animal Word Searches

Evolution Unit 2024-12-05

9 Items: father of evolutiona permanent change in the DNAgradual change in a species over timetype of coloration for when an animal blends in with its backgroundorganism has the best chance to survive, reproduce, and pass on traitsis a trait that makes it very hard to see an animal in its natural habitat...

How well do you know Aisha? 2025-10-06

10 Items: Her favorite showThe Inni loves mostThe place she hatesHer favorite chocolateThe only meat she eatsThe subject she studiedThe place she grew up inHer favorite Indian snackThe animal she can’t standHer favorite travel destination

Reggie Word Search 2026-05-12

6 Items: (The star of the book!)(Reggie's favorite treat)(Something fun to play with)(What happened to the treat?)(What kind of animal is Reggie?)(How Reggie solved the sticky problem)

Spanish 2023-04-28

27 Items: seazoocitylaketreebearbirdplacemuseumanimalmonkeystadiumtheatermonumentto learnto visitto sunbathenational parkto go boatingamusement parkplay (theater)country, nationto ride a horseto buy souvenirsto rest, to relaxto scuba dive/snorkelatracción, attraction, attractions

Can You Finish This 2023-09-05

76 Items: asatbyaddageagoairallandanyarmartaskbadbutbuycanablealsoareaawaybabybackcalladmitadultafteragainagentagreeaheadallowalonealongamongapplyarguebeginbringbuildaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistbeforebehindbudgetcameraabilityaddressagainstalreadyanotherarticlebrotheractivityactuallyalthoughamericananalysisanything...

3000/2 2025-02-22

78 Items: ahAMageagoaidaimairallandanyaideAIDSallyalsoafteragainagentagreeaheadalbumaliveallowalonealongalteramongangerangleangryapartappleapplyagencyagendaalmostalwaysamountanimalannualansweranyoneanywayappealappearagainstairlineairportalcoholalreadyamazinganalystanalyzeancientanotheranxietyanybodyanymoreappointaircraftalliancealthoughAmericananalysis...

Hannah's Word Search 2026-04-08

78 Items: dodogredtandueboxpinpenbedartgymballformlinebluepinkbowldoortimefirenameselfbookhookwallokaynotegluestemvalueshapespacecolorpaintgreenblackbrowntrickpaperboneslightwhiteclockwheelshelfnightstandtablepapermusicorangeyellowpurpleletterflowerspongerecordanimalnumbersimplepersonpencilmarkercrayonpencilstickysquishytexturecrystalcoloredblenderspecial...

Palavras que Lembram Você 2026-07-09

21 Items: — pônei.— joelho.— óculos.— patela.— "reboco".— enxergar.— machucado.— seu cabelo.— pegar fogo.— seu animal.— sua música.— o que você é.— voa e é colorida.— muitas evoluções.— depois de quinze.— sua personalidade.— apelido do seu pai.— seu vestido de quinze.— cor que me lembra você.— país que você quer visitar.— o jeito que escrevo seu nome.

trs23 ie2 u6p2 2023-02-07

10 Items: Not the same.Green thing with leaves.E.g. chicken, pork, beef.E.g. bread, rice, noodles.E.g. milk, cheese, yoghurt.E.g. sardines, tuna, salmon.E.g. lettuce, carrot, potato.E.g. apples, bananas, oranges.E.g. lion, dog, crocodile, mouse.Some food between two pieces of bread.

Spelling 2026-05-05

10 Items: not louda string instrumentValentines Day montha keyboard instrumentanimal with a loud roarperformance with horsescan listen to music usng thisa passage with mostly rhyming wordsan electronic used for displaying movies & imagesknowledge through predictions, experiments & observations

The World at Night 2025-10-16

10 Items: Having two equal or matching halves.Extremely interesting or captivating.The measure of how hot or cold something is.Active at night and sleeping during the day.An animal that is hunted and eaten by a predator.An animal that hunts and eats other animals for food.A small mammal with sharp front teeth, such as a mouse or rat....

Valentine Day Word Hunt 2026-02-10

10 Items: My zodiac signOur first tripOur lucky numberYour favorite barWhere we first metYour favorite animalWhat was our first dateWhere we said I love youOur favorite fast food restaurantWhat country we want to travel to

Animales - Colores - Emociones 2023-03-02

4 Items: someone who's happy (male)the color of Colombia's flagsomeone who's excited (female)big animal that throws water at you

FINN'S 16TH BIRTHDAY 2026-07-14

16 Items: FAV FOODSTAR SIGNHER BIRTHSTONEFAVOURITE COLOURFAVOURITE ANIMALCHILDHOOD STUFFYALL TIME FAV BOOKITS HER SWEET ____FINNLEYS MIDDLE NAMEHER TUXEDO CATS NAMEHE LIKES LICKING TOESWHAT YEAR SHE WAS BORNTHE DEVILS COUNTER PARTHER FAVOURITE POP/USERNAMEA FUN GYMNASTIC TRICK SHE DOESTHE COLOUR OF JEWELRY SHE WEARS

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Les mots de vocabulaire 4e classe 2022 *** 2022-01-13

77 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachejaunevoleravrilmarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterrampertomberorangevioletmangeroiseauautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercreusermarcheranimauxchercher...

2nd Grade Fundations Trick Words 2025-05-13

78 Items: wonsonuseJulyloseheadawaycitymoveonlyonceknowknewusedsuregoesdonewalktalkbothpullfulllaughpiecewhosewhosegreatlearnearthworldcarrynighteverylargeeightplacerighthouseoftenagainshallAugustenoughboughtMondaycousinschoolmotherfatheranswerfamilychangealwaysanimalpleaseprettyspecialJanuarybroughtTuesdayAmericathoughtcountrybrotherpictureagainstdaughter...

Across Word Search 2025-05-11

19 Items: downseedsacrossto heredityof cereal cropsgrain from chafffor storing grainused to kill pestsland for cultivationused to kill insectsgrain from the plantwaste used as fertilizerfor sowing seeds in rowsseeds of leguminous plantscrops to improve soil healthfor harvesting and threshingthat fix nitrogen in the soilscience or practice of farming...

애완동물 Word Search 2024-09-08

25 Items: nowfishyardbabya petchickhouselatermotherfatherto dieto liketo livetogetherapartmentto be sadto be bigdog, puppyto grow upto be goodto be rightmiddle schoolto hate, disliketo hear, to listen toto raise, to grow animal

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Tricky Words 2025-11-04

78 Items: sawanywaswhywhoasksaidtheyloseonlyknowweremanyherewerehomewhatworkwomenafterlaughtheirbuildhouseabouteverytherewheregreattheseothercan’tdon’tcouldwoulduntilwomanwherebeforealwaysacrossmotherfathersisterschoolcousinthougharoundshouldfriendfamilycaughtpeoplereallyanimalboughtbelievealrightalreadybrotherthroughminutesanotherdecidedbecausethought...

Deutsch II Märchen Quiz 2 2026-05-10

27 Items: plotwidowwitchswordbraveorphanto askto winto diewidowerto loseto washgorgeouscharacterto becomeevil, madpoisonousenchantedcourageousenchantinghappy endingcastle, lockfairy-tale liketo ride (animal)once upon a timefable-like, fabulousHappily ever after phrase not in word search

Bony Fish Wordsearch 2026-04-09

18 Items: The study of fish.An animal that releases eggsThe bony gill covering on some fishSkeletons are composed of this materialMarine fish that migrate to freshwater to breedFreshwater fish that migrate to the ocean to breedWhat fish use to collect underwater sensory informationThe organ in fish responsible for oxygen-carbon dioxide exchange...

trs23 ver2 u7 2022-10-19

10 Items: 365 dayslittle animalclean with watermeal at 12 o'clocksomeone in your familymake a picture with a pencilby yourself, just one personTomorrow I ____ go to school.You ____ to drink water every day.It is 4:20p.m. Class will finish ____.

Whimsical Word Search 2026-06-15

10 Items: FlowersWhimsicalHeavyTipsyKissing is __________Aidas favorite animalHow does Aida spell SkibbaWhat does Aida love to shareWhat does Aida need in the morningWhat does Aida want to do on a night outWhat did we used to eat in the aquarium with a knife

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

Tricky Words 2025! 2025-12-02

77 Items: areherwasyouputsawanywhowhytwoouraskI’msaidveryhavewerethentheyherewhatwantsomeoverhomeyourlovemanysaysfourworkbabylastfastfindonlykindopenknowtalkwalktherewhereagainhousethreeaftertheseaboutgreattheircan’tdon’totherwatereverylaughfriendschoolmotherfathersistercousinfamilybeforedidn’talwaysanimalpeoplebrotherbecausethoughtanotherchildrencouldn’t...

Unforgettable Minds: Memory Marvels and Forgetful Friends in the Animal Kingdomelephantschimpanzeesoctopusesdogscatssquirrelsgoldfishguppiesantsmemorywater 2024-04-13

19 Items: dogscatsantswatertoolsfacesmemorytricksforgethidingguppiesgoldfishroutineselephantsoctopusessquirrelschimpanzeesintelligenceimpressively

Marine Animals 2025-01-06

8 Items: It is a mammal.It can sting you.It lives in a shell.It has got 8 tentacles.It has terrifying teeth.Patrick, from Sponge Bob.It walks from side to sideThe biggest animal in the world.

From Tortoises to Parrots: A Fascinating Dive into Animal LifespansAnimalsBirdsDogsCatsElephantsTurtlesFoodDietHabitat 2024-06-03

16 Items: dogscatsfooddietsizebirdssafetyanimalsturtleshabitatthreatselephantspredatorsprotectionmetabolismenvironment

Encontra a palavra: TEMA JOANA 2026-01-09

7 Items: A minha cor favoritaO meu animal favoritoA minha comida favoritaUma viagem que gostava de fazerA minha estação do ano favoritaA minha marca de chocolate favoritaUma das áreas que acho interessante

Random stuff im learning :D 2024-01-18

11 Items: live in a shellsad__ - adverb -slow__ - adverb -quick__ - adverb -5/7 - 2/3 = ? - simplify -2/3 - 3/8 = ? - simplify -6/7 - 2/6 = ? - simplify -4/6 - 4/8 = ? - simplify -4/5 - 2/3 = ? - simplify -an animal that unpollutes waterpeople were over harvesting them in Chesapeake Bay

Family 2025-11-25

12 Items: plural of footcheveux bouclésplural of mouseYour mother's sisteryour father's brotherMarge Simpson's husbandI am not small, I am...Prince William's brotherBrothers born on the same dayanimal de compagnie en anglaisCharles and Camilla are husband and...Fester Addams doesn't have any hair, he is...

Identify these objects 2024-09-20

10 Items: Pet that BarksSomething you readWater from the skyPet that chase miceA home built by birds.Animal that loves cheeseSomething you write withSomething you wear on your headTall plant with leaves and branchesA small container used for drinking

UAE Animal Word Search List 2026-03-17

5 Items: A graceful desert-dwelling animal.A critically endangered sea turtle species.The national bird of the UAE, used for falconry.A marine mammal found in the UAE’s coastal waters.A rare and endangered big cat found in the mountains.

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

Benny's Exploration Journal 2024-10-24

12 Items: A secreted molecules that influences cells near where it is secretedA transmembrane protein channel that opens or closes in response to a particular stimulus.A type of intercellular junction in animal cells that function as a rivet, fastening cells together...

Afro Word Search 2025-11-19

10 Items: Animal que voa à noiteInseto com oito pernasDoces dados às criançasEstrutura óssea do corpoCriatura que bebe sangueMulher com poderes mágicosEspírito de uma pessoa mortaRoupa usada para se fantasiarLugar assombrado por fantasmasFruta laranja usada para decoração

Fun Animal Brain Games 2026-03-20

4 Items: LionTigerMonkeyElephant

Florida Word Search 2025-09-07

10 Items: state treestate animalcapital of FLstate reptilecurrent governor of FLcurrent mayor of Tampacounty that Tampa is inland with water on 3 sidesFL city with the largest populationmajor FL city that is known for theme parks (Disney)

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Unit 12 2024-02-26

12 Items: improperpoorly madea thin stripto agree withshowing no sorrowto stun or confusefit to be inspectednot taking any sidesa standard measurementto turn around a central pointa machine or tool used to do household jobsan animal or person that moves to different regions

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

Find animal name 2026-07-05

3 Items: CowTigerCamel

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

Renaissance 2025-05-23

10 Items: basic rulemounted gunproceed towardunderlying basisgrow or develop healthilyexpert or student in astronomyrepresenting the sun as the centera carved figure of a person or animalagricultural laborers with low statusa continuous area or expanse which is free

All About Me 2025-05-30

20 Items: AgeBirthdateFirst NameMiddle Name1st Car ModelFavourite FoodFavourite FoodFavourite ThingFirst Dream CarFavourite FlowerFavourite ColourBusiness #1 NameBusiness #2 NameWhat I call myselfName of First ChildName of Second ChildFavourite RestaurantBest Month of the YearFavourite Animal on paperWhen I grow up I want to be...

Your Spirit Animal For The End Of March 2026-03-20

10 Items: CatDogSwanSnakeRavenHorseJaguarMonkeyElephantButterfly

Dolphin Word Search 2025-02-11

15 Items: The largest marine mammalA small marine fish with a horse-like headA small, schooling fish found in the oceanLION A large marine mammal related to sealsA marine invertebrate with a star-shaped bodyA gelatinous marine animal with stinging cellsA large, predatory fish known for its sharp teethA slow-moving reptile, some of which live in the ocean...

🦁 Let's Go on a Wild Animal Safari! 🦒 2026-06-03

12 Items: foxharewolfkoalaostrichsparrowgiraffeelephanthedgehogkangaroosquirrelbutterfly

911 Dispatcher 2024-10-01

77 Items: samtomdoaadammarynorapaulxraybombloudtextybakerdavidoceanqueenunionyoungzebraalarmbreaksecurdrunkfightlaserpartyfraudwagonedwardrobertvictoralarmskidnapperarmdumpindisturdomestexplospermisharassperdwnpersusinvestweapondamageanimalpersonpersonshotguncharleswilliamtheftinpershotdomweapoverdosperwelfweatherinjuredbatteryrunawaylockoutcontrolofficer...

One Year Anniversary Search 2025-12-04

23 Items: LoveKoreaTexasKamrynOneyearLettersAirportSungjoonage we metInternationalMost made dishAnniversary datewhere we first metfirst official datemy nickname for himmost used app to callFirst holiday together200 day anniversary spotwhere we had our first kissFirst place traveled togetheranimal of keychain he gifted meeachothers favorite physical feature...

Joyeux Noël ! 2025-12-08

33 Items: elftoystardollhollyangelchildscarfsleighcandlewreathturkeygarlandpresentsnowmanchimneyreindeerstockingYule logsnow hatchampagnecandy caneSanta Clausgingerbreadmulled wineChristmas treeNativity scenestuffed animalChristmas carolAdvent calendarChristmas marketthe three wise menChristmas ornaments

Minecraft (For Little Puppy) 2026-04-12

20 Items: UndeadSnipersAwww Man?mmmmmm MilkOg Best ToolNewest weponI swing my...Little F*****has a job lolTreeee ChoppaCraftable BossBig enemy houseTime to end thisOrange jumpy friendVilliger on the moveMulti Colored Animal?Nice song, not creeper"...I still love ya baby."Number 1 rule of minecraftFirst Block for a minecrafter

a 2026-09-01

80 Items: aloeapexaxisaboveacornacutealbumalloyaloofamberangelappleazureagencyalmondalpacaamazonanchoranimalanswerartistauburnaugustauntieauthorautumnacronymactressaffableagilityalchemyalcoholalgebraallergyamericaamplifyanagramanalogyantiqueapricotarchaicaverageaviatoravocadoabstractacademicaddendumairplanealphabetamethystantelopeantennaeaquariumaromatic...

trs23 ver3 u4 2023-02-24

10 Items: A big cat.Really great.Not interesting.A kind of long pasta.Something you think up.Have fun doing something.#1. Better than everything else.A small animal that lives in trees.Ask someone to do something with you.A kind of chicken that makes noise in the morning.

Consonant Blends: sw, qu, dr, tw, tr 2026-09-04

10 Items: Where trains run on.Moving through water.Not making any sound.Moving back and forth.After one and before three.Taking water to your mouth.Doing something in a fast way.Dancing and spinning in circles.Transportation you can take to places.Big fictional animal who can breathe fire.

Animals 2026-09-03

25 Items: MoooooNeighhhEats cansPerry the _____Mans Best friendKing of the SafariKing of the jungleDogs primal creatureHas a long spotted neckAmericas country animalA feline with a homebodyA version of a CrocodileWood choppers of the wildA version of an AlligatorBaby _____ doo doo doo dooA huge mammal with a trunkUsed for wool and for its meat...

Animals 2025-01-28

8 Items: purr... get it?has a long trunkMan's best friendhas colorful wingsking of all the animalshas a long neck and is spottedbig and gray animal that lives in Africa.does it have black stripes or white stripes?

yuyi's word search 𖹭 2026-02-03

13 Items: what we are hehefirst date drinksgo to burger place!how much i love youwhat today is aboutour favourite animalfavourite hindi songwhat we should do todayour favourite drink placeour favourite shared animefavourite John legend songcheapest yummiest korean nammost expensive thing we ordered

Tulip, rabbit, reptile words 2025-11-14

18 Items: A womanA baby catSet on fireMouse or ratMake believePut togetherA sweet treatEating outsideA little flowerMore than enoughLearner at schoolA doctor for teethThe opposite of goodBlood drinking monsterLong-eared hopping animalWhat you sing and dance toA breakfast food with syrupA salty, crispy breakfast food

Fun Skills 6 Animals 2026-08-26

8 Items: An insect with a hard shell.A flying insect with large, colourful wings.A sea creature with a soft, round body and eight arms.A large animal that lives in the desert and has a hump on its back.A large, white bird with a long neck that lives on rivers and lakes.bear A large, white bear that lives in the cold regions of the north....

Finding secret animals 2025-11-11

9 Items: Man's best friendDied and came back to lifeUsed to skateboard in the 90's but now he's too oldA helpful animal with a shiny bald head and kind eyesMan's second best friend who's honestly just using him for foodKind of like a kite but it lives underwater and killed Steve Irwin...

EMD NATURE CODES 2026-05-21

26 Items: BURNSFALLSSTROKETRAUMACHOKINGDIABETICHEADACHESEIZURESAMPUTATIONANIMAL BITESSICK/UNKNOWNALLERGIC REACTIONOVERDOSE/POISONINGABDOMINAL/BACK PAINEYE PROBLEMS/INJURYDIFFICULTY BREATHINGASSAULT/SEXUAL ASSAULTELECTROCUTION/LIGHTNINGGYNECOLOGY/OB/PREGNANCYBLEEDING (NON-TRAUMATIC)STABBING/ GUNSHOT VICTIMCHEST PAIN/HEART PROBLEMSNEUROLOGICAL/HEAD INJURIES...

Happy Birthday Bri! 2024-06-25

10 Items: Bri's favorite cake.Bri's favorite holiday.- Bri's favorite season- Bri's favorite color.Bri's favorite food - mmm crispy.Bri's favorite animal - think pink!Bri's favorite movie genre - amour.- Bri's favorite summer activity - not running!Bri's dream vacation destination - known for pasta....

1st Grade S3W6 2026-08-06

10 Items: to explodeangry or madto fall overto be in painto smile widelyempty and abandonedan animal like a frogpuffed up from getting hurthaving lots of corners and turnshard to hold or stand on, usually caused by water or ice

sydney 2025-02-20

9 Items: indigenii aborigenio insulă din Australiamâncarea ursului koalao specie protejată de ursanimale cu marsupiu şi picioarecel mai vechi şi mai mare oraş dinactriţă australiană care săa făcutactor Australian care a jucat rolulanimal marsupial nocturn are trăieşte în

10 minutes de détente 2023-03-16

30 Items: ville de papeville d'arènesérie du soirmaison du sudcolis du mardiévénement de 2024chevelure du liontriangle chocolaténagui y fait chantersoignant post mortemhéros de tes lectureshabitude du quotidienil peut être d'honneurton jeu de train préféréton jeu de carte préféréta boisson de la journéefumé italien que tu aimeston animal de compétition...

ww5 u 3 & 4 2024-03-07

29 Items: weaka choiceto leavetoo earlyvery largeto cover upto lose hopestrong windsto understandexact, correctno longer livingsavage or fiercea meat eating animalto make strong againa feeling of great joya longing for the pastnot exact but close enoughto break off or cut in twoa long journey by sea or spacean animal that is hunted for food...

6th Grade Science 2026-04-10

20 Items: The gas released by plants.What a plant or animal does.The input detected by our eyes.The input detected by our ears.The greenhouse gas that plants need.An organism that makes its own food.Cells that send signals to the brain.An organism that must find its own food.The input detected by our mouth and nose.The term for plants spreading their seeds....

Most Common Words 2026-04-23

82 Items: addoffairwhytryownpagenamegoodhomeplayalsoturnhandhelpmuchmustneedkindlineherereadsametellcamedoesevenlandmovewantshowformwellsuchwentawayhighkeeptreecitylearnfoundwouldpointhousestudysmallthinkgreatspelllargeagainstillrightmeanswherethreeeveryplantbelowneverstartshouldletteranimalchangebeforefollowaroundmotheranswerschoolfatherbecausepicture...

Puzzle #6. Palabras con A. 2024-05-24

80 Items: ajoalmaaltoanísaptoaquíarpaacosoajenoálbumaletaalzaranchoángelantesanualañejoapodoarenaardoralhajaalhelíaliciaaljibeacordeafilaráfricaagendaalarmaalemánalturaamargoamarseamasaranimalantojoañorarapenasarenalalianzaaclamaradentroafloraraisladoalambrealargaralcaldealondraaltavozaltitudamarraraméricaancianoanguilaapliqueapuradoarbustoarcillaárbitro...

Can you guess? 2024-10-09

16 Items: My gradeMy little <3My hair typeMy hair colorMy favorite foodMy favorite colorMy favorite seasonMy favorite animalMy favorite musicalMy favorite holidayMy favorite subjectSomething I'm directingShow I've been a part ofMy favorite disney princessI wear these most of the timeMy preferred color of jewelry

Gato Word Search 2023-03-03

20 Items: something people sleep onsomething people use to write ona very common house pet that meowsa very common house pet that barksa device people use to communicatea form of art people can listen tosomething people wear on their feetsomething people use to carry stuffa big gray animal with huge gray earssomething you open to get into a room...

US<3 2025-02-04

14 Items: kissesyour monthwhere we metyour fav gameyour fav personyour fav animalyour fav tv seriesone of your fav songsyou always crave thissomething we always sayyour fav comic charactersyou like this veggie a lotme to you,in your languagesomething you love more than me jk

Adv. Deutsch II Vögel 2 2025-05-11

30 Items: owlnutduckcrowwrenseedfinchstorkberrybroodthrushmagpieinsectto cawvulturesparrowto feedomnivoreto hatchwoodpeckerchiffchafffalcon, hawkdove, pigeonEuropean robinswallow (bird)to hunt, chaseto eat (animal)to tweet, chirpto shriek, screamfamily of birds including titmice, chickadees

Lion Word Search 2025-09-24

2 Items: A long wordAN African Animal

Sopa de letras 2025-06-03

20 Items: Animal blanco con rayas negras.Brilla en el cielo por la noche.Instrumento musical con cuerdas.Se usan para cortar papel o tela.Herramienta que sirve para barrer.Utensilio para comer sopas o postres.Torre luminosa que guía a los barcos.Medio de transporte que va por rieles.Animal con concha que se mueve muy lento....

Puzzle Word Search 2025-11-13

22 Items: The gas we breatheA vast body of salt water.A mountain that erupts lava.An event with music and food.Often called man's best friendA person who travels in space.A colorful arc seen after rain.A place where you can find art.A sea creature with eight arms.The largest animal living on landA place full of books for reading....

Russia 2025-12-19

14 Items: beet soupfish eggsbiggest countrycapital of Russiaat war with Russiacapital of Ukrainepresident of RussiaSea south of Ukrainerare animal from Siberiadolls inside of each othersecond coldest place on earthclosest American state to Russiacountry with name like a US statesea that connects to the Black Sea

English Word Search 2025-10-07

12 Items: place, time, moodbig idea of a storycategory of a storytop of plot mountainthe feeling of a storystory from imaginationintroduction of a storyperson, animal, or figureseries of events in a textcharacters that don't changeacronym for indirect characterizationtrue story using real characters and setting

INVINCIBLE 2026-06-02

15 Items: our planeta farm animalan alien planetsomething you eata one eyed monstersomeone who is eviltaking over somethingsomething you live inthe emperor of Viltruma fast food restaurantsomething you throw awaya place you go every daysomeone who saves the daythe biggest thing in existencea different version of something

Vocabulary #22 2024-05-28

8 Items: a weak person or animalencouraging and nurturingto declare with convictionto believe something without proofwithout any doubt, very apparentlyto depend upon someone or somethingto propose as a candidate for electionsadness for what another is going through

Unit 10 Vocabulary 2026-01-23

12 Items: easily moved or carriedHaving to do with sight or seeinga ruler or leader who has total poweran animal hunted as food by another animala severe shortage of food over a large areato open up, make or grow larger; to developeasily broken, snapped, or cracked; not flexibleto do away completely with something; to put an end to...

Survive Word Search 2026-05-11

8 Items: asylum seekersAnimal domain areaoutlast in some placea place to keep animals safethe place where cattles liveOther word for 'most endangered'An action that human did to harm animalsthe place where a lot of trees or vegetations

Vocab word search 2024-04-26

12 Items: definition listening to ordersdefinition its like being treated crueldefinition to bark quick in a sharp tonedefinition something that supports wood for sawingdefinition a group of shelter like a bunch of tentsdefinition an inner voice bringing someone to rightness.Definition is when your crying and have tears in your eyes...

Pit stop - Food 2025-09-11

84 Items: HotDogEggTeaSaltSoyaMeatCakeCrabMealCafeKidsSoupBeerWineForkRicePizzaOnionSnackBeansItalyFruitJuiceDrinkWheatBreadSugarHoneySweetWaterOliveLunchKniveSpoonBaconToastGravyCurryPastaSnakeSheepburgerChilliPepperRelishTomatoCheeseBananaDishesHungryPeanutButterCerealAnimalPicnicBarleyDinnerLizardPrunesOrangeCoffeeHaggisLocustToppingSausageKetchupMustard...

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Animal Body Parts (Level 3 - Lesson 3) 2025-05-19

7 Items: catpawhornclawsteethtigerrhinoceros

Masculin Lettre A 2020-02-15

87 Items: anauâgeâgéairamiartabriaideangeaoutaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugle...

Masculin Lettre A 2020-02-15

83 Items: anauâgeâgéairamiartabriaideangeaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugleaccident...

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

Croton Polinators (some words are backwards) 2025-12-18

10 Items: Our town!Ruby throated…Inside of flowersIt’s in the title!A fluffy type of beePollinators Need it to live!A animal that’s terrified of bees…A flower in Croton that supports pollinatorsA place that’s Behind your house filled with flowersA special type of garden often used for different veggies

Naomie Crosswolrd edition 2026-03-10

13 Items: : Crush prime: vu que t’es lele: très impolie même: Toi de time en time: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: camer du côté de tik tok: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

quix time 2026-05-22

20 Items: Famous Nurse'Bad Romance'Barack's wife8am, 10am, 3pmVoice of GrootFlying DinosaurBeatles DrummerFrozen ContinentSpotted Dog BreedCapital of ScotlandAnimal named GolferDraco Malfoy's HouseCincinnati Bengals QBColors of Canadian flagThe Other British GingerChemical with symbol 'K''a happy little accident'The year this clinic opened...

Me & You 2024-06-19

11 Items: Our cityour best dateyour fave animalyour donut flavoryour fave Bee Gees songour shared home last yearyour silly little nicknamewhere we're getting marriedyour (alleged) favorite dessertthe gal we're gonna see in novemberthe band you started listening to after I forced you to branch out

PALABRAS HOMÓFONAS 2026-02-26

14 Items: buenos diascomida en casaquien te comentobella del orienteese puesto es mioun animal rumianteestá el trabajo listoeso es en las plantasque marejada tan fuertela comida a los animalesuna puerta en casa de mi tíaestá hermoso tu portaequipajeya basta ríndete no sigas luchandoes una buena forma de conseguir la carne

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

Lisa and Rob's wedding wordsearch 2025-06-02

14 Items: City we live inRob's middle nameRob's birth monthLisa's middle nameLisa's birth monthName of our pet catHazel's middle nameMatching tattoo animalSchool we both attendedLast gig we went to seeOur most watched TV seriesOur first holiday destinationBig nut that brought us togetherWhere we hung out together in our teens

merry christmas 2025-12-08

10 Items: first datemy step sonyour step sona word to describe youan artist we both lovewhat i ask for the mostmy favorite thing to dothe dog in our relationshipthe animal you remind me ofplace where you said i love you for the first time