animal Word Searches

Animal Word Search #1 2013-08-13

5 Items: DogCatBatElephantKangaroo

Domestic Animals — "Animal Wonderland!" 2025-04-17

5 Items: DogCatCowDuckRabbit

Animal Word search ~ 2 2026-07-18

5 Items: tigerbunnygeckosnakelizard

How Well Do You Know Your Wife? 2024-07-18

15 Items: shoe sizemiddle namefavorite coloriloveyousomuchdream pet animalcantwaittoseeyoufavorite NBA teamanniversary monthmy favorite smellwhere is my home?boil favorite foodhow many kids do i wantfavorite sibling ( my own )favorite wingstop wing flavormy favorite color hair on myself

Dog Word Search 2024-10-17

10 Items: A soft and independent pet that enjoys lounging and purring.An aquatic animal that lives in water, typically kept in an aquarium.food Special food made for pets like dogs, cats, and other domestic animals.A legless reptile that slithers, sometimes kept as a unique pet in terrariums....

Cat Word Search 2025-12-31

10 Items: - to look at words and enjoy a story.- to move, imagine, and have a good time.- something that makes you laugh and smile.- a happy face made when something is funny.- a funny name for a character who likes to play.- words that tell about fun characters and events.- a small animal that swims and gives advice in books....

Yukki x Yuno 2025-08-19

11 Items: Chipmunkfavourite animefavourite mangafavourite animalcommon spiritual goalwhat you hate me sayingphrase I hate you sayingour favourite board gamelanguage learning togethermax number of kids we havingfavourite thing to watch together

Animal Farm Wood Search 2026-01-07

5 Items: LeadersheetsWindmillNepoleonFarmhouse

Cat Word Search 2026-08-02

10 Items: zebrahippoPredatorThe meow-erA random gameA... puntuaton?!Man's best friendYay, a big animalVideo streaming and watchingThe word u say when meeting someone new or when u see say ur mom.

SAMPLE GRIDLOCK 2025-08-08

15 Items: An expression of happinessA vehicle that runs on tracksA piece of furniture to sit onThe natural satellite of EarthA large natural stream of waterA plant with a trunk and branchesAn animal with feathers and wingsA white liquid produced by mammalsA staple food made from flour and waterOrganized sound that is pleasant to hear...

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

Groundhog Word Search 2026-01-19

10 Items: - a guess about what will happen next- the cold season with snow and short days- a hole in the ground where an animal lives- the bright light in the sky that makes shadows- something people do every year in the same way- to do something special for a holiday or event- a dark shape made when something blocks the light...

Useless Word Search 2025-09-15

5 Items: Young at heartGood for nothingThe inside story?Blood vessels to the heartTusked animal of the far North

Ecology 2023-04-20

13 Items: Organism that only eats meat.Organism that only eats plants.Animal hunted by another animal.Plants use _____ to make energy.______ eat dead and/or decaying matter.Organism that eats both plants and animals.______ break down dead and decaying matter.All of the energy on earth begins with the ____....

Girlfriend, Word Search 2025-02-12

10 Items: be my?I'm yourhugs'n'kissesfavorite Leif songa kiss from my babecode for I love you!dreamy forest animalfavorite Tyler Childers songwhere we found the best sandwichA warm gesture, often involving arms

7x10 animal 5 words 2026-09-17

5 Items: dogcatbirdtigerwhale

Republican and Democratic Parties Animal Symbols Cross Word 2025-10-08

13 Items: nastpanictweeddonkeythomassymbolharperlincolncartoontammanyelephantcampaignpolitical

122 2026-01-08

70 Items: SunFurDaySeeFunSkyIceHatSnowColdWarmHoleTailPawsEyesEarsTreeSignLookHideWakeLongCuteWaitTownTimeDarkWindCloudFieldGrassSleepEarlyShortFurrySmallBrownEarthWatchCrowdStoryTodayLightFrostScarfBootsShadowWinterSpringBurrowAnimalForestNatureInsideSeasonGroundLegendJacketGlovesWeatherMorningOutsidePredictComeoutHolidayFebruaryCalendarTomorrowGroundhog...

Stick it Words 2026-05-20

70 Items: whofewwasbeendoesdoneeasyfacthalfhearhourideaonceonlyyourreadeachgonetalkthantoldturnsurewereaskedclosewouldearlyfoundgrouprightlargelearnotheragainstorethinkthosetrieduntilwatchwaterwholealmostanimalanswerbehindbetterchangeduringeitherfamilymyselfpersonprettyreallyreasonschoolalreadyshoutedthroughbetweenfinallybecauseproblemwouldn’teveryone...

Animal 2026-08-19

2 Items: catdog

Word Search 2026-08-05

8 Items: Bad dream"Let us pray"Waiter in ParisA lover gives it awayCard game with a dummyAttractive piece of metalSouth American pack animalWhere to see stars at night

Really? 2025-01-10

22 Items: What fruit is slightly radioactive?What is Cookie Monster's real name?What animal sleeps with one eye open?One in 18 people have this extra body part.What were chainsaws originally invented for?The speed of a computer mouse is measured in?What is the hashtag symbol technically called?What is the most shoplifted food in the world?...

Flower Word Search 2023-04-17

5 Items: a animala plant that growssomething to write witha place where kids learnwork given to do at home

Seagrass October 2025-09-05

18 Items: aliveeatingenigmavisitorfriendlyneeds helpon our ownsandy shoremidday mealhairdressingwhere we swimanimal friendscity just norththe state we're inplace for social hourfor playing hand and footwhere ocean meet the sandnearby large body of water

Diabolical Word Search 2024-08-06

69 Items: PigCowAntSkiCoolAuntKingBakeNeffQuickThumbProudShareLemonPlazaJesseSecretAnimalDonkeyAntlerMelodyZipperBasketMizzouTrumanGalenaTigersFaroutNoxiousPopcornMinimumDogwoodLibraryCornellHearnesColumnsRespectMissouriProofingBlushingInfringeFootballHospitalColumbiaHawthornLafferreMountainsGarrulousRelevanceTranslateAmbiguitySouthwestDiscoveryDiabolical...

1223 2026-01-07

70 Items: SunFurDaySeeFunSkyIceHatSnowColdWarmHoleTailPawsEyesEarsTreeSignLookHideWakeLongCuteWaitTownTimeDarkWindCloudFieldGrassSleepEarlyShortFurrySmallBrownEarthWatchCrowdStoryTodayLightFrostScarfBootsShadowWinterSpringBurrowAnimalForestNatureInsideSeasonGroundLegendJacketGlovesWeatherMorningOutsidePredictComeoutHolidayFebruaryCalendarTomorrowGroundhog...

Español con la Doctora Vilá Geis ~ Sopa de Letras 2026-05-18

70 Items: AjoPanRíoPerúIslaVidaAmorFelizMadreCartaCapazAmadaCoquíBahíaPanamáOcéanoVolcánCaribeAmigosMúsicaComidaTomateCantarAnimalCuerpoConfíaRegaloFloresYunqueCuevasEcuadorTortugaPalmeraOfrendaGraciasFamiliaMaestraCebollaNavidadHábitatPoderesProcesoSevillaAlegríaLimpiarCuriosaAmorosaSanJuanColombiaPacíficoMonarcasAguacatePrósperoFlamencaCreativaValiente...

Vocab Man 2026-04-30

29 Items: bybuscitylaketreebearbirdplaceoceantrainhotelmuseumanimalmonkeyticketstadiumcountrytheatertell memonumentairplaneto learnto visitboat/shipfantasticimpressivelike/such asto scuba diveto rest/relax

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

French Word Puzzle (Casse-tête de mots en français) 2024-11-27

22 Items: The number 30The verb to be?The verb to go?What do you read?The verb to like?Where do you live?What animal barks?What animal meows?The verb to speak?First month of the yearWhat is a high landform?Where do you go to learn?What do you drive on the road?What is the light of the night?What do you drink to stay hydrated?...

Toxic Substances Wordsearch 2026-05-06

23 Items: discovered radiuman atypical hattercreator of a blue dyesubstance used by paintersanimal used for making hatscaused by arsenic poisoningcreator of toxic green paintradium girls famously paintedbeing subjected to a substanceused to make hats after mercurypaint that isn't toxic by itselfanother name for the green paintwas considered a miracle element...

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

Rainbow Word Search 2025-09-16

6 Items: HorseGod's sign to NoahPost Office purchaseAn old-time record playerA sneaky gift to Troy (2 words)A make-believe animal with a horn

Ben’s Giant Animal Word Search 2022-08-25

6 Items: catlionzebrahippoelephantMan's best friend

Cat Word Search 2022-09-15

6 Items: dog's enemyMan's best friendthe king of the junglebiggest mamal in the worldhave white and black list furdangerous animal ini the world

Animal Assisted Therapy & OT in Acute Care 2025-04-19

10 Items: BalanceBenefitsEnduranceFineMotorMotivationEngagementPrecautionsFunctionalTasksPatientCenteredOTInterventions

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

Welcome to Dr. Puzzleverse's Word Search Puzzle - Animal Edition (#1) 2025-01-17

27 Items: OwlFoxLionWolfBearZebraTigerPandaKoalaSharkEagleWhaleSnakeParrotRabbitMonkeyTurtleGiraffeDolphinPenguinCheetahLeopardOctopusElephantKangarooFlamingoCrocodile

CR Amex team 2022-09-29

17 Items: teamsureLDA's petpuntarenasCR capitalmarried manmommy to beproud to beSaprissa' petwhite last namebreakfast to goCosta Rica lifestylead dealers main functionseasonal fruit 2mil el Keveryones fav college drinkCr most exported fruit 2019unexpected animal that joins zoom meetings

62) NOMBRES DEL REINO ANIMAL PARA BOSTON TERRIERS 2026-01-13

12 Items: RanaTopoLinceFénixCebraCarpaGorilaÁguilaDelfínGrullaHalcónBisonte

Pros y contras de tener una mascota 2025-06-02

9 Items: Valor que debe tener para hacerse cargoDesarrollo de lazos emocionales; vínculo fuerteBeneficio físico y mental que puede aportar una mascotaSensación de no estar solo, especialmente con un perro o gatoPuede presentarse si el animal hace ruidos o destruye objetosReacción que puede tener la gente ante la presencia de una mascota...

Movies 2026-02-15

7 Items: Pope selectionReligion done rightChalamat's magnum opusLost hearing watching imaxLittle boy made me breakdownAnimated animal movie with no dialogueTarantino movie with a part anime section

Dog and animal word search 2026-04-01

6 Items: catlionzebrahippoelephantMan's best friend

Clue 2 2026-03-23

13 Items: a colorur majorur allergyur fav showConnor Pennur fav movieour mascot animaldorm hall by DATCUa piece of jewelryur personality traitnot your talons familywhat you do at the gymwhat someone is called when they are crazy

Pig, oink! 2025-12-13

10 Items: a pink tribe...The animalWant a sprite?...Mircusfan81First challenge!Ghosty merge tribe!Something that pigs sayFirst boot of the seasonOne of the oink variants,Could mean a trolls protagonist, or a Dandy's world starter!

Word Search for Dementia Care 2026-03-10

10 Items: helps you seea round fruitlives in watera drink from cowsyou play with thisyou wash with thisa small pet animalyou listen to musicsomething fun to playyou wear on your feet

Ocean friends 2026-06-02

10 Items: I have eight long arms to swim.I have a flat body and a long tail.I am the biggest animal in the ocean.I look like a tiny horse and swim upright.When I get scared, I puff up like a balloon!I am a small, orange pet that lives in a bowl.I have many sharp teeth and I am a fast swimmer.I am a smart and friendly animal that loves to jump....

David Word Search 2024-10-20

14 Items: Who annointed David?Who was David's father?Who was David's best friend?What instrument did David play?Who was David's great grandmother?What King wanted to have David killed?What animal did David tend for his father?Who was the Philistine that David went to battle?Who was the woman David saw taking a bath on a roof?...

Animales del bosque 2024-08-22

15 Items: Mamífero elegante con grandes astas, que habita en bosques y montañas.Predador canino, símbolo de fuerza y unidad familiar en la naturaleza.Mamífero salvaje de gran tamaño, conocido por sus colmillos y su fuerza.Ave nocturna con grandes ojos, conocida por su sabiduría en la mitología....

unit 16 2024-04-24

12 Items: roughnot bendingto get alongextinct animalto stuff tightlycapable of growingto take upon oneselfsomething that protectsan action that is wrongto supply with furniturea person of the same ageto expose to injury or harm

A WORDS 2024-02-01

73 Items: asatactaddageagoairallandanyarmartaskablealsoareaawayaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattackauthorabilityaccountaddressagainstalreadyanotherarticleactivityactuallyalthoughamericananalysisanythingapproach...

Sea Creatures 2026-04-13

15 Items: The way the ocean water moves in and out during the day.A wobbly, see-through creature that can give you a sting.A very deep, dark valley on the bottom of the ocean floor.A gentle, slow-moving plant-eater often called a "sea cow."A tiny fish that swims upright and looks like a land horse.A clever animal with eight arms that can spray ink to hide....

Wedding Wordsearch 2025-02-18

20 Items: Luke's best manLuke's middle nameLuke is Stacey's...Stacey's maiden nameStacey's maid of honourStacey/Here comes the...Luke & Stacey's last nameTheo and Arthur are the...Mollie and Chloe are the...Luke & Stacey are 'Just ...'what type of animal is Bun-Bun?The name shared by the most guestsWhat type of animal watched Luke propose?...

Veterinary Abbreviations 2026-04-11

37 Items: SurgeryPosteriorThyroxineSmall animalSpayed femaleOperating roomSulfamethazineVentral-dorsalevery other dayQuality of lifeRed blood cellsProthrombin timeSubcutaneous(ly)Specific gravityWhite blood cellsPosterior-anteriorPacked cell volumePhysical examinationPhysical examinationToo numerous to count[Latin] Per os, orallyUrinary tract infection...

Vet Med Term Word Search 2025-12-01

32 Items: WartsFat tissuePain (suffix)Dead on arrivalAbsence of teethA newborn animalA neutered male rabbitLacking normal muscle toneSoftening of tissue (suffix)A complete joint dislocationDull, depressed, nonresponsiveThe cause or origin of a diseaseThe way an animal moves or walksA tumor made of mucus-like tissueLethal dose (amount that can kill)...

trs23 ver2 u12 2022-11-25

10 Items: 100use your teethopposite of thina big, scary fishopposite of lighta yummy thing to eatcan lift heavy thingswill make you feel scaredtry to run and catch somethingthe outside of an animal or person

Payton's Clue Week Day 2 2025-10-12

10 Items: Your big's star signYour big's cat's nameYour big's dream careerYour big's favorite foodYour big's first concertYour big's favorite colorYour big's favorite movieYour big's favorite flowerYour big's favorite animalYour big's favorite holiday

Amazing N and O 2026-05-04

15 Items: A fruitA colorA shapeA numberA numberA big birdA vegetableA sea animalPart of the bodyParts of the handHouse of the birdsA vegetable or oilWorks at the hospitalA sea animals with 8 legsA bird what makes huhu sound

Les mots de Bibracte 2020-04-10

73 Items: fermurruevueabriansearmeboiscireclefclouépéehaiehouxmiremontorgeparcurnevertarbreautunaversbijoucésardomusécoleéduenforumhêtremeuleoutilanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedoliumamphorearverneatelierbeuvraycollègecollineconcertcouventtruelleassiettebâtimentbibracteboucliercervoisechantierchapellechaudron...

Norway Polar Puffs Word Search 2026-03-02

11 Items: Oslo - The capital of NorwayFjordland - Norway's most famous natural gemSkiing - The popular winter sport credited to NorwayReindeer - Christmas's famous animal found in NorwayScandinavia - The European subregion where Norway is foundAurora Borealis - The natural phenomenon also known as "Northern Lights"...

Noah's Ark: Genesis 6-9 2023-07-15

14 Items: Who loved God? (page 27)What covered everything? (page 31)The people _____ about God. (page 26)What did God put in the sky? (page 33)What did the dove bring back? (page 33)What animal did Noah send out? (page 33)What did God tell Noah to make? (page 28)Noah and his family _______ God. (page 33)How did Noah and his family feel? (page 32)...

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Endangered Animal Word Find for Room 8 2026-05-06

9 Items: kiwifalconleoparddolphincriticalExtinctionVulnerableorangatangEndangerment

Les mots de Bibracte 2020-04-10

73 Items: fermurrueabriansearmeboiscireclefclouepeehaieminemiremontorgeparcsitearbreautunaversbijoucesardomusecoleeduenelevefleurforgeforumfoyerhachehetrerepasanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedessindoliumfauconreleveamphorearverneatelierbeuvraycollegecollineconcertcouventassiettebatimentbibracteboucliercervoise...

School 2020-11-30

72 Items: catdognotteatenrunfunbigsunfoxcowjimlionpenstimewithsaidmilknoonmoonwolfgolfkiwidocsnotszebrahippomathsbookspaperbikesbreakfruithorsetrackafterclassdriveanimalinsideplayedchromeminutepeoplehitingsitingpersonaroundgooglewritingreadingmoaningteacherarguingplayingoutsidepencilsmorningfriendscartonsrunningchickenstudentelephantlearningfightinglistening...

Biology Terms 2025-08-26

75 Items: DNARNACellGenePreyBirdFishLipidClassOrderGenusNicheBiomeVirusPlantAlleleGenomeEnzymePhylumFamilyFungusAnimalMammalNucleusVacuoleProteinHormoneOsmosisKingdomSpeciesEcologyHabitatArchaeaProtistReptileRibosomeLysosomeMembraneCellWallMutationTaxonomyPredatorBacteriaCytoplasmOrganelleAminoAcidDiffusionEvolutionCommunityEcosystemBiosphereSymbiosis...

2nd Grade Practice 2025-11-30

72 Items: ouroldanyskytrynewairfourintobothkindmostgiveonlyalsoweekdoeslongwellpartlandgoodyearcityliveknowshowmoveoverabledoorworkroomthingtheiraftersmallthinktodayrightplaceunderwhichagainlargelearnworldfoundhousesoundgreatmeansalmostchangefollowpeopleacrossanimalbecomebeforebehindletternumberaroundschoolanotherpicturethoughtthroughanythingsomething...

eer, ear 2026-08-22

24 Items: feargearhearneartearyearpeerclearcheersteerfearfulhearingclearingcheeringsteeringappearingA rude or unpleasant lookA mocking or scornful smileTo look closely or carefullyLoved or cared about very muchTo shout or call out to show supportTo make fun of someone by shouting insultsTo guide or control the direction of something...

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

test4 2026-03-01

10 Items: fasttwo timesnumber to addman-made clothhole made by an animalMakes things from clayCrunchy snack or cookieA big land like India or USAthin threads, also a nutrienta sick person who gets medical care

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

Instructions 2026-01-14

32 Items: FastGo upHave toNot fastAfter thatAfter thatAt the endUse scissorsSave someoneIn a safe wayIn a soft wayWithout dangerLift somethingMake somethingPlace somethingMove on your feetBefore anything elseIt is a good idea toTry to find somethingPut something somewhereHold and take somewhereAttach with glue or tapeA tall plant with leaves...

Final Exam Review 2026-03-31

30 Items: Joint painItchy SkinYoung sheepWithout painRed blood cellTo remove hornsintact female catStudy of the skinWithin the muscleRefers to the backWay an animal movesReferring to two sidesPeriod after a seizureExternal portion of earMove towards the midlineImaging using sound wavesControls circadian rhythmTop of the head in equines...

Posties Big Read 0212 2024-01-22

6 Items: doubting that something is true or usefulsolid waste that comes from the bottom of a person or animala large, black and white animal that lives in forests in Chinaa soft, wet substance made from wood, which is used to make papera tall plant with hard, hollow stems, often used for making furniture...

How well do you know me? 2025-09-09

15 Items: biggest fearfavorite foodfavorite musicfavorite animalMy favorite colormy height is 5’_”what makes me laughfavorite pizza placeLeast favorite colorMy moms maiden name isfavorite pair of shoesFavorite family membermorning or night personDream vacation is in the…how many places I’ve lived

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Animal Word Search Puzzle Book: Fun & Challenging Brain Games 2025-03-12

14 Items: lionzebrahipporhinohyenababoonjaguargiraffecheetahgorillaleopardelephantkangarooantelope

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

Wicked 2024-12-07

61 Items: OzHatCryBoqManWandGoodShizRoseCityBickbandBroomNessaGlindaUplandThroppWickeddragonCoddleElixirWizardFiyeroGalindaPfanneePopularElphabaGravityAnimalstornadoGlassesmonkeysShenShenGoodnessMorribleslippersBallroomDefinishOutuendoDulcibearDillamondScarecrowBraverismGrimmerieWickedestRejoicifyprofessorsWheelchairSwankifiedWizomaniacHideoteousGalindafied...

Trick Words 2025-06-10

74 Items: wonsonbothfulltalkpullwalkdonegoesusedknowsureonceknewawayheadloseJulyonlymoveshallagainoftengreatreadywhoseearlyoceanpiecelaughyoungplaceworldearthlearnhouserightprettypleaseanimalalwaysMondaycousinboughtenoughAugustcoupleanswerfathermotherschoolagainstcountryTuesdaybroughtJanuaryspecialtroublepicturebrotherthoughtAmericafavoritetomorrowThursday...

The Great Christmas Wordsearch! 2025-12-19

74 Items: sixiceelfboomapsnowcoldtreestarbellclapheroplugwiretreeleafrootseedstembirdfishdiettimesevenfrostsantaelvescarolpartypantostagecheermagicfairypowerplantriveroceanglobeshapewintersleighbaubletinsellightsprinceenergysocketswitchfloweranimalmammalforestnumbersnowmanchimneycurtainvillainbatterycircuitreptilehabitatreindeerpresentsstockingaudience...

Earth Day 2026-04-21

75 Items: AirWindSoilTreeLeafSaveEarthGreenReuseOceanRiverSolarWaterPlantCleanTrashWastePaperGlassMetalNatureReduceForestEnergyAnimalCarbonGlobalFuturePlanetRecycleClimateHabitatProtectPlasticCompostOrganicWarmingSustainBalanceCleanupGoGreenWildlifeEarthdayGreeneryPollutionEcosystemFootprintRenewableAwarenessRecyclingZeroWasteEarthcareWatercycleAirquality...

Cat Word Search 2023-05-02

10 Items: Wild dogLand Sea horseMan's best friendWomans best freindKing of the junglesomething you sleep onworlds largest land mammalpineapples don't belong on _____Animal with stripes in the savvanahthe old way of transportation without cars

Lollapalooza Word Search 2026-02-14

7 Items: Our first dateHalloween dateOur old hang out spotOur nicknames recentlyThe month we got togetherWhere we had our our first kissThe name of our first stuffed animal

Good Word Search 2024-04-30

7 Items: bonroi des animauxdire quelque choseplanete qui a beaucoup d’eauanimal grands et fin qui rampesentiment quand tu perds ton perefruit rouge qui tombe des arbres d’après Newton

Year Word Search 2026-01-01

12 Items: not oldwhat we eata special daya bright colora light decorationa time of 12 monthspeople we live withbringing good thingsshows days and monthsanimal signs for yearsthe light in the night skyto make something not dirty

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

Decifrando a Páscoa 2023-03-16

6 Items: Semana...Alimento do coelhoLugar onde se guardam os ovosAnimal que representa a PáscoaDia da Páscoa no calendário semanalProduto que são feitos os ovos de Páscoa

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

Anniversary! 2026-05-31

7 Items: my work!my favorite animalmy favorite personwhat we'll do today ahathe feeling i have for youwhat i REALLY love to do aha..what i like to do in my freetime

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Word saerch page 21 ANIMAL BABYS 2015-07-21

7 Items: POTROPICHÓNOZESNOBECERROCORDEROCACHORROBALLENATO

ANIMALS AND ITS BODY PARTS 2025-11-12

15 Items: CatDogDeerLionFishhippoParrotOctopusElephantit's got a beakit's got long neck and it's yellowit's got black stripes and it's whiteBig animal, it's got big teeths and it's brownit's got long neck and it's white; it's a birdit's got a tail and it's brown; it lives in the jungle

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....