atoms and molecules Word Searches

PSALM 145:3 2026-05-10

14 Items: ISTOBEISTHEANDANDHISLORDGREATGREATLYPRAISEDGREATNESSUNSEARCHABLE

Group 4 Word Search 2026-04-16

8 Items: the holy actiona conversation with GodThe process of following Jesus Christ.the moral principle of equality, fairness, and righteousnessthe act of completely trusting and relying on God and Jesus Christ.A group of people in one area with the common culture, social structure, and a collective identity....

EMU Resources 2024-08-01

10 Items: This program’s mission is to provide the Eastern Michigan University (EMU) community with both food and non-food item assistance along with additional resources to positively impact well-being and college success....

American Word Search 2025-04-22

14 Items: Someone from CanadaNumbers and problemsBarbara is from the UKYou can draw and paintCleopatra,gods and warsSomeone who's from the USAGreta is German, she's fromJoao is brazilian, he's formMessi is from Argentina, he'sNaomi is Japanese, she's fromCitlali is Mexican, she's fromSalvattore is Italian, he's fromSomeone who was born in China is......

I Word Search 2026-01-15

40 Items: DODJBARPIEKISSVEILVOWSRINGSUITHOFFLOVEBRIDEGROOMDANCEDRESSTOASTAFTERHEELSPHOTOSPETALSAUGUSTCHEERSSUNSETFAMILYAND MRSFOREVERBOUQUETHOLLANDWEDDINGHITCHEDFRIENDSMARRIAGEMICHIGANOFFICIALHONEYMOONAND HAVENCOCKTAILSCUFFLINKSBOUTONNIEREPHOTOGRAPHER

Averroès 2024-11-26

20 Items: EnergyImmuneBiologyCultureSurgeryMoleculeResearchMythologyTraditionDiagnosisDiscoveryExperimentPhotosynthesisThe smallest unit of matterThe study of disease causes and effectsA monumental structure from Ancient EgyptThe protein in red blood cells that carries oxygenA tool used by doctors to listen to the heart and lungs...

Electricity 2023-01-13

10 Items: Particle with no charge.The basic unit of matter.Particle with a positive charge.Type of electricity that powers our devices.A closed path that electrons can flow through.Material that allows electrons to pass through.Material that doesn't let electrons pass through.Is the transfer of electrons from one atom to another....

animals and summer and christmas 2013-12-10

44 Items: catdogbeeflyfoxcowhotsunbirdliongoatswimsandtigerkoalasheepbeachoceantowelspadeangleSantaelveslizardmonkeyrabbitpossumbreezebuckettinselfamilychickenfriendselephantladybirdkangaroosunshineumbrellabutterflydragonflysunscreenChristmassandcastledecorations

Lilo and Stitch and Science 2025-05-27

25 Items: LiloStarJumbaGantuOhanaAlienSpaceEarthLaserStitchGenomePlasmaScienceBiologyDensityPleakleyGeneticsMosquitoPreserveHumanoidDucklingMolecularExperimentHyperdriveEndangered

Spelling and Prefix and Suffix 2026-03-24

24 Items: reactunrollunloadrecallrewindunwindunsurereviewunhappyunknownrewritereplacemisleaddislikepreviewdisobeymisplacedisagreemisspelldisappeardishonestpreschoolunwillingreimagine

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

Jason Spelling 2014-08-28

12 Items: myittheandyouallbutonewiththisworkhave

Search 45 - Shakespearean Quotations 2019-05-09

13 Items: AndActTwoTwoWhatLightRomeoSceneYonderWindowBreaksJulietThrough

Puzzle 1 2022-09-07

12 Items: atallandeveraboutearlyenougheitheritselfinterestimportantinformation

Lesson 13 2023-01-17

12 Items: myyoutheandyeswithwhatcomebrownpurplemondaysunday

Word Search 2023-02-15

12 Items: atoftoinisithetheandcancatsit

Gold Words 2023-06-23

12 Items: iabeinisitoftoandthewasthat

43565465342 2024-01-02

12 Items: andwiththiswordbookyourrelaxgiantbrainunwindsearchchallange

Psalm 24:1 2024-09-19

15 Items: inittoTheandtheanditstheLordearthworldbelongeverythinginhabitants

For Word Search 2024-11-08

12 Items: forsheredonebignothisandbluejumpintosaid

m100 search 2025-05-22

13 Items: ofitisinwasandyouwhythatthatwhatwhenwhere

What is a Pal Word Search 2025-09-07

12 Items: amatbesatmatdadmanandyouhelpwithplay

Heart Word Hunt 2025-12-04

12 Items: todoofmebeheasistheseeandsaid

Dan Word Search 2026-01-30

12 Items: ONITDANMINMATSADMADANDTHESAMSATSIT

And Word Search 2026-05-16

15 Items: dodoitastotoandyouTheandnotmenLordwhateverheartily

Spelling List #1 2020-04-30

12 Items: gonotheseesheandyouforplaywithjumplittle

fair trade vocabulary  2021-02-08

12 Items: andtradeIncomeSupplydemandImportsProfitsJusticeBargainexports.Consumersworkforce

im a dog 2021-05-14

14 Items: catdogandlionkailaveykailkisszebrahippotessaaveryaveryelephant

Insects Word Search 2023-09-14

14 Items: sixoneonetwoandmayhavelegsheadhavewingsthoraxinsectsantennae

VRQMVOTJ 2024-01-26

12 Items: foranddearjoinmealcutievivekmistrypleasehomemadevalentinesactivities

3.kl sõnarägastik 2024-09-18

12 Items: andByelateunitMissthatHellosorrymorningBritainAmericaFinland

Smile Word Search 2024-11-25

12 Items: sayearandcanarmhelpnicenamesmilesharemouthlisten

Heart Words 2024-12-10

12 Items: wetogodocantheseeandyousaidlikethey

Romans 10.17 2025-09-08

13 Items: ofSoandtheWordfromfaithcomesChristRomanshearingthroughhearing

PSALM 119:105 2025-10-02

15 Items: AAISTOMYTOMYANDYOURWORDLAMPFEETPATHLIGHTPSALM

Ephesians 4:32 Puzzle 2025-11-09

12 Items: andoneGodkindeachjustotherChristanotherforgaveforgivingcompassionate

Find the following words 2025-12-24

12 Items: AIWeTheAndSeeCatMatSatPatRatLike

Cool 2026-03-18

12 Items: Itodoandcantwaitthissomecoolfinishassignmentexperiments

Mexico Word Search 2026-03-14

10 Items: - people who celebrate together- moving the body to music for fun- bright shades used in decorations- to enjoy a special day with others- being able to live and choose freely- a march with people, music, and flags- songs and sounds played at celebrations- a cloth with green, white, and red colors- a country where this holiday is celebrated...

How Well Do You Know Your Model A 1? 2023-06-17

20 Items: rate of speeddecorative basefinishing piecesprevents blow bycam lobe contactmixes fuel and airhighest temp valvelight weight metalbrand of Model A tirekeeps the door closedreduces 12 to 6 voltscontrols spark timingwhere will you find a forkwhich side is the door lockupholstery fastening deviceprovides support and lubrication...

IBDP Language B Identities Vocabulary Word Search 2025-09-04

25 Items: Usual ways of behaving in a cultureFeeling accepted and part of a groupThe country a person legally belongs toPrinciples or beliefs that guide behaviorJudging others unfairly before knowing themA group of people born around the same timeMoving from one country or region to anotherShowing your thoughts, feelings, or identity...

The Skeletal and Muscular Systems 2025-02-12

20 Items: A point where two or more bones meet.The type of muscle found only in the heart.The bones that protect the lungs and heart.The longest and strongest bone in the human body.The series of small bones that form the backbone.A connective tissue that attaches muscles to bones.The type of muscle that is voluntary and moves bones....

Word Search - Golden Words 2018-06-24

12 Items: Iaofisbetoinitwastheandthat

EH 2018-03-13

12 Items: tencatbotthefortoowinwonwowandarewhy

Name: _____________ Lesson 16 2023-02-06

12 Items: issoofmyhowandtheyoumanywithwhatwhere

Fundations 1 Unit 2 2025-06-25

12 Items: isoftheandhiscatsiplogfoxfitpetdug

TO THE WOMAN WITH THE MOST BEAUTIFUL SMILE 2025-07-30

14 Items: IYouAndYouTheAndLoveMostTodaySmileLaughVivianForeverBeautiful

fraya is a poo 2025-07-31

12 Items: aiisdoMEpooandyesdidthisfrayaALISSIA

Millies camp word serch 2025-08-05

12 Items: andcliprockwallclimbdinnerarcherypegwingcholatebreafastclimbingpillipiland

• W O R D S E A R C H • 2025-08-30

12 Items: byeaJforandJARSEarthMEDANKLINIKProjectBirthdaynatureaJREBOISASI

Focus on Greek Roots 2024-03-04

19 Items: Study of living organismsEarly sound-reproducing machinePerson trained for space travelA person's signature, often as a mementoA sudden event causing great damage or lossVisual representation of data or informationAn account of someone's life written by someone elseAn account of a person's life written by that person...

Quaint Word Search 2025-11-17

13 Items: paths for bicyclesfull of life and energypaved with rounded stonesunwanted or harmful soundbusy and full of activityspace area for vehicles outsidebeautiful and visually charminggently sloping landscape featuresarea where only walkers are allowedparking facility below ground levelregular travel between home and work...

Comet Word Search 2023-12-18

17 Items: Ursa majorUrsa minorchanging time and the seasonlight bouncing off an objectis a belief about personalitysomething that gives off lightsomeone that travels into spacesomething going around somethingstreak of light in our atmospheregalaxies including the solar systemhas the same amount of sunlight and darkness...

Final Cold War Word Searchizzle 2023-03-15

11 Items: USSR Economic ReformA conflict that went hotUSSR Political Freedom ReformRivalry between the US and the USSRNo private property and classless societythe government sets production and pricesUSA policy to stop the spread of communismindividuals determine production and pricesLeader who tried to save the USSR with new reforms...

What's in my sandwich 2025-11-04

11 Items: I add crunch and color.I wear armor from the sea.I glide smoothly on bread.I melt when things get hot.I’m saucy and full of flavor.I bring sweetness to the mix.I swim before I fill your sandwich.I make your sandwich strong and savory.I’m always on top and bottom of the stack.I’m sticky, sweet, and love peanut butter....

December Safety 2025 2025-12-22

10 Items: Avoid hanging lights near any potential _____ hazard.Do not use outlets or cords that have exposed _______.Do not carry or lift up electrical equipment by the power ____.Risk of ________ shock is greater in areas that are wet or damp.Know where the panel and circuit _______ are located in case of an emergency....

Plate Tectonics: 4.01-4.02 Vocabulary 2022-11-18

12 Items: CAPABLE OF BEING MOLDEDCAPABLE OF BEING MOLDEDTHE OUTERMOST LAYER OF EARTHTHE UPPER PART OF EARTH'S MANTLEUPPER MANTLE JUST BELOW LITHOSPHERESOLID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS DENSE AND THINLIQUID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS THICK AND LIGHTPART OF EARTH BENEATH THE CRUST MADE UP OF ROCK...

EDH Word Search 2025-08-19

15 Items: concern about and action aimed at protecting the environment.the mission of the EDH department is to "defend and care for _____ on earth"The acronym for the thematic area and gateway course: Global Inequality & DevelopmentThe acronym for the thematic area and gateway course: Environmental Sustainability & Global Health...

Gas Laws and Mixtures 2024-01-11

13 Items: a perfect gasunit with symbol kPaunit with symbol atmforce put on somethingshows particles of a substancemixture with the same propertiesmixture with different propertiescollisions where energy is transferredrelationship between pressure and volumerelationship between temperature and volumetemperature unit used for gas law questions...

Transformational leadership 2023-10-09

7 Items: communicate a shared vision and gives meaningleader provides constructive review and adviceinspires creativity and innovation and a challengethe ability to inspire trust and devotion in followersfollowers are empowered to take on roles & responsibilitiesfollower effort is recognized and celebrated with incentives...

Vocabulary March 2025 2025-03-09

17 Items: To stop or endConflict or struggleState of being boredPeaceful, calm, and quietTo walk slowly and heavilyConfusion or disorientationWeak or lacking in strengthLasting for a very short timeExtremely tiring or demandingCalm, peaceful, and without troublesTo increase the risks or stakes in a situationAnxiety or fear about something that might happen...

Factors that Influence Product Design (F.U.N. T.E.A.M.S.) 2026-04-01

9 Items: The purpose of a product that makes it fit-for-use for its intentMaterials, tools and processes used in product design and productionThe end consumers of the product for whom and which the product is intendedThe identification of the purpose of a product from research and development...

Parts of a Residential Structure 2026-02-09

11 Items: RoofBeamFloorStairsColumnFramingFoundationFloor SlabExterior WallsWindows and DoorsInterior Walls and Partitions

HAHA 2023-03-09

17 Items: me!he_is-eli&bro(and=read%like*eli'scute~hello@te-he#named)lennox$lennoxśbrother^amazing+

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

Group 2: 3rd and 5th grade #2 2020-03-30

12 Items: BEWEHEANDSEEYOUARELOOKGIRLWANTHAVEWHERE

sight words 1 2021-03-17

12 Items: ofonatandtheoffputwasdidallsaidyour

GIDDY FEELINGS 2022-09-07

13 Items: tomymyyouseeeyeandareyoursightcaughtcolorsfavorite

high frequency words 2024-08-23

12 Items: amanbeallandbigcandayawaycomeaboutabove

Group C 2024-12-03

12 Items: ToInHeOfIsAtTheAndYouSheForThey

Grade 3 ELD- Unit 4, Week 1 2025-01-07

12 Items: noisonebighasforyouandplayjumpwithlittle

Differences Word Search 2025-02-11

12 Items: AreAndCodeYourThereMorseBetweenTappingMissionMessagesTranslateDifferences

Ice fishing 2025 2025-01-12

12 Items: AndCodeYourExistMorseBetweenTappingMissionMessagesTranslateDifferencesCommunication

Fry Sight Words (1st 100) 2025-02-22

12 Items: atifandfordowneachpartthatyourfirstwaterwhich

Hello Word Search 2025-05-13

13 Items: i1myisandtwoandnameeviehavebroshellosisters

Brojevni sustavi i logički sklopovi 2025-06-04

12 Items: ANDdvanulebazazapissustavbinarnidekadskinegacijapotencijakonjukcijaheksadekadski

The Word Search 2025-11-04

12 Items: aIbetoofinittheandforthathave

Genesis 1:31 2025-11-12

12 Items: HEITGODSAWALLHADANDWASTHATMADEVERYGOOD

List A, Group 1 2026-01-27

12 Items: andbackcomedownhavehelpherelikemakesaidthiswant

week 1-5 sight words 2026-02-28

12 Items: thegotseeandwithlikecomelookplayheresaidlittle

I Word Search 2026-05-11

12 Items: Iamonitgowemeinandcanthethen

Palabras Compuestas 2025-10-07

15 Items: (Nerve)(Puzzle)(Ranger)(Runner)(Sleeper)(Frogman)(See-Saw)(Open lab)(Flip flop)(Long hand)(Bulletrain)(Chiaroscuro)(Nail Tripper)(Black and white)(Sweet and salty)

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Fit4Dance 2025-10-04

34 Items: Front Desk StaffBrukwine TeacherAddress of StudioNext Door NeighborWhere ILLY is fromWhere Sara is fromRaboday Fit TeacherWhere Laci was bornJust Grooves TeacherHaitian Dance TeacherWhere Kameica was bornAdult Majorette TeacherRegular Saturday RenterClass that Laci teachesFounder & CEO of Fit4DanceKids Afro and Jazz Teacher...

trs23 ie2 u3p2 2022-11-16

10 Items: Doesn't work.It has 2 wheels.It can fly. It has wings.It's big and has 4 wheels.It can fly. It doesn't have wings.It's very big and has 4 wheels. (Br)It's very big and has 4 wheels. (US)You can see it on a yo-yo and a kite.It is round. It is on a car and a bus.Two overlapping circles with things inside.

Ariel Word Search 2025-05-28

17 Items: MaxGusmoreArielBilalChloeIssacRowanMakaiSofiaCorvinSahiraJoquinSydneyAtticusValientEemeran

Ariel Word Search 2025-05-28

17 Items: MaxGusmoreArielBilalChloeIssacRowanMakaiSofiaCorvinSahiraJoquinSydneyAtticusValientEemeran

Hawker Renewal Wordsearch 2026-04-27

10 Items: Doug's middle nameDoug's pint of choiceDoug's favourite filmSue's favourite singerName of our flower girlSue and Doug's zodiac signDoug's favourite football teamEstate Sue and Doug currently liveWhere did Sue and Doug go on honeymoonBalearic island Sue and Doug have visited many times

Fashion 2024-11-28

16 Items: HatandBowlBeltShoesPurseWatchScarfWalletGlovesBroochJewelryHandbagBackpackCufflinkSunglasses

You Word Search 2025-05-31

16 Items: YOUENDALLANDLETLOSTTAKETHISDOWNTHESEPLACEWANNADIDN`TTRAGEDYMEMORIESSOMEWHERE

CDA Sept 20 2025-09-20

20 Items: atobetoisThetheandforonlylovefightGod'sLord'scomingworkerkingdomlast-hourrequirementrequirement

Fibres- fabrics 2023-05-09

16 Items: andallarespunintoyamsmakesilkformknownfibreslengthsproduceman-madefilamentscontinuous

Cyber - Technical words 6 2025-06-27

12 Items: Documentation of who handled evidence and when.An observable occurrence relevant to system security.A European regulation on data protection and privacy.Proactively searching for signs of malicious activity.A form of public key encryption based on elliptic curves.Creating an exact copy of a digital device for investigation....

Personal Health and Fitness 2025-04-14

10 Items: POSTURE : The way one holds their body when sitting or standing.WELLNESS : A state of overall physical, mental, and social well-being.ENDURANCE : The ability to sustain physical or mental effort over time.STRENGTH : The physical power and energy to lift, push, or perform tasks....

Comet Word Search 2023-12-18

17 Items: Ursa majorUrsa minorchanging time and the seasonlight bouncing off an objectis a belief about personalitysomething that gives off lightsomeone that travels into spacesomething going around somethingstreak of light in our atmospheregalaxies including the solar systemhas the same amount of sunlight and darkness...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Breakfast Cookery 2026-04-14

20 Items: the white of an eggslightly cooked eggsthe first meal of the daya savory egg custard baked in a crustvery thin, delicate unleavened griddlecakemedium-weight pur batter, cooked on griddlea mixture of chopped meat, potatoes, and onionsmade from Native American ground corn called hominyservice that is generally a simpler self-service breakfast...

Aging 2025-05-29

12 Items: ____ aging is a social constructInfluences 75% of biological agingThis organ ages quickly relative to other organsAging is a natural process and is not the same as thisWhich is NOT one of the 5 M’s of caring for older peopleProgressive decline in ability to maintain homeostasis under stress...

Soap de letras 2026-04-30

12 Items: This helps you solve equationsIt helps you cut things smallerYou can write and erase with thisSticky and white and its a liquidit has ink and you can write with itIt has chapters and it can be real or fakeHolds things, goes on your back, has strapsYou can get a rid of your mistakes,rectangleWhite with lines and you can do a lot of things...