chemical reaction Word Searches

Lesson 16 Review 2024-05-20

16 Items: suddenfragilitya responsethe lowest floorto talk togetherto break or burstto share informationact of breaking in onhaving to do with a partto get rid of; throw awayto have a connection withfoundation; part that supportsto bend light; to think back aboutrevealing or putting into open viewa part chipped away; a broken piece...

Substance Abuse* 2024-12-18

11 Items: The percentage of alcohol in your blood.Psychological desire for the effects of a drug.The chemical in cannabis that makes you feel high.Something a person feels when they stop taking a drug.The organ in the body responsible for detoxifying alcohol.A group of drugs that includes Fentanyl, Codeine and Oxycodone...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-25

90 Items: StyeLiceSitzViralEdemaLaserTineaLymphEczemaImmuneAsthmaOcularSulfurHerpesAureusStressUlcerspilarisRosaceaAllergyPruriusSteroidPinkeyeScabiesBullousSimplexFatigueIllnessSurgeryGeneticsChemicalPerioralErythemaVascularPeroxideImpetigoRingwormAxillaryRetinoidHormonalAbrasionPyogenesDiabetesBlistersNaproxenInfectionKeratosisPsoriasisBacterialFilaggrin...

Science Word Search 2023-03-01

19 Items: F=MxASpeeding upSlowing downsolar eclipselunar eclipselunar eclipsesolar eclipseA push or pullA unit for forcethe unit of energyThe amount of speedPower house of the cellthe earth orbits the...moon first lunar phasewhat holds the slide in placewhat you can use to see cellsThe direction the earth orbitshow many lunar phases are there...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Aerospace Word Search 2022-09-22

77 Items: ivappdnacellraysscanmarsmoonnasarisktoolstormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganvesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareaerospaceastronautbiologistcolleague...

Science 2025-01-16

89 Items: labatomcelldatafactlawsmassdatumflaskphasescaleweighbeakerbotanyenergyfossilfunnelmattermotionretorttheorytissuevolumebiologyburetteclimatecontrolcuvetteelementgeologygravitymeasuremineralobservephysicspipettescienceweatherzoologychemicalgeneticsmoleculeorganismparticleresearchtesttubevariableastronomychemistryevolutionglasswaremagnetismPetridish...

unit10-grade9 2026-03-30

20 Items: animal wastevery importantfood for plantsan animal's homevery interestingbalance in natureto damage or hurtspace beyond Earthto value somethingto watch carefullya shape of the landsomething dangerousextremely importantto go around a planetto influence somethinga protected natural arealand with a lot of grasschanges in weather over time...

random words 2024-03-30

100 Items: icepetjambitforkruletentironfowlshipmovefishcatsoventwigduckblowsidestepcrowcartheadflaghookbitefuelcowsclubwormrollteamhandpestslipfootrailwalkcoilarmythumbtrickcrowdgeesebirdsangerplaceelbowmoneydeathriflepartycreamstampfleshhandsquillwatertwistsnailsmashhoneypricenervelaughkittycannonislandbattlerecessmemorystreetparcelpencildesirerhythmspring...

words with r 2026-01-29

96 Items: ricerubyravenriskyriverrosesrabbitraisinrandomrarityreciperegimeribbonrotaryraccoonradicalrailwayrainbowreadingreceiptredwoodrefereerequestreunionreverierhubarbrisottoroboticrunningreactionrecklessrecoveryredpandareindeerreliablereligionremedialrepublicrestlessrhapsodyrhetoricrockfishroommaterosemaryrouletteruefullyryegrainrainstormraspberry...

Weathering erosion deposition 2022-11-03

46 Items: 91iceFLi'€7•07•glwindlavasoilrockwaterfaultmagmarOCKSfaultforcesfloodsmeltedgravityerosionerosionchangespassingphysicalchemicalglacierschanginglandformscoastlinecollidingmountainslandformsweatheringdepositionlandslidesconvergentearthquakehurricaneslava 13. solltransformationcracks 26. divergentsediments 45. pressuredeposition 6. glaciers...

Skin Disorders and Diseases: Inflammation and Infection 2025-02-26

90 Items: LiceSitzStyeEdemaLaserLymphTineaViralAsthmaAureusEczemaHerpesImmuneOcularStressSulfurUlcersAllergyBullousFatigueIllnessPilarisPinkeyePruriusRosaceaScabiesSimplexSteroidSurgeryAbrasionAxillaryBlistersChemicalDiabetesErythemaGeneticsHormonalImpetigoNaproxenPerioralPeroxidePyogenesRetinoidRingwormVascularAcyclovirAntiviralBacterialFilaggrinIbuprofen...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

ED Word Search 2024-07-23

100 Items: cnaxrayadmitbloodstemihokascovidgownsdraincoughowaladeconchargesepsissuturetriagedivertlacticsplintscrubsurinalativanvitalspannusfunduskronoszofrantraumagreetericentrasyncopewetpreptoradolambubagsurgerystanleyallergypharmacydementiareactionwalkbackchartingdowntimetroponinculturesmonstersjaundicecriticalbloodgasswellingcodebluetransferbedalarm...

Yr9 Science Revision 2025-05-23

101 Items: FluGascanWebIonSunBondAreaMassApexAtomMoonStarCOVIDSolidSpeedFinalGraphForceChainGroupIonicMetalGiantCometOrbitLiquidEnergyMetresVolumeCarbonProtonPeriodAlkaliChargeSimplePlanetCholeraVibrateMeltingBoilingElementMixtureSecondsAverageInitialDensityBalanceSpeciesHabitatTrophicPrimaryIsotopeNeutronHalogenSharingDiamondGravityMovementFreezingCompound...

Unit 11 - 15 Backup 2026-02-09

100 Items: oilyreindoubttheirreignenoughsighedcastletheyreinciteburrowcensorsensorcorralbroachbroochactionbrieflyturmoiltyphoidvoyagerboycottloyaltyplumbercondemngnarledscentedtrestledroughtalgebraantennaopinioncolonelarticlewarningformulainsightboroughchoralealreadyphysicalsymphonycoughingpamphletflexibleointmentcorduroydoorknobmagazinenationalargument...

ADAP Chapter 3 Word Search 2025-12-17

15 Items: commonly called Ecstasy or Mollycommonly called Meth or Crystal Meththe most commonly used substance after alcoholleading cause of preventable deaths in the United Statesconsuming alcohol prior to the minimum legal drinking age of 21widely available, free or inexpensive, and falsely believed to be safer than illicit drugs...

Cell Biology Key Words 2025-10-01

12 Items: The basic building block and functional unit of all known living organisms. (C, 4 letters)The control center of a eukaryotic cell; it contains the cell's genetic material (DNA). (N, 7)The specific region on an enzyme where a substrate molecule binds and where the chemical reaction is catalyzed. (A.S., 6,4)...

SCIENCE WORD SEARCH 2025-08-05

100 Items: DNAGasSunDataCellGenePreyAtomMassStarMoonRockRainSnowWindOrganSolidForceSolarOrbitCometOceanCloudStormTheoryTissueSystemGrowthProtonLiquidPlasmaVolumeMotionEnergyPlanetGalaxyMeteorFossilBeakerMagnetBunsenScienceNucleusHabitatNeutronElementMixtureDensityBoilingMeltingGravityInertiaMineralVolcanoErosionGlacierClimateWeatherTornadoGogglesBalance...

April 2026 Word Search 1 2026-02-18

20 Items: a small streamwet soft earthwalking in naturea waterproof coatshort bird soundsa knitted warm topwaterproof footweara small smooth stonea small pool of watera light outer garmenta rain-shielding devicea small flowing waterwayseasonal animal movementa body reaction to pollenquick light wing movementstaying outdoors overnight...

CHEMISTERY 2023-05-28

10 Items: Collect and analyze evidence from a crime scene.Are responsible for researching marine ecosystems.Study and analyze both natural and manmade items to learn more.Responsible for examining and monitoring the presence of chemicals in water.Study the appearance, movement, and effect of chemical compounds on the earth....

Europe/ Eurasian Geography 2025-11-13

10 Items: TaxesEnemies entering by force.An old decayed plant materialMeaning little or no rainfallSupporting or advertising somethingDefined territory with its own governmentA forest area that provides valuable resourcesA chemical that kill harmful insects and weedsA country in the Eastern Europe and North Asia....

Chemistry Word Hunt 2026-03-12

12 Items: Make up everythingis one type of atomis a table of the elementscontains protons and neutronsis what occurs between elementsis what we conduct to investigateis where the electrons are locatedSubatomic particle with a neutral chargeSubatomic particle with a positive chargeSubatomic particle with a negative charge...

Healthy Weight Word Search 2025-02-05

10 Items: Extreme eating behaviorsA physical or mental tensionAn intense fear of gaining weightAbnormal response to certain foodsNegative physical reaction to foodTaking place over a long period of timeA disorder that weakens the immune systemPurging then ridding the body of the foodThe body cannot control blood sugar levels...

Science Review Word Search 2023-03-02

17 Items: F=MxAspeeding upslowing downa push or a pullfirst lunar phasethe unit for forcethe unit for energythe amount of speedthe earth orbits the...the power house of the cellwhat you can use to see cellswhat holds the slide in placethe direction the earth orbitshow many lunar phases are therethe color of the moon during a lunar eclipse...

End of Year Word Search - 8th Grade 2026-05-18

101 Items: eggatomheatmasscorelavarockcellgenecrustfaultfocusforcemagmaclonetraitliquidmattersolutevolumecraterfossilmantleanthercancerembryogenomepistilpollenstamenstigmazygotedensityelementmixtureproductsolventbrittlediagramdynamicerosionfissuregeologyglacierigneousvolcanoallelesbuddingdormantgametesmeiosismitosisnucleusspeciesvacuolechemicalcompound...

Safety Week 2026-05-22

100 Items: PPECPRAEDSDSRiskVestLOTOExitFireMSDSVentTripSlipFallHeatColdBootsGuardAlarmAuditSpillLabelFocusToolsNoiseSharpSafetyHazardInjuryGlovesHelmetTagoutMotionDangerRepairPermitVisionLadderBreaksGogglesLockoutMachineStoragePostureLiftingFatigueSignageWarningCautionToolboxMeetingCultureHearingWeatherTrainingProtocolIncidentFirstAidChemicalHandlingBehavior...

OSHA Construction Outreach Word Search 2026-04-14

100 Items: PPESDSGasSawOSHARiskRoofEdgeLoadFireFuelLeadDustBootsFallsShockLabelToxicVaporToolsDrillCraneAlarmNoiseSafetyHazardRightsHelmetGlovesAnchorLadderWiringTagoutTrenchSilicaPenaltyRecordsPostingHardhatGogglesHarnessLanyardVoltageCircuitLockoutMachineGrinderVehicleStorageHotWorkTrainingEmployerCitationEarplugsLifelineScaffoldPlatformArcFlashChemical...

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Viva Connect - Doctor and Health Word Search 2025-05-02

47 Items: GPFluLegArmHipSickSnotBackKneeHeadToesFeetSkinRestRestTestMaskPainNeckCoughFeverHeartAnkleElbowHandsShockAfterSyrupNauseaBrokenBittenBeforeTabletFingersTwistedCapsuleShoulderInfectionBlood TestSide AffectsOn the InsideAny allergiesOn the OutsideCardiad ArrestBlood PressureCold (having one)Allergic Reaction

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

LIVING AND NON LIVING THINGS 2026-04-14

10 Items: Plants need this to make foodSomething that grows into planthot things you should not touchliving things that swims in waterSomething that is alive and growsSound that makes ypu cover your earsWhat we call the change after a stimulusNon- living machine that does not need foodA change in surrounding that cause a reaction...

unit vocab 2025-02-04

19 Items: is activity thatis a popular weight-lossis an intense fear of gaining weighthaving a Body Mass Index of over 30.involves short intense bursts of activity.is using food to relieve negative feelings.means having a Body Mass Index of between 25 and 29.9the heart and breathing rate for at least 20 minutes....

spelling list 2024-09-13

14 Items: having 2 leaveshaving 8 leavesto strip of leaveshaving five leavesa three leaf cloverhaving only one leafpages of a manuscripta thin sheet of metalall the leaves of a plantthe process of forming a leafa leaf composed of four leafletsa chemical that causes green leaves to dropa portable case for carrying sheets of paper...

muscular system 2026-03-26

10 Items: A stable subatomic particle with a positive charge found inside the nucleus.A subatomic particle found in the nucleus that has no electrical charge (neutral).The tiny, dense, positively charged center of an atom made up of protons and neutrons.Atoms of the same element that have the same number of protons but a different number of neutrons....

pathophysiology 2025-02-15

15 Items: a pocket of pusinflammation of the skininfection caused by mitesinfection caused by fungusinfection caused by a virusan abnormal mass of tissuestype 1 hypersensitivity reactioncontagious growth, caused by HPVA type of skin lesion in epidermisparasites that feed off human bloodinfection common in children/infants...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

Anti-Vape 2026-05-01

5 Items: Cravings - Strong urges to smoke or vape.Recovery - The process of getting healthier after quitting.Addiction - A strong dependence on a substance like nicotine.Withdrawal - Symptoms that happen when stopping nicotine use.Nicotine - The addictive chemical found in cigarettes and vapes.

Sci 2024-05-21

10 Items: of, worked by, charged with, or producing electricity.energy which a body possesses by virtue of being in motion.the chemical element of atomic number 30, a silvery-white metala coherent, typically large body of matter with no definite shape.the energy contained within a system that is responsible for its temperature...

LOVE ISLAND TINGS 2025-07-13

12 Items: YOU'REFRIENDSHIP OR REAL LOVE?FINISH THE PHRASE "AMAYAWHICH ISLANDER IS A LEO MANFINISH THE SENTENCE HURRICANEWHICH ISLANDER IS A PISCES MANFIRST PERSON DROPPED FROM THE VILLA BELLE-AFINISH THE PHRASE "GOD FORBID I'M A SENSITIVEWHAT DAY OF THE WEEK DOES LOVE ISLAND NOT AIR?WHICH ISLANDER IS A DAY TRADER AND A MODEL CHELLEY...

Science Review 2026-04-16

28 Items: Landmark's mascot.Name of the element H.The capital of France.Water in it's solid state.Heat transfer through fluids.What is the basic unit of life?Mrs. Hadfield's favorite color.Liquid water becomes water vapor.What is the powerhouse of the cell?What is the only even prime number?The process by which plants make food....

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

First Aid Basics 2024-09-23

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Solvent Word Search 2026-05-14

10 Items: - how much solute is dissolved- a solid that forms during a reaction- the substance that does the dissolving- a mixture where two substances combine- a solution with a small amount of solute- a solution that can still dissolve solute- the amount of moles in 1 liter of solution- a solution that can’t dissolve any more solute...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

unit1 2025-10-16

13 Items: Unit of energyOrganisms that are eatenA physical characteristicOrganisms that create foodObtaining nutrients from foodAn organism's genetic informationThe chemical reactions in the bodyItems necessary to fuel an organismresponse to change in the environmenta behavior or trait that helps an organism survive...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Final Review Word Search 2024-05-16

15 Items: solid to a gasgas to a solidEnergy of motionMr.Ferdinandi's birthdayhow tightly packed atoms arethe building blocks of matterwhen thermal energy is releasedwhen thermal energy is releasedhow much space an object takes upthis goes on the y axis of a graphthe ability to do work or cause changechange in the chemical structure of matter...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Predetermined fart smells 2025-10-04

117 Items: myandbetbarduefoxwinGoatTreetoothornnestgoalsuitwavebeltrootzonetosswordpumplovearmybeamechoTheretheirFunkycheatvisitjellysnailguiltsmashstartamplespiteblaststickflingtastydoubtdirtypleadscorepriceSmilesSimilegaragescrapedeletethroatlocateinjectformalborrowexcusestablecarpetsummerremindrocketstickyclosedtrumpetretreataveragerespectinquirycrevice...

ENERGY SOURCES 2025-03-26

20 Items: Limited supplyUnlimited sourcesPower from the sunOrganic waste as fuelAtom-splitting energyAncient organic matterPower from ocean tidesEarth’s heat for energyWater-driven electricityUse wind to generate powerAir movement generates powerStore and supply electricityChange voltage in power systemsConvert sunlight into electricity...

Physics Challenge 104 words 2025-07-14

104 Items: ohmlawsungastimeAtomBetaloopheatmarsstardustraysForcespeedForceWavesHertzAlphaGammavoltsgraphspaceearthvenusplutopolesNewtonProtonGMtubeampereseriesEnergyjouleschargesaturnuranusnebulacometsgalaxyGravityDensityNeutronIsotopecurrentvoltagecircuitkineticnuclearelasticaveragecoulombdisgrammercuryjupiterneptunemagnetsVelocityMomentumdistanceFriction...

Safety Terms Word Search 2025-09-02

55 Items: OVAfiresmokehazardcogentincidentcontrolssecuritycode-redconvergecode-greyspill-kitwork-safecommitteeevacuationleadershipfire-doorsmock-codeselectricityinspectionscode-purplearea-wardenchief-wardenfire-curtainconsultationde-escalationcommunicationgas-cylinderssafety-cultureriskman-reportmanual-handlingdangerous-goodssafe-work-limitrisk-assessment...

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Atom Word Search 2025-04-16

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Lesson 1-4 2025-07-13

4 Items: bacteria, waste, produce, chemical, raise, celebrate, experience, try, staypermission, comment, etiquette, nervous, interested, filter, expression, bother, awesome,vegetable, recipe, salad, appetizer, culture, recommend, balanced, nutrients, ingredients,tradition, meaning, gesture, respect, greeting, environment, recycle, pollution, conserve,

health 2024-12-16

13 Items: bigskinnynon-meat eatersugar moleculesyou are thirstycapable of dissolving in waterolive, safflower, and sunflower oila solid chemical element or compoundinformation of the number of grams of fat etcthe act or process of nourishing or being nourishedthe things that a person has to do or deal with at one time...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

Geology Word Search 2024-12-11

16 Items: Parent RockForm over warm waterFunnel-shaped vortex cloudFast moving volcanic mud flowMakes up most of earth's crustLarge cracks that form in rocksCool, strong outer layer of earthMagma becomes this after eruptionCompass direction of a rock layerOccurs when water dissolves mineralsphysical removal and transport of rocks...

Vocab 16 ICP 2025-04-24

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Infection Control 2026-05-16

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Urticaria Word Search 2025-06-15

15 Items: Another name for EczemaConnection between bonesproliferation of basal cellspainful infection on the fingersChronic inflammatory skin disorderfluid-filled sacs to add extra cushionlateral pads in some joints to stabilizefungal infection associated with diabetesosteoblast-rich lining of medullary cavityconnective tissue covering over the bone...

Science Word Search 2025-10-16

15 Items: educated guesshole hhghfhrghrfnfto test a hypothesisthe energy sound carriesenergy stored in nuclear atomsenergy that's in a electric currentobject in motion will stay in motionenergy due to motion and interactionanother name for the first newton lawstored energy of an object or materialenergy carried by electromagnetic waves...

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Skin Disorders 2025-09-28

15 Items: Parasitic mite infestation causing intensely pruritic burrows in the skin.Warts caused by human papillomavirus , often on hands, feet, or genital areas.Autoimmune disease causing blisters due to loss of cohesion between epidermal cells.Viral infections causing painful vesicles, commonly known as cold sores or genital herpes....

Science Word Search 2026-05-01

15 Items: movementrelating to magnetismrelating to electricitythe lowest point of a wavethe highest point of a wavethe process of doing somethingthe outcome of doing somethingthe space in between two crestsa system of rules that are always appliedaudible waves created by vibrating objectsthe rate of change in an object's velocity...

Psych/Psyche 2025-12-08

9 Items: mind spirithuman soul or mindoccurring within the mindstrange and weird, like hallucinationsa spiritual guide for souls to the place of the deadaffecting the mind, especially a medicine or chemical substancedescribing illness with physical symptoms but apparently mental causes...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

Seasonal Affective Disorder 2026-01-12

19 Items: Sleeping more than usualTrouble thinking clearlyLow energy or sluggishnessTool used in light therapyBrain chemical tied to moodConstant feeling of tirednessFeeling opposite of energizedDaily habits that support moodEmotional heaviness or low moodStrong desire for certain foodsLack of this can trigger symptomsProfessional mental health support...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

PTE Arrangement 2024-09-09

20 Items: How many elements are there today?The periodic table have _____ rows.Elements are placed based on their what?Different types of atoms are called what?How many columns does the periodic table have?What is the first element on the Periodic Table?Each Row of the Period Table is called a ______.Periods represent the energy level of _________....

types of reaction 2023-05-04

4 Items: reactionsreactionsreactionsreactions

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

U6 Homeostasis 1 Wordsearch 2022-11-15

21 Items: increase the speed of enzymesmolecule that an enzyme acts uponable to dissolve in other substancesThe energy needed to start a reactionsmaller pieces of something larger, that make it upa state of balance of the internal conditions of an organismenzymes are specific to the molecules in which they work upon...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Common Drug Classifications and Names 2026-02-10

14 Items: Prescription neededExact molecular formulaGeneral name assigned by USANNo purchasing restrictions by FDAAppears in the official referenceConditions drug shouldn't be givenUsed in a way not indicated by FDADescription of cellular changes that occurCopyrighted and used exclusively by that companyOther drugs or food that may alter effect of drug...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

vocab periodic table word search 2026-04-28

20 Items: Squeaky-voice gas.Half of a salt shaker.Pool-cleaning chemical.Cavity-fighting element.Smells like rotten eggs.The universe's #1 element.78% of the air we breathe.Lightweight battery metal.Basis of life and diamonds.Flashy metal in sparklers.For strong bones and teeth.The heart of a computer chip.Common foil or soda can metal....

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

My Motion and Machine word search. 2025-10-18

16 Items: to put togetherto go up and outa machine that helps lift thingsplane- a machine that moves objectsa simple machine that goes up and outis a movement from one position to another.( The scientist) First Law of Motion states:- is any applied force that moves an object.- are any type of device/technology that makes work...

Acids and Alkalis 2023-09-16

13 Items: a soluble basehas a pH below 7has a pH above 7has a pH of exactly 7acid that contains a lot of watercolour litmus paper turns in acidscolour litmus paper turns in alkalisacid that doesn't have a lot of watera reaction between an acid and a basean example of an acid we use in the laban example of an acid you find in the kitchen...

Health and Wellness 2025-05-30

10 Items: The state of being in good health.The body's ability to resist diseases.Emotional and psychological well-being.Practices that keep you clean and healthy.A shot that helps protect you from diseases.The process of absorbing enough water for health.The condition of being physically strong and healthy....

Culture shock in an unlikely situation: Australia to Canada 2025-06-05

5 Items: Kind or pleasant, as Canadians are known for.A chemical used for washing dishes or clothes.Not ready (how Emily felt when she moved to Canada).Easy to see or understand (Where garbage bags were not)A large group of people (it can be hard to get in THIS)

Fashion words and Phrases C1 2026-04-07

11 Items: (phr) In fashion; popular.(adj)Extremely modern and advanced.(n)A blend or mix (e.g., of styles)(phr): Being noticed or considered.(phr v)To become popular or fashionable.(idiom): Very popular or fashionable right now.(n): A person who leads the way in fashion or ideas.(adj)No longer relevant, fashionable, or usable. e.g. 67...

Writer 2022-11-05

11 Items: the lower jawsurgical removal of bone or tissueswelling; usually secondary to infectionsubstance that joins two or more surfacesa relatively narrow tubular passage or channelthe hard and soft tissues forming the roof of the mouthlightening of the teeth using a chemical oxidizing agentmissing tooth structure due to decay, erosion or abrasion...

Food Safety Chapter 1 2025-08-28

11 Items: a bad microorganisma hazard like bleacha type of temperature abusea hazard like hair or plasticbacteria like parasites or moldanything in your food that doesn't belong therepoor personal _____, not washing hands regularly____illness, an illness you can get from eating bad fooda very small living thing only seen through a microscope...

Clinical Chemistry Automation and POCT 2024-06-11

18 Items: Term describing near patient testingQuality measure to ensure accuracy and precisionStep in the total testing process where testing occursAn analyzer methodology based on the rate of the reactionPart of the analyzer which aspirates the sample from the tubeThe number of samples or tests that can be performed per hour...

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Physics word search 2025-06-14

28 Items: - When atoms decide to form a group chat- How often you check your phone per minute- How loud your neighbor's music is at 2 AM- What your body has to waking up on Monday mornings- What happens to your heart rate during a physics exam- The reason you're still on the couch watching Netflix- Why your room gets messy faster than you can clean it...

Organelles and their function 2026-04-21

9 Items: This is a ring of DNAWhere is the site of protein synthesis?What is the site of aerobic respiration?This structure stores water and cell sapWhat cell structure provides strength and support?What structure controls the exit and entry of substances?What structure controls all cell activity and contains DNA...

Acids and Bases 2025-03-27

15 Items: ph of 7ph below 7ph above 7ph is in _____ of tensph of a neutral substancewhat we trying to neutralizered cabbage is an example of this- what acids and bases are to skindigital device that tells you the pha kind of indicator we use to test pHwhat color litmus paper turns when an acidwhat color litmus paper turns when an base...

Unit 3 Vocab 2023-09-14

20 Items: (adj) roundabout, not direct(v) to make amends, make up for; to avert(v) to make easy, cause to progress faster(v) to have an intense dislike or hatred for(v) to assign or refer to (as a cause or source), attribute(adj) bitter, sarcastic; highly caustic or biting; acerbic.(n) a natural inclination or tendency; penchant or propensity....