chemical reactions Word Searches

Pathophysiology - Ch. 15 + 16 Terms 2024-11-05

20 Items: Double visionBlood glucose levels riseParalysis of the upper eyelidA ringing or buzzing in the earsExcessive thirst caused by dehydrationExcessive amounts of ketones in the bloodActivated by a change in chemical concentrationInvoluntary, abnormal rapid movement of one or both eyesStimulates appetite; lack of nutrients entering the cells...

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

Melting, Word Search 2024-05-13

1 Item: FAMILY, COMPOUND, PROTON, PHYSICAL CHANGE, GAS, MATTER, CHEMICAL CHANGE, FREEZING, NEUTRONS, MOLECULES, ELEMENT, SOLID, PRODUCT, ATOMS, GROUPS, NUCLEUS, METALS, PLASMA, PERIODS, LIQUID

ENGINEERING + 2024-08-20

1 Item: AERONAUTICAL BIOMEDICAL SOFTWARE COMPUTER MECHANICAL ELECTRICAL CHEMICAL SAFETY DANGER FALL LOUD FIRE MEDICAL FORKLIFT GLOVES EYEWEAR HEARING BREATHING RADIATION RESPIRATOR EMERGENCY

Chem-is-tree Holiday Word Search 2024-12-18

14 Items: Major flavor component of clovesMajor flavor component of cinnamonThe alkaloid compound found in mistletoeThis compound gives ginger its pungent odorThe chemical in peppermint that makes your mouth feel coldType of compounds that give poinsettia leaves their red colorThis Group 13 Period 4 metal is frequently found in LED lights...

1. Word Search 2025-03-17

1 Item: Chemical Characteristics 2. Cladogram 3. Dichotomous key 4. domain 5. Genus 6. Kingdom 7. Physical Characteristics 8. phylum 9. species 10. taxonomy

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

hi 2024-05-17

14 Items: the circular motion of an object around its centerthe amount of space occupied by a sample of matterThe SI derived unit used to measure energy or work.a positively charged region at the center of the atoma chemical element with symbol Ag and atomic number 47.a force which tries to pull two objects toward each other...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

GEOLOGIC PROCESSES 2024-08-25

1 Item: Exogenous Weathering Erosion Sedimentation Deposition Endogenous Process Chemical Physical Disintegration Rock Temperature Pressure Decomposition Compound Mineral Soil Atmospheric Oxidation Substance Oxygen Hydrolysis Water Acidification Organism Earth Gr

Sanremo artists 2024-05-21

108 Items: ldabugoemmagaiaModàollyrikiwillarisaclaraelisafasmafedezghaliiramalazzanoemirkomisethusharitoscayumanarieteblancoelodieghemonIl TreLa SadmadamemorganrandomultimobigmamadiodatogeoliergiorgiaIl VololevantemahmoodmaninnirancoretananaiAnna OxaannalisagazzelleGio EvanMåneskinMr. RainColla ZioComa_CosegianmariaMax GazzènegramaroRenga NekErmal Meta...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

First Aid Basics 2024-09-23

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Unit 3 Vocab 2023-09-14

20 Items: (adj) roundabout, not direct(v) to make amends, make up for; to avert(v) to make easy, cause to progress faster(v) to have an intense dislike or hatred for(v) to assign or refer to (as a cause or source), attribute(adj) bitter, sarcastic; highly caustic or biting; acerbic.(n) a natural inclination or tendency; penchant or propensity....

Twenty One Pilots MOSTLY songs clues 2025-02-12

41 Items: to floata red gemto go backto get darkera tight necklaceto decorate againthe day after Fridaya door that is a trapthe place you were bornwhat a forest is made ofto sink in water quicklyyou watch TV shows on thisa compromise between peoplea really really bad headachemany tiny peices of somethinga bunch of trees in one place...

AT THE BEAUTICIAN 2025-02-05

17 Items: DefinitionThe process of replenishing the skin with moisture to keep it soft, plump, and healthy.The process of removing dead skin cells from the surface of the skin to improve texture and appearance.A product used to hydrate and lock in moisture to the skin, helping to prevent dryness and keep skin smooth....

Contagious Word Search 2023-05-28

22 Items: Adnormal hair lossThe highest point of the headRod-shaped, spore-producing bacteriaBacteria that are harmful and cause diseaseThe study of hair and its diseases and disordersCovers the top and sides of the head and consists of six bonesThe process of converting living skin cells into hard proteins...

deffinitions 2023-11-23

10 Items: critical or mocking in an indirect or sarcastic way.needing much effort or skill to accomplish, deal with, or understand.a nuclear weapon improvised from radioactive nuclear waste material and conventional explosives.heavy material, such as gravel, sand, iron, or lead, placed low in a vessel to improve its stability....

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

Water 2023-05-24

29 Items: Xylem or phloemNegatively charged ionPositively charged ionlow enough for ice to floatAllows water to form its bondsPolar and ionic molecules; asymmetricalReaction where water molecule is releasedBonds where two non metals share an electronNon-polar and non-ionic molecules; symmetricalwater sticks to itself; the same as surface tension...

EPD Word Search 2022-09-10

35 Items: Protocol 128112 _______ PersonDeterminant 105-B-4Determinant 113-B-3Determinant 118-D-3Determinant 123-B-1Determinant 132-D-1130 Theft (________)Gross and wanton indecency110 _____ (break and enter)119 Harassment / _______ / Threat102 Abuse / Abandonment / ________Examples are needles, syringes, bongs, and pipes...

Illicit Drugs - Daily Review 2023-08-22

22 Items: The most common reason why people start to take illicit drugs. (9)Drugs that alter or distort the brain's perception of reality. (13)Drugs that speed up the Central Nervous System (CNS) responses. (10)Drugs that slow down the Central Nervous System (CNS) responses. (11)Drugs with multiple effects on the Central Nervous System (CNS). (5-6-5)...

asdf 2024-09-11

32 Items: D=m/vRock that forms as magma coolsRock that forms from heat and pressurebuilding Process of creating mountainsboundary Where two tectonic plates meet.Most sedimentary rocks form in layers known as ________.The process that turns any rock into magma by adding heat.Occurs when sediments settle on the ground or a body of water...

US MILITARY 2024-12-29

44 Items: Focused on air and space operations.The newest branch, established in 2019, focusing on space operations.The largest and oldest branch, responsible for land-based military operations.A term used to describe military personnel who die during combat operations. (abbr)...

Series 6 Review 2023-07-19

75 Items: accountA radio interview is a public _________Rule 147 is regarding _______ offeringsSelling group members are paid a selling ______A final prospectus is also known as a _______ prospectusThe firm in which must complete the transfer of an accountThe “A” under discretionary orders that describes buy or sell...