chemical reactions Word Searches

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Biological molecules 2024-12-18

10 Items: I contain three fatty acidsI am the pentose sugar inside RNAI am a base only in a DNA nucleotideI am what an active site is to the substrateI contain a phosphate group and two fatty acids.I transfer genetic information from the DNA to the ribosomes.I break hydrogen bonds between bases and unwind the double helix....

Names from the Class 2024-05-21

12 Items: Snowy's humanStockroom heroMakes RCO₂H from ROHMore substituted alkeneViktor's C-C bond forming name reactionThe other voice in the IR video tutorialAte the edible chemical in a safety demoSilent scientist in the always in the labOne of the voices in the IR video tutorialDraw this projection to visualize E2 anti-beta H...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

Vocab 1.1 2024-09-06

16 Items: A brief, indirect referencethe universal message or big ideaof View the type of narration usedappeals to our five physical sensesRepresenting a thing or idea as a personthe main problem or struggle within a storyAn expression that must be learned as a whole.the sequence of events that take place in a story...

Chemistry and Water Cycle 2024-10-13

29 Items: Group 1 Metalsreactions with oxygenAll frozen water on the EarthSum of all water found on EarthSubstances containing non-metalsSubstances only containing metalslayer of the planet where life existsthe substances produced in a reactionThe horizontal row of the Periodic Tablemeasure of the amount of water in the air...

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Writer 2022-11-05

11 Items: the lower jawsurgical removal of bone or tissueswelling; usually secondary to infectionsubstance that joins two or more surfacesa relatively narrow tubular passage or channelthe hard and soft tissues forming the roof of the mouthlightening of the teeth using a chemical oxidizing agentmissing tooth structure due to decay, erosion or abrasion...

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Intro to Physics and Matter & Interactions 2023-06-15

7 Items: Career related to Physics.Any quality or characteristic.Physics studies the ________ world.Everything around us is made of _______.Is used in Physics to model observations and make predictions.An example of a chemical property of matter. Related to how dangerous a substance can be....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Mass Word Search 2024-05-17

13 Items: The main liquid on our planet.The point at which liquids boil.A chemical reaction that is very hot.The things that make up our universe.Vaporized liquid as a result of boiling.How much gravity pulls down on something.the degree of compactness of a substance.How fast something or someone is traveling.The resistance that stops objects from moving....

Biology S1 Exam Review 2024-12-11

31 Items: water lovingself feederssplitting wateradding phosphatesplitting glucoseenzyme that makes ATPaffinity for electronsmore stiff fatty acidsreaction releases energyorganelle that holds DNAcycle with Acetyl CoA inputtransport that requires energybreaking down larger moleculesNADH and FADH2 are electron...organelle that synthesizes proteins...

Dynamics Word Search 2022-06-18

98 Items: machohmspowervoltsrangetensioninertiavoltagecurrentamperesammeterdynamicscircuitsvectors-distancenet-forceradiationhalf-lifeharmonicsohm’s-lawvoltmeterkinematicsbeta-decaysoundwavessupersonicresistancemax-heightforce-fieldlatent-heatatomic-massalpha-decaygamma-decayreflectionswavelengthselectricitynormal-forcetrigonometrydisplacementacceleration...

Photosynthesis Word Search 2024-11-27

41 Items: , What gas is taken into the lungs during inhalation?, What are substances that absorb light energy called?, What is the voice box that contains the vocal cords?, What gas is released as a by,product of photosynthesis?, What is the tube that connects the throat to the lungs?, What is the primary source of energy for photosynthesis?...

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

Unit 1 Review 2024-09-03

10 Items: When energy is movedThis is stored energyThis is the energy of motionThese carry energy from one place to anotherType of energy stored in the bonds between atomsWhat it's called when energy changes from one form to anotherThis is done to an object to give it Elastic potential energyGravitational potential energy is affected by these two things...

The carboniferous period 2023-10-05

10 Items: Lasted about 60 million yearsthe big land mass before pangeabefore it was called just oxyegeneplant from the carboniferous perioda supercontnant formed from gondwanaa sea animal during the carboniferous periodcorals One of the carboniferous periods animalsa reasource from the earth that is nonrenweable....

October Safety Puzzle 2024-10-02

10 Items: Manifests contain 4 key (8).Retain manifests for (4) years.DOT stands for Department of (14).RMW stands for regulated medical (5).All hazardous material must be accompanied by (9).The name of the company that takes our sharps is (10).There are (4) classifications for hazardous materials....

Aaron Word Search 2024-09-03

73 Items: MeOTSOrbSrlYouModsGuysBabyDanaDaveSormFarmjackSprayBocksTowerHeHowRiverPtreeRealmSwockMelonsFUCKERSpringTraceyFasterLinmanPhaserSorm'sTrenchAtlantaChromerFramingGluemanHatreonHuntersPodcastRealmerof LarryChemicalFabriciaMeMoreTVWilliamsWagstaffSkelCorpBeastingAndersonCurtainsCivil WarBleichnerNewsWorldQuikLinksTeaseballTurkeymenBong GamesStephenson...

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

Science Word Search 2023-05-24

144 Items: phgaseoneradnaatommasscoalsoilacidbasemoldcastgenecellpreysolidsolarshoreepochtracetoxinvirusfunginicheliquidenergyturbidperiodfossilhazardvectormarinescienceelementformuladensitythermalnuclearsolventaquiferestuarygeologyspeciesextinctproteindiseaseprotisthygienecaloriehabitatfoodwebmoleculesolutionequationchemicalsalinitygeneticsgenotypegenetics...

Joint Commission Readiness Word Search 1 2023-12-14

13 Items: You can find policies on __ ___.A code black is called for a ___.Informed consent is obtained by the ____.If a patient is suicidal you call a ____.The SDS for any chemical is found in ___.Glucometer test strips are good for ___ ___.What is the wet kill time for purple top wipes?How long do you have to report critical results?...

Energy 2023-06-14

20 Items: Energy linked to fuelThe rate of work doneVariable that you changeEnergy linked to movementVariable that you measureAlso know as thermal energyEnergy linked to luminous objectsPotential energy in raised objectsThe unit of measurement for energyEnergy cannot be created or _________Energy found in the nucleus of an atom...

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...

Unit 7 Word Search Quiz 2023-02-23

11 Items: something dangerouspull, aim, squeeze and sweepcut off the oxygen from a fireto cause something to stop burninga form of energy produced by a firea group of people who have gathered togetherto remove yourself or someone from a dangerous placeto cover something in order to keep it from growing or...

Mole Day 2023-10-23

10 Items: a mole is like a chemical '_____'a single unit of an ionic compoundthe mass of one mole of a substancea single unit of a covalent compounda unit used in chemistry to count particlesthe smallest particle of a substance that is not bondedthe scientist that the number 6.022x10^23 is named after...

Medical Terminology 2024-12-12

50 Items: SkinChewFlameUterusChangeAsleepShieldAbdomenCerumenProteinHealthyDisableA LouseVaccineHandlingPancreasTransferCartilageBile DuctTear DuctDifferentHip SocketLying DownGallbladderCalf MuscleBit of FleshBlood VesselPushing IntoTake MonthlyTight BinderFlame ColoredAnimal StarchPut Poison InIn the MiddleRegain HealthWandering MindWedged Against...

Air Word Search 2024-09-25

8 Items: Method used to separate 2 solidsWhen a solid does not dissolve into a liquidSolid that dissolves in water to form a solutionProcess that occurs when a solid transfers into a gas directlyMixture that consists of oxygen, Carbon dioxide, nitrogen, and other gasesSeparates an insoluble solid from a liquid by pouring the liquid in a separate container...

Anatomy & Physiology S1 Exam 2024-12-11

37 Items: big toeheel boneAKA oil glandscatalyze reactionsmedial forearm bonecontrolled cell deathlargest sesamoid bonemake up your knucklescells decrease in sizesuperior spinal regionsomewhat movable jointjoint of hip and shoulderradius and ulna make an Xuncontrolled cell divisionpaired lateral skull bonesthe most severe type of burn...

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energya gas that green plants absorb that is required for photosynthesis...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energy...

Metamorphicrocks Word Search 2024-04-09

11 Items: lack plates or stripesbands, sheets or platesform by the precipitation of mineralsform by the compaction of rock fragmentsform by accumulation of animal or plant debrishave large grains and cools for millions of yearshave small to medium grains and cools for thousands of yearshave invisible or microscopic grains and cools for seconds to months...

Principles of Hospitality & Tourism 2023-05-16

153 Items: mixoilinncupeggmashhullmeltflipsoakhashrollburnzesttosswashtrimwarmovenbakesaltporkmenupintgramyolkveallambricebrangermcakesievestuffscooptrussbreadfrothshuckpureesievelayerjuiceroastwedgekneadsautesugarflouronionsteaklunchhotelmotelquartscaleouncefruitgrapedrupepeachapplewatergrainwheatbatterpanfryflambesimmerinfusefreezefilletflavorcaremepastry...

Chemistry words/elements 2024-04-04

168 Items: tinbindbondchemgoldironleadneonzincwaterargonboronradonxenonatomicbeakerbondedcyclicbariumcarbonceriumcesiumcobaltcoppercuriumerbiumheliumindiumiodinenickelosmiumoxygenradiumsilversodiumsulfuraerosolchelatecrystalarsenicbismuthbohriumbrominecadmiumcalciumdubniumfermiumgalliumhafniumhassiumholmiumiridiumkryptonlithiummercuryniobiumrheniumrhodium...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energya gas that green plants absorb that is required for photosynthesis...

Chemistry, Physics, and Energy Word Search 2023-05-22

20 Items: The unit of mass.? = Distance/Time.The unit for work.? = Force x Distance.The unit of frequency.The type of energy that food is.He created the 3 laws of motion.A horizontal row on the periodic table.A vertical column on the periodic table.The type of energy stored inside an object.The type of reaction where heat is released....

Promoting Safety 2023-09-04

8 Items: harmful microbes that cause diseasesurface or object has been soiled with pathogensany device that inhibits a person’s freedom of movementthe correct positioning of body parts relative to each othera chemical solution used to kill microbes on an object or surfacea situation that arises suddenly and requires immediate action to keep a person safe...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energya gas that green plants absorb that is required for photosynthesis...

The Eyes - Pathophysiology Word Search 2024-11-05

20 Items: double visionfarsightednesssquint or cross-eyesensitivity to lightRespond to light stimuli.paralysis of the upper eyelidfarsightedness associated with ­agingirregular curvature in the cornea or lens.an involuntary abnormal movement of one or both eyes.an infection involving a hair follicle on the eyelid....

Nutritional Concepts 2022-10-25

35 Items: Vitamin EVitamin B2Vitamin B5Vitamin B7an antioxidantincrease PT/INRtoxicity-goiterdeficiency Beriberirelated to breathing60% adult body weightsubstance called basefor bone mineralizationexcessive acid conditiondeficiency nightblindnessvegans should use supplementbody fluids have excess basefor fluid and acid based balance...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Isabell's word search 2024-05-16

16 Items: valenceelectronschemical gas that is tastelesselectrons in the outermost shellatoms of 2 or more elements combinedsubstence made up with atoms with same idenitymixture in which matirials can be eaily seperatedmixture in which 2 or more substences are spread outa place where the force a magnet applies is strongest...

Nova Farms Word Search 2023-12-19

20 Items: Ground flowerSolventless edibleSleepy time edibleTHC, CBD, CBN, CBG3g Joint with a wooden tipBlunt infused on the insideJoint infused on the insidepre-packed glass one-hitterTHC oil used with a dropperTopical brand made in houseBlunt infused on the outsideVape with live cannabis derived terpenessolvent extract used in Sticky Fish products...

Word Hunt 2024-10-16

10 Items: Supposed to reduce the symptoms and mental illness.Gives an "out of this world" feeling, hallucinations.Drugs that speed up the messages between brain and the body.Causes euphoria, nausea, and even death. Also known as "opioids".A chronic brain disease that affects millions of people worldwide....

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

Unit 8: Toxicity and Wastes 2024-04-25

18 Items: diseases that are caused by pathogensmostly chemical and construction wastediseases that aren't caused by pathogenschemicals are magnified through food weban increase in death rate over a large areachemicals in the body that build up overtimepathogen causes rapid increase in local death ratetype of infectious disease that is newly discovered...

jajshajjsjs 2023-05-31

10 Items: Pairs with thymineOrganic compounds used to store energyIn the double helix pairs with cytosineConverts the instructional genetic information stored in deoxyribonucleic acidEach nucleic acid has this, a 5-carbon sugar as a part of its polymer backbonePortion of the DNA double helix that provides structural support to the molecule....

Chemistry Vocab 2024-09-04

9 Items: each vertical column of elementseach horizontal line of elements in the periodic tablethe energy change that happens when an atom gains an electronan atom or group of atoms that has a positive or negative chargeone half the distance between the nuclei of two atoms of the same element...

Cycle 1 Vocabulary Week 6 2024-10-02

12 Items: the action or fact of forming a united wholethe basic chemical building blocks of mattera flat, 2-dimensional, surface which extends infinitely farThe difference between the lowest and highest values; outputa legal entity that is separate and distinct from its ownersgeneral plan of organization, arrangement, or choice of material...

Cycle 1 Vocabulary Week 7 2024-10-16

12 Items: A layer of gases surrounding Earththe action or fact of forming a united wholethe basic chemical building blocks of matterA comparison of two numbers, shown as a ratioa flat, 2-dimensional, surface which extends infinitely farA meeting of people face to face, especially for consultationbring (goods or services) into a country from abroad for sale....

Neurons Word Search 2023-02-06

10 Items: action under our controlThe largest part of the brainconnects your brain to your spinal cordextends downward from the base of your brain.a change in the environment (either external or internal) that is detected by a receptorprojections of a neuron (nerve cell) that receive signals (information) from other neurons....

Matter 2023-09-22

10 Items: - A material is drawn into a wireThe changing of a solid to a gas, dry iceChange in state of matter from a gas to a solidNo definate shape or volume, atoms have highest energyThe reason we have aluminum foil, gold jewelry, and coinsDefinate shape and definate volume, atoms have very little energy...

Solutions 2023-11-16

11 Items: Heat, stir or crush solute. (solid)A data based curve that is going to inform youThe inability of the solute to form such a solution.A substance that can be dissolved into a solution by a solvent.Water is capable of dissolving more substances than any other liquid.A bond between two or more nonmetal atoms that have different charges....

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Plastic: Here to stay? 2022-10-10

9 Items: capable of being made newA place where trash is buried or placed on top of the groundTo make something new from something that has been used beforepolymers that are produced by or derived from living organismsnot capable of being broken down by the action of living organisms...

Unit 1 Test Review 2023-10-24

21 Items: one way we use our foodused to handle hot potsphysiological influence examplethe body's main source of energythis is used to reach high placestype of shoes worn in the kitchenthis provides our body with energyshould be disposed of with a broomcarries nutrients throughout the bodythis is an example of a media influence...

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

Vocab 3 2024-09-18

15 Items: A living part of an ecosystemA nonliving part of an ecosystemStep in a food chain or food webAn organism that makes its own foodAn organism that cannot make its own foodA consumer that eats both plants and animalsConversion of light energy from the sun into chemical energyOrganism that feeds on plant and animal remains and other dead matter...

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

Pathophysiology - Ch. 15 + 16 Terms 2024-11-05

20 Items: Double visionBlood glucose levels riseParalysis of the upper eyelidA ringing or buzzing in the earsExcessive thirst caused by dehydrationExcessive amounts of ketones in the bloodActivated by a change in chemical concentrationInvoluntary, abnormal rapid movement of one or both eyesStimulates appetite; lack of nutrients entering the cells...

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

ENGINEERING + 2024-08-20

1 Item: AERONAUTICAL BIOMEDICAL SOFTWARE COMPUTER MECHANICAL ELECTRICAL CHEMICAL SAFETY DANGER FALL LOUD FIRE MEDICAL FORKLIFT GLOVES EYEWEAR HEARING BREATHING RADIATION RESPIRATOR EMERGENCY

Melting, Word Search 2024-05-13

1 Item: FAMILY, COMPOUND, PROTON, PHYSICAL CHANGE, GAS, MATTER, CHEMICAL CHANGE, FREEZING, NEUTRONS, MOLECULES, ELEMENT, SOLID, PRODUCT, ATOMS, GROUPS, NUCLEUS, METALS, PLASMA, PERIODS, LIQUID

Chem-is-tree Holiday Word Search 2024-12-18

14 Items: Major flavor component of clovesMajor flavor component of cinnamonThe alkaloid compound found in mistletoeThis compound gives ginger its pungent odorThe chemical in peppermint that makes your mouth feel coldType of compounds that give poinsettia leaves their red colorThis Group 13 Period 4 metal is frequently found in LED lights...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

hi 2024-05-17

14 Items: the circular motion of an object around its centerthe amount of space occupied by a sample of matterThe SI derived unit used to measure energy or work.a positively charged region at the center of the atoma chemical element with symbol Ag and atomic number 47.a force which tries to pull two objects toward each other...

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

GEOLOGIC PROCESSES 2024-08-25

1 Item: Exogenous Weathering Erosion Sedimentation Deposition Endogenous Process Chemical Physical Disintegration Rock Temperature Pressure Decomposition Compound Mineral Soil Atmospheric Oxidation Substance Oxygen Hydrolysis Water Acidification Organism Earth Gr

Sanremo artists 2024-05-21

108 Items: ldabugoemmagaiaModàollyrikiwillarisaclaraelisafasmafedezghaliiramalazzanoemirkomisethusharitoscayumanarieteblancoelodieghemonIl TreLa SadmadamemorganrandomultimobigmamadiodatogeoliergiorgiaIl VololevantemahmoodmaninnirancoretananaiAnna OxaannalisagazzelleGio EvanMåneskinMr. RainColla ZioComa_CosegianmariaMax GazzènegramaroRenga NekErmal Meta...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

First Aid Basics 2024-09-23

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Caffeine Word Search 2024-11-25

20 Items: a severe allergic reactionproduced from the formation of beetsa stimulant found in coffee, tea, and cocoanutrients people take in addition to the food we eat.a type of vegetarian that eats plant sources and eggsa type of vegetarian that only eats food from plant sourcespopular diets that claim to offer a quick fix to health issues...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Unit 3 Vocab 2023-09-14

20 Items: (adj) roundabout, not direct(v) to make amends, make up for; to avert(v) to make easy, cause to progress faster(v) to have an intense dislike or hatred for(v) to assign or refer to (as a cause or source), attribute(adj) bitter, sarcastic; highly caustic or biting; acerbic.(n) a natural inclination or tendency; penchant or propensity....

deffinitions 2023-11-23

10 Items: critical or mocking in an indirect or sarcastic way.needing much effort or skill to accomplish, deal with, or understand.a nuclear weapon improvised from radioactive nuclear waste material and conventional explosives.heavy material, such as gravel, sand, iron, or lead, placed low in a vessel to improve its stability....

Contagious Word Search 2023-05-28

22 Items: Adnormal hair lossThe highest point of the headRod-shaped, spore-producing bacteriaBacteria that are harmful and cause diseaseThe study of hair and its diseases and disordersCovers the top and sides of the head and consists of six bonesThe process of converting living skin cells into hard proteins...