the Sun.force responsible for the attraction and repulsion of opposite electric charges.any of the four basic forces that govern how objects or particles interact and how some particles break down....

Sci 2024-05-21

10 Items: of, worked by, charged with, or producing electricity.energy which a body possesses by virtue of being in motion.the chemical element of atomic number 30, a silvery-white metala coherent, typically large body of matter with no definite shape.the energy contained within a system that is responsible for its temperature...

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Final Review Word Search 2024-05-16

15 Items: solid to a gasgas to a solidEnergy of motionMr.Ferdinandi's birthdayhow tightly packed atoms arethe building blocks of matterwhen thermal energy is releasedwhen thermal energy is releasedhow much space an object takes upthis goes on the y axis of a graphthe ability to do work or cause changechange in the chemical structure of matter...

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Bond Word Search 2023-08-14

9 Items: It's a type of clayDon't do drugs kids!"What's the ______ dear"the names ____ James ____Einsteins______ of relativityYou can put them on your fridge(of a reaction or process) accompanied by the release of heat.each of two or more different physical forms in which an element can exist...

Kitchen Scientist 2025-01-13

9 Items: Heat from the sunBacteria converts sugars to acidTogetherness due to movement and energyMeasure of a fluid's resistance to flowWheat protein that gives a chewy texturesubstance found in the cell walls of algaeFluids that break Newton's law of viscosityMixture of two liquids that normally do not mix...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

Atom Word Search 2025-04-16

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

health 2024-12-16

13 Items: bigskinnynon-meat eatersugar moleculesyou are thirstycapable of dissolving in waterolive, safflower, and sunflower oila solid chemical element or compoundinformation of the number of grams of fat etcthe act or process of nourishing or being nourishedthe things that a person has to do or deal with at one time...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Vocab 16 ICP 2025-04-24

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Biological molecules 2024-12-18

10 Items: I contain three fatty acidsI am the pentose sugar inside RNAI am a base only in a DNA nucleotideI am what an active site is to the substrateI contain a phosphate group and two fatty acids.I transfer genetic information from the DNA to the ribosomes.I break hydrogen bonds between bases and unwind the double helix....

Names from the Class 2024-05-21

12 Items: Snowy's humanStockroom heroMakes RCO₂H from ROHMore substituted alkeneViktor's C-C bond forming name reactionThe other voice in the IR video tutorialAte the edible chemical in a safety demoSilent scientist in the always in the labOne of the voices in the IR video tutorialDraw this projection to visualize E2 anti-beta H...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

Vocab 1.1 2024-09-06

16 Items: A brief, indirect referencethe universal message or big ideaof View the type of narration usedappeals to our five physical sensesRepresenting a thing or idea as a personthe main problem or struggle within a storyAn expression that must be learned as a whole.the sequence of events that take place in a story...

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Chemistry and Water Cycle 2024-10-13

29 Items: Group 1 Metalsreactions with oxygenAll frozen water on the EarthSum of all water found on EarthSubstances containing non-metalsSubstances only containing metalslayer of the planet where life existsthe substances produced in a reactionThe horizontal row of the Periodic Tablemeasure of the amount of water in the air...

Writer 2022-11-05

11 Items: the lower jawsurgical removal of bone or tissueswelling; usually secondary to infectionsubstance that joins two or more surfacesa relatively narrow tubular passage or channelthe hard and soft tissues forming the roof of the mouthlightening of the teeth using a chemical oxidizing agentmissing tooth structure due to decay, erosion or abrasion...

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Sociology Chapter 4 Vocabulary 2025-01-28

13 Items: the process of learning to participate in a groupthe part of the self formed through socializationset of individuals of roughly the same age and interestschildren begin to imitate behaviors without understanding whychildren begin to act in ways they believe other people wouldmeans of communication designed to reach the general population...

Ch. 6 word search 2025-04-11

10 Items: ____ is a another word for your feelings.People who have ____attitudes are more likely to be active.Moderate physical activity is equal in intensity to brisk ____.The MET is a term used to describe the ____ of physical activity.Getting enough regular physical activity is important in maintaining a healthy ____....

Intro to Physics and Matter & Interactions 2023-06-15

7 Items: Career related to Physics.Any quality or characteristic.Physics studies the ________ world.Everything around us is made of _______.Is used in Physics to model observations and make predictions.An example of a chemical property of matter. Related to how dangerous a substance can be....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Mass Word Search 2024-05-17

13 Items: The main liquid on our planet.The point at which liquids boil.A chemical reaction that is very hot.The things that make up our universe.Vaporized liquid as a result of boiling.How much gravity pulls down on something.the degree of compactness of a substance.How fast something or someone is traveling.The resistance that stops objects from moving....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Biology S1 Exam Review 2024-12-11

31 Items: water lovingself feederssplitting wateradding phosphatesplitting glucoseenzyme that makes ATPaffinity for electronsmore stiff fatty acidsreaction releases energyorganelle that holds DNAcycle with Acetyl CoA inputtransport that requires energybreaking down larger moleculesNADH and FADH2 are electron...organelle that synthesizes proteins...

Energy Review Word Search 2025-05-12

9 Items: Energy possessed by hot objects.Form of energy possessed by moving objects.Energy stored by doing work against a force.Energy stored in chemical elements and compounds.A way energy is transferred in the form of sound.A way to transfer energy using an electric current.Energy stored by lifting an object against gravity....

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Health and Wellness 2025-04-14

10 Items: WELLNESS : The state of being in good health.IMMUNITY : The body's ability to resist diseases.HYGIENE : Practices that keep you clean and healthy.MENTALHEALTH : Emotional and psychological well-being.VACCINATION : A shot that helps protect you from diseases.HYDRATION : The process of absorbing enough water for health....

Dynamics Word Search 2022-06-18

98 Items: machohmspowervoltsrangetensioninertiavoltagecurrentamperesammeterdynamicscircuitsvectors-distancenet-forceradiationhalf-lifeharmonicsohm’s-lawvoltmeterkinematicsbeta-decaysoundwavessupersonicresistancemax-heightforce-fieldlatent-heatatomic-massalpha-decaygamma-decayreflectionswavelengthselectricitynormal-forcetrigonometrydisplacementacceleration...

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

Unit 1 Review 2024-09-03

10 Items: When energy is movedThis is stored energyThis is the energy of motionThese carry energy from one place to anotherType of energy stored in the bonds between atomsWhat it's called when energy changes from one form to anotherThis is done to an object to give it Elastic potential energyGravitational potential energy is affected by these two things...

Skin Disorders 2025-02-11

15 Items: An intense itching sensation.Small, flat, discolored spots on the skin.Skin abrasions caused by repeated scratching.A collection of pus that forms due to bacterial infection.An oily substance secreted by glands to keep skin hydrated.Immature parasitic insects or worms, which can cause skin infections....

The carboniferous period 2023-10-05

10 Items: Lasted about 60 million yearsthe big land mass before pangeabefore it was called just oxyegeneplant from the carboniferous perioda supercontnant formed from gondwanaa sea animal during the carboniferous periodcorals One of the carboniferous periods animalsa reasource from the earth that is nonrenweable....