animal Word Searches

SUMMER 2025 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

Hajj Season 2026-05-21

20 Items: CowHajjLambGoatCamelTawafKabahIhraamQurbaniShavingTrimmingEidulAdhaSacrificePilgrimageMuzdalifahMonth of Eid-ul-AdhaIt is an integral of Hajj to be hereArabic word for sacrificing an animal for HajjThe Prophet who was ordered to sacrifice his sonOne needs to make their ihraam intention before here

Patti's Word Search 2023-01-20

24 Items: Involved animalCommitted animalPredicting effortTemporal limitationA weird water carafeAKA Leonardo of PisaPenultimate ceremonyDelta x over delta tShort consistent cycleBefuddled interrogativeHow much can we completeBreaks down into storiesEvery morning, with a rockPrioritized work to be doneWe do this with the backlogSlows or hinders productivity...

20 of my most challenging words form 2023 2023-12-06

20 Items: to be givena reverse movementnot alined proplelyan expert in scientsto be full of glamoura person who fixs teethto be scade of somethinga rainforest in queanslandto let someone do somethingbefore what has just happenda animal that lives in africaa animal that lives in the seafuels a fuel made out of fossilsto see something that is obviose...

Yea 10 Trivia Challenge 2025-02-17

27 Items: Largest ocean?Longest river?Largest planet?Largest desert?Largest island?Smallest country?Capital of France?Fastest land animal?whale Largest mammal?First U.S. president?Number of continents?Closest star to Earth?First man on the moon?Largest country by area?Chemical symbol for gold?Chemical symbol for salt?Chemical symbol for iron?...

동물 2026-08-04

64 Items: zoocoqoieanechatlionveaumuleloupcerfoursraiechienchiotlapinvacheboeufzebrecrabedindecarpesingeanimaloiseaulievremeuuuhchevalpouletcochonsourischevremoutoncanardrenardtortuephoqueloutrerequinhomardlezardfourmipoissonhamsterbaleinedauphincalamarpieuvreserpentabeillecochonetblaireauecureuilanguilleelephantescargotcrocodilemaquereaumoustiqueguinea pig...

test 2026-01-19

7 Items: FruitSofwarePopular game consoleA song by Foo FightersFamous pop culture monsterAn animal most people like6 string musical instrument

An Officer and a Gorilla 2024-01-31

15 Items: 담요맛있는벽난로불타다서부의부드러운보호하다도착하다잡고 있다숫자를 세다What animal is Afolabi?Afolabi wanted to go home to _____.Afolabi woke up in the New York _____._____ often came to the forest to catch gorillas.

srcs p words 2026-08-12

13 Items: PAINhappyconfidentput out firewasting awaya set of roomsdifferent lingosstudy of grammartree living animalchuse between stuffbathroom in bedroomfood made of avocadowaddles; btw, it lives in Antarctica

SKy Science vocabulary 2023-12-15

4 Items: best animalrock in spacerock hitting earthice and ball flying

fonfas 2023-05-19

4 Items: magicmartim's dadbrown animalused to attack a person or something

YLC8 - Unit 6 - Reading 2025-11-25

10 Items: Not deep. (nông)Liked by many people. (phổ biến)Almost, very close to. (gần như)Tell someone about danger. (cảnh báo)Harm or break something. (làm hư hại)Used in science or factories. (hóa chất)Stays and does not leave. (ở lại / còn lại)Makes people or things come closer. (thu hút)A long, curved tooth of an animal like an elephant. (ngà)...

Level 2 2026-01-12

10 Items: What professional treats sick animals?What equipment protects workers from injury?What type of behaviour is an animal born with?What term means responding to the environment?What do we call the place where an animal lives?What do we call daily care routines for animals?What term means animals passing diseases to humans?...

unit 10 2024-01-22

12 Items: to endguiltyto groweasily brokento move lowerfood shortageeasily carrieda sincere requestcarful with moneyan animal in dangerruler with total powersomething to do with sight or seeing

Sunshine 1 Program 10 2023-12-27

64 Items: catsaybadcutendtopweresurfcamebanglegswheebackhillwarmtestideasstillcomicyoungbrokeslopespeedsleepymovingcalledmatterfreezematteranimalenoughsleighpickedflyingclosetfluffyquiltsgrandmawarmingprogramawesometheaterbedroomstartedheavehofinallyreachedmorningfinishedsleepingtextbookinternetfreezingfollowedterriblesteamingyourselfexercisesurprised...

Likes and Dislikes 2024-05-07

51 Items: teadayTeagamecatsdogsfoodfishsodadanceCreamjeansonionsleepwateranimalapplesbananacoffeefamilyflowersalamitiktoktomatoyellowchickenclothesorangessausageyoutubebirthdaycomputerlemonadeto musicpinapplesneakersbreakfastchocolatehamburgerchocolatemotorbikespaghettiactivitiesvegetablesvideogamesTelevisionwatermelonfoodtropolisto the beachstrawberries...

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

vocab man 2026-05-18

26 Items: bybuszooseabirdbeartreelakecitytrainplacemonkeyanimalmuseumtheaterstadiumto learnairplanemonumentboat, shipattractionnational parkplay (theater)amusement parkcountry, nationto scuba dive/snorkel

Bat Word Search 2025-09-23

7 Items: A wild dogA night birdA night insectA small rodentA howling animalAn eight-legged bugA flying mammal at night

Dolphin Word Search 2025-02-11

10 Items: A highly intelligent marine mammalA crustacean known for its large clawsA marine organism that forms coral reefsA small fish known for its horse-like headThe largest mammal on Earth, living in oceansA large predatory fish found in oceans worldwideA gelatinous creature with tentacles that can stingA slow-moving reptile, some of which live in the sea...

Wildlife Word Search 2026-01-19

10 Items: - to keep something safe from harm- the natural home of an animal or plant- a living thing like a dog, bird, or lion- to help and look after animals and nature- a place with many trees where animals live- the world of plants, animals, land, and water- animals that live in nature, not in homes or zoos...

Grace5letterwordsearch 2024-05-13

3 Items: planetsmall animalopposite to no

Les mots de vocabulaire 4e classe 2022* 2022-01-13

63 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachevolermarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterramperautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercherchervendredinovembresanglierhérissonpartagerregarderdécembre...

Word Search 2025-11-10

60 Items: ideacloudcolordreamlightoceanrivertruthanimalbeautycactuschoicecircledesignenergyengineforestfuturegalaxygardengrowthmemorymomentnatureplanetpuzzlerhythmshadowvisionwisdomabilitybalancebraverycomfortcouragefeatherfreedomharmonyhistoryjourneypatternpromisesciencesilencesuccessthundercalendarcreaturedecisionlanguagelaughtermountainmovementstrength...

Laciudad Word Search 2026-04-29

26 Items: byseazoobuscitylaketreebearbirdplacetrainmuseumanimalmonkeystadiumtheatermonumentairplaneto learnto visitattractionboat, shipnational parkplay (theater)country, nationto scuba dive/snorkle

Psychology Word Search Ch.2 - All 50 Terms 2026-06-12

50 Items: factsamplesurveytheoryopinionvalidityattritiondeceptionempiricalreplicatedebriefinggeneralizehypothesispopulationcorrelationfalsifiablereliabilitycontrolgroupobserverbiasparticipantsrandomsampleplaceboeffectinformedconsentarchivalresearchconfirmationbiasdoubleblindstudyexperimenterbiasrandomassignmentsingleblindstudydependentvariable...

Katseye 2026-07-23

59 Items: GapM&MWildLaraMarzTouchMywayManonMeganFlameDebutMeifiDanonMoonzDanisGnarlyAnimalSophiaSodaniSolarzMegaraCherryEyekonKatseyeGameboyPinkyupDanielaSunchipMaphinzMeichaeMeiziniYoonaraLarielaDanchaeSodanonMarziniYooniesSophiasYoonchaeLaralonsGabriellaMeangirlsTimelapseMegatronsManontiesDirtywaterAllthesameMonsterhighDreamanchorStellatiaraInternetgirl...

Invasive Salmonellosis 2025-08-02

8 Items: What One Health sector provides surveillance data from farms and animal health workers?What kind of study compares those who became ill with those who didn’t to find risk factors?What structured meeting brings together human, animal, and food sectors to share outbreak data?...

Sprout vocab 2025-06-27

62 Items: drygelhumstayturneachmallmarkovenforksavepassmeanlacksaltitemjokestudyvoicecleanextrapointlabelshapewaterstoreorganbloodfrownguidestackspacemarineanimalstatuehammerlitteraroundpoisonguiltyfluffymusclefridgediamondsurfacenaturalwhisperpredictperformcontrolfactoryexcitingsunlightfunctionnegativeinterviewnaturallysculpturesparklingfossilizeimportant...

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

Spelling bee 2025-12-29

60 Items: KnowAsiaOftenEarthCurlySixthWrongWroteBrownGradeTowerMaybeNovelFightGrandShouldHelpedBoringTaughtAnimalFigureFranceDidn’tCoffeeofficeTurningHeavierUkuleleProjectConcertScienceExpressReserveAmericaPopularEnglishTheaterMagicalHistoryInventedHeadachePracticeStrongerBirthdayMedicineKindnessTerminalAirplaneElevatorBreakfastExpensiveRecyclingDifficult...

A1 1st batch 2026-08-03

60 Items: AANASATADDAGEAGOAIRALLANDANYARMARTASKBADBAGALSOAREAAUNTAWAYBABYBACKBALLBANDBANKBATHABOUTABOVEACTORADULTAFTERAGAINAGREEANGRYAPPLEAPRILACROSSACTIONADVICEAFRAIDALWAYSANIMALANSWERANYONEAROUNDARRIVEARTISTAUGUSTAUTUMNBANANAACTRESSADDRESSAIRPORTAMAZINGANOTHERARTICLEACTIVITYANYTHINGAFTERNOONAPARTMENT

Clue #3 2025-09-27

10 Items: My majorfavorite flowerFavorite HolidayMy favorite CandyMy favorite DrinkMy favorite Animalbeach vs mountainsMorning or night owlFavorite food on campusSport I did in highschool

Dolphin Word Search 2025-02-11

10 Items: A highly intelligent marine mammalA crustacean known for its large clawsA marine organism that forms coral reefsA small fish known for its horse-like headThe largest mammal on Earth, living in oceansA large predatory fish found in oceans worldwideA gelatinous creature with tentacles that can stingA slow-moving reptile, some of which live in the sea...

An Officer and a Gorilla 2025-03-05

15 Items: 털: _________담요: _________맛있는: _________불타다: _________서부의: _________부드러운: _________보호하다: _________도착하다: _________벽난로: ___________잡고 있다: _________숫자를 세다: _________What animal is Afolabi? _________Afolabi wanted to go home to _________.Afolabi woke up in the New York _________._________ often came to the forest to catch gorillas.

Sunshine 1 Program 10 2023-12-28

64 Items: catsaybadcutendtopweresurfcamebanglegswheebackhillwarmtestideasstillcomicyoungbrokeslopespeedsleepymovingcalledmatterfreezematteranimalenoughsleighpickedflyingclosetfluffyquiltsgrandmawarmingprogramawesometheaterbedroomstartedheavehofinallyreachedmorningfinishedsleepingtextbookinternetfreezingfollowedterriblesteamingyourselfexercisesurprised...

Axe Word Search 2025-02-25

63 Items: AxeGunSawRopeClubRockFireAcidVaseKnifeSpearHandsWaterSwordSteamSpearStoveTeethSmokeShovelHammerPoisonGuitarAnimalStairsBridgePillowWelderMalletVehicleIcePickCrowbarMacheteNailGunCrossbowChainsawToxicGasScissorsTableSawFryingPanChemicalsFirePokerHDMICableTwineRopeCorkScrewStarvationBaseballBatBrokenGlassHighVoltageGlassBottleBowlingBallHockeyStick...

MCWs Word Search! 2025-03-31

62 Items: saytoooldanyboyputwhytryaddfewnamegoodlinesamecamewantshowalsoformdoeseventurnheremoveawayhigheyesheadboththinkgreatwhererightmeansthreelargeagainstudyeverynevergroupbeforefollowaroundanimallettermotheranswershouldschoolfatheralwaysthroughanotherbecausepictureAmericacountrythoughtsentencetogetherdifferent

Mssandra Word Search 2025-08-15

58 Items: ARTFUNZOEYFREDLUKEFARMCAMPWALKKAYLALUCASJACOBCYCLEPIZZAGAMESXANDERDANIELSTEVENRONALDANIMALMOVIESSMILESSMORESSOCCERPUZZLEDONUTSMSHILDAMRERICKALONDRABRAYDENEMANUELSCIENCERECYCLEPROJECTEXICTEDLIBRARYFRIENDSMSSANDRAMRDAMIANLEMONADEBARBEQUEICECREAMMSCAMILAMSAMAILIASUPERHEROSCHOOLAGETAWKWONDOQUITEGAMEINSIDEOUTADVENTUREWORDSEARCHWATERSLIDECHARACTERS...

MJ7 2026-06-25

63 Items: hammudvestturntaximineourscoinyardfarmtruckspicytastesoundhoteltrainwhosefluteluckyriveryummywalletletterlonelybakerycorneracrosspolicechurchtheirsanimallittlebottleinsectmuseummarketforestcastleislandpotatotomatopresentpopcornsweaterunhappyrailwaystationglassesworriedexcitedcountryenvelopeterriblehospitalairplanescissorswonderfulbookstoresurprised...

Year 1 Tricky Words 2026-07-06

62 Items: whowhyaskouryourhomemanysaysminekindonlyopenwalktalkknowveryloseagainhouseafteraboutgreattheirwaterlaughuntilwomanbuildwomenfriendschoolmotherfathersistercousinfamilybeforeanimalpeoplecaughtreallyboughtacrossthougharoundbrotherthoughtanotheralrightalreadythroughminutesdecidedbelievechildrenfebruarysurpriseremembertogetherdifferentsomethingfavourite

THE MOST EPIC 250 Clues Animal House Word Search 2025-06-04

250 Items: PITAUCHIZITBREWJOHNERICRUSHFAWNMINXKILNCARTKENTKATYDDAYBETHGREGBANDROTCTRUEDELTAMUSICSHOUTDANCEGATORBLUTOPEARLOTTERHANKYPANKYHULCELARRYPINTODEVILANGELLOTTAFURSTCARDSHORSESISSYSTORKBRAINBOONESPEEDMYJOBOMEGATHETAMANDYGLOVEMAYORBUNNYINPOOLDINNERSPRINGFEMALEGUITARLADDERHARBORPIRATEGOLFERMARIONSHELLYPREMEDKROGERUPTODOEDITORLEGACYSTUPIDKENNEYDWAYNEDAMAGE...

Karina and Coffee Facts 2026-01-13

20 Items: Her ageA green nutHer favorite colorEspresso with hot waterHer favorite type of foodEspresso with steamed milkAnimal she is allergic tooI am a dog who loves to eatI am a dog who hates to eatPoet who's known for ravensA tiny strong shot of coffeeFavorite Disney princess movieWho's birthday are we celebratingHer favorite slow and lazy animal...

Dog Word Search 2024-08-19

3 Items: an animal that goes woofa small feral animal that rhymes with hata yummy food that is cold and rhymes with dream

ULTIMATE WORD SEARCH 2025-04-22

41 Items: Half girl, half fishThe king of the jungleHidden gold and jewelsA sneaky, fast fighterColorful arc after rainA spooky floating thingA colorful flying insectA tiny cake with frostingIt buzzes and makes honeyA slow animal with a shellA yellow fruit monkeys loveCold, sweet, and melts fastA horse with a magical hornA spiky plant in the desert...

From Head to Toe - Animal Word Search 2015-01-21

12 Items: catsealcamelparrotmonkeydonkeypenguingiraffebuffalogorillaelephantcrocodile

Différentes classes des règnes végétal et animal 2022-10-06

12 Items: oiseauxpoissonreptilesinsectesamphibienmollusquecrustacéssegmentésmammiféresarachnidesarthropodesmille-pattes

Mr. Monkey and the Hut 2026-05-11

10 Items: 집: ______________남자: _______________동물: _______________원숭이: _______________행복한: _______________You can _______________ the ring.The man is taking _______________.He is _______________ a green hat.What color is Mr. Monkey? _______________This is not a mouse's house. This is my _______________.

Différentes classes des règnes végétal et animal 2022-10-06

12 Items: oiseauxpoissonreptilesinsectesamphibienmollusquecrustacéssegmentésmammiféresarachnidesarthropodesmille-pattes

May Word Search 2026-09-04

8 Items: Favorite colorFavorite animalFavorite artistAre you handsome?What pet do you have?This month is very specialDo you love your girlfriend?What's your girlfriend's name?

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Week 3 Review by Sharli Syed 2023-11-05

11 Items: Makes proteinsBreaks down food into energyInformation for making proteinsPackages and sends proteins out of the cellContains and protects genetic material (DNA)Breaks down and recycles worn out animal cellsCellular package containing products such as proteinHolds everything inside the cell, enclosed by the cell membrane...

Get to the Root of it Unit 16 2026-03-14

29 Items: Eating only meat.A reddish-brown stone.To separate from the body.Relating to abstract ideas.Hostility or strong feeling.Mental calmness or composure.Showing animal-like qualities.The quality of being physical.A scientist who studies physics.The order of meat-eating mammals.The science of matter and energy.An animal that eats other animals....

Animal World 2026-04-05

3 Items: LEMUR, DOLPHIN, OTTERBEAR, CHEETAH, RHINO, CROCODILE, FOX, WOLF,TIGER, ELEPHANT, MONKEY, PANDA, ZEBRA, GIRAFFE,

WORD SEARCH 2026-03-23

5 Items: extinctPygmyShrewA larger RabbitThe largest native mammal of IrelandA soft, domestic animal, primarily bred for their meat

Animal Word Search pt. 1 2026-05-08

7 Items: catdogbirdfishmouserabbithamster

Animal Word Search pt. 2 2026-05-08

7 Items: beecowlionhorsesnakezebrahippo

May 13 concert 2026-04-28

9 Items: SCARY!a moviehas do in ithas day in itMy favorite animalfrom sesame streetfast and slow songa movie gabby knowsa soft and loud song

Earth 2026-02-17

8 Items: BiosphereAtmosphereLithosphereHydrosphereRiver, Lake, Glacier, Rain, Snow, Ice, StreamRock, Mountain, Volcano, Crust, Canyon, Desert, HillAnimal, Human, Forest, Insect, Habitat, Ecosystem, TreeOxygen, Nitrogen, Cloud, Wind, Storm, Temperature, Pressure

I AM SELAH! 2025-03-28

13 Items: my catmy carmy universitymy high schoolmy best friendmy favorite foodmy favorite bandmy favorite colormy favorite sportmy favorite animalmy favorite subjectmy favorite make upmy favorite vacation spot

trs23 ver2 u13 2023-01-09

6 Items: not whitea tall plantfight or playchicken, beef, porka black and white animala place with lots of trees

Nature's Classroom Word Search 2023-11-15

58 Items: preysoilacidhikeadaptnymphbioticcanopyedibleexotichydriclichenmammalnativecenterabioticaquaticaquiferof preydiurnalecologyextincthabitatreptileboatingdomestichumiditymollusksomnivoresandhillsamplingsurvivalcompoundamphibiancarnivorecommunityecosystemelevationherbivorenocturnalcamouflagecrustaceanendangeredcrepuscularevaporationgroundwater...

Plural Nouns 2024-04-08

65 Items: daymanboxcupkeyantelfskyflywayleafarmygulfdeerlifetunachefheroechowifeladybodyloafcalffootroofdwarfchildwomanratiochiefiglooknifesheepbanjomooserodeobunnypartyclasscoachpatiomousetoothradiobeliefvalleysalmonpotatoanimalpersonstudiotomatokidneysupplystereoworkermemorysurveyjourneysheriffcountryvarietyscissorskangaroo

Chapter 7 Word Search 2024-10-01

60 Items: DNARNAATPwallacidPiliCiliaplantporeslightsugarlipidsanimalgranumstromaenergyNucleusVacuolebilayerproteincapsuleproteinproteinmembraneLysosomeVacuolesVesiclesflagellaPlasmidsMembranebacteriaenvelopereticulumapparatusRibosomesCytoplasmchromatidChromatineukaryotethylakoidOrganellePhosphateCentriolesCentrosomePeroxisomechromosomeprokaryoteGlycolipid...

Spiritual 2024-11-24

64 Items: AirFaeHexJarLeoSunTeaEnkiFireMarsMoonRainWardWindAngelAriesChaosDeityEarthGhostHedgeHerbsOceanStarsTarotVenusWandsWaterAnimalApolloAstralCandleCharmsDaemonDivineDreamsEnergyFreyjaGardenHermesMediumOraclePiscesSpellsSpiritCrystalDowsingFlowersGoddessKitchenLuciferMercuryMinervaPotionsScorpioCauldronGrimoirePantheonPendulumPentacleAstrologyLightning...

8A Vocab Man 2026-05-07

26 Items: byseazoobuscitylaketreebearbirdplacetrainmuseumanimalmonkeystadiumtheatermonumentairplaneto learnboat, shipnational parkamusement parkplay (theater)country, nationto scuba dive/snorkelattraction, attractions

123 2025-05-20

6 Items: man or womana person under 18elephant, lion, racoonpeople on a playgroundgangsters, doctors, copsair, coca-cola, alien rock

Year 7 2025-07-16

12 Items: WHAT RELIGION IS THE POPE?WHO WAS ELIZABETH'S FATHER?WHAT ANIMAL FOUGHT IN RINGS?WHAT WAS THE NICKNAME OF MARY TUDOR?WHAT RELIGION DID HENRY BRING TO ENGLAND?WHAT ANIMAL DID THEY USE TO ATTACK BEARS?WHAT WAS THE ROYAL NAME OF HENRY'S ONLY SON?WHAT DID ELIZABETH FIND BETWEEN THE TWO RELIGIONS?WHAT POPULAR SPORT WAS ENJOYED BY THE RICH ON HORSES?...

for my love 2024-06-04

14 Items: my nameby clairoI ____ you_______ toileti love ____ (you are ____)source #1 for con to the domsOGRE NOISE TUTORIAL CREATOR NAMEthree numbers we say i love you withaction that i love that involves the lipsmy amazing boyfriend's name muwah muwah muwahthe sound of a kiss that we like to text each other...

Sandra Boynton 2025-08-21

5 Items: The animals that "go berserk" in her 1977 bookOne of the animals to dance with in her 1993 bookThe clothes that it is "time" for in her 2000 bookThe animal that wakes everyone up in her 1997 storyThe animal that it is good to "be like" in her 2002 song

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

Dog Word Search 2022-12-23

9 Items: tigges breedour favourite petsCharlie's boyfriendwhere we lived abroadmy favourite cocktailyour favourite cocktailmum's favourite word gameour favourite holiday destinationwhat woodland animal piggy looks like

Growth 2023-06-28

12 Items: An animal that eats acornsThis big ape is endangeredThe name of an oak tree's seedThis animal lives in AustraliaThe type of snake that Mr Stones hasThe found that Mr Stones' snake eatsA fruit that is grown in the rainforestWhat you have made from toilet rolls this weekThe continent that Mr Davies' parakeet comes from...

Dynamic Ecosystems 2026-04-20

12 Items: When an animal leaves a ecosystem.When an animal comes into a ecosystem.The first animals to live in a ecosystem.Animals coming in and out of aan ecosystem.The amount of organisms in a specific place.a community of living and nonliving organisms.The amount of one species a ecosystem can hold.When animals fight each other or help eachother....

Objects 2024-02-29

3 Items: Garfieldman's best friendmy animal at home

CELER'S WORLD 2025-11-11

18 Items: Irunssevenhillshellostoryalways(I) amI livefriendsbig (masculine)friend (feminine)friend (masculine)the narrator's nameMONTIBUS on the hillsbelonging to me/mine (feminine)city where the story takes placekind of animal that narrates the story

Christmas words 2025-01-03

15 Items: white iceman in redfrozen waterholiday plantringing soundhang for giftsheavenly beingChristmas songslight in the skyround decorationfun gift for kidspresent for someoneanimal with antlersfigure made of snowlight for decoration

Siga as pistas 2026-07-01

9 Items: Cor do solNós tomamosAnimal que rastejaantes do número onzeNós usamos para comerO melhor amigo do homemNós usamos para escreverUsamos para nos secarmoscinquenta mais cinquenta

animals, animal noises and places where animals may live 2013-02-15

19 Items: catdogpigratliongoatbearbearbirdpumazebrahipposheeppolarmousebunnydonkeyanimalselephant

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

NEW YEARS EVE 2023-12-27

4 Items: Bugs bzunnyAn animal with 4 legssomething that smellstransportation with 4 wheels

Amor Word Search 2026-02-13

30 Items: huglovecarekissdategiftcardringrosestrustheartCupidpartyletterdinnerpartnerromancepassionflowersballoonloyaltysupportcandlessurpriseto sharechocolatefriendshipto celebratestuffed animalto fall in love

Grammar review 4 vocabulary 2026-05-12

31 Items: oazėduonagalvažvakėpiliskaimassunkuspykinastalasžmonėsekranasmiestaskosulysgyvūnasplunksnasandalailigoninėpaspaustidribsniaiatmintukasvandenynasugnikalnisperšalimasprisijungtispausdintuvasgarsiakalbiaisvaigsta galvaatogrąžų miškasgalvos skausmaskompiuterinė pelėišsaugoti dokumentą

spanish 2026-05-20

26 Items: byseazoobuscitylaketreebearbirdplacetrainmuseumanimalmonkeystadiumtheatermonumentairplaneto learnboat, shipnational parkamusement parkplay (theater)country, nationto scuba dive/snorkelattraction / attractions

South America Funny 2025-07-03

15 Items: What does a lazy volcano do?What's a dancer's favorite dip?What grain is always feeling super?Where do mountains go for a spa day?What fruit says "Bonjour, bonjour!"?What do you call a dramatic pack animal?What fish writes the best scary stories?Where do super strong women like to shop?What animal is always dressed for winter?...

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

Dog Word Search 2024-05-02

8 Items: a sporta devicea furry animala small devicea pointy shapea mans best frienda place to cross overThe biggest planet in our solar syestem

Reyna's Favorite... 2023-10-05

21 Items: WordFoodColorGroupSnackFruitDrinkAnimalSeasonVeggieTV showCartoonCandy BarComputer GameSchool SubjectWhat on her ceilingItem from McDonald'sWhat she wants to beOverseas place to visitPlace in DC she visitedArticle of clothing, black ...

Beach Word Search 2026-08-04

53 Items: upfairmenumallcookfarmparkbeachordermoneyservetrashwasteplantpartyguestfruitshapecolorphotocoursenearlyimpactdesigngathermarketanimalonlinefarmersellerdessertplasticpreparewelcomeNationscollectvisitorsup trashcampaignleftoverkilogramsandwichrecyclingvolunteerawarenesschallengevegetableingredientrestaurantsupermarketorganizationup decorations...

Noël 2024-12-13

28 Items: elftoystardollhollysleighcandlewreathturkeygarlandpresentchimneysnowmanornamentreindeerstockingYule logchildrenchampagnecandy canegingerbreadSanta Clausmulled wineChristmas treenativity scenestuffed animalChristmas carolChristmas market

Domyhomework Word Search 2026-01-07

66 Items: gymMaywalkbusymessteamJuneJulybloglifelivelovegetupMetooearlyneveroftenvisitMarchAprileverymyownreallyMondayFridaySundayAugustanimalonlinetravelgotobedwatchTVTuesdayfreedaytoolateJanuaryOctoberwalkingwritingpancakesThursdaySaturdayFebruaryNovemberDecemberhavelunchSeriouslyWednesdaySeptemberteenagersgotoschoolhavedinnertidymyroomComeonguystakethebus...

Nature's Classroom Word Search 2023-11-15

58 Items: preysoilacidhikeadaptnymphbioticcanopyedibleexotichydriclichenmammalnativecenterabioticaquaticaquiferof preydiurnalecologyextincthabitatreptileboatingdomestichumiditymollusksomnivoresandhillsamplingsurvivalcompoundamphibiancarnivorecommunityecosystemelevationherbivorenocturnalcamouflagecrustaceanendangeredcrepuscularevaporationgroundwater...

vocab 2026-05-05

27 Items: seabuyzoocitylakeplaytreebearbirdplacemuseumanimalmonkeyto tanstadiumcountrytheaterto restmonumentto learnto visitattractionto ride boatnational parkto scuba diveto ride horseto buy souvenirs

Ratos Puzzle 2026-02-04

12 Items: GêmeaEu te …ChocolateNosso animalVocê não suportaBebida favorita?Sua segunda casa?Minha cor favorita?Água com gás + limãoVocê faz comigo 24/7O nome do nosso filho?O que você mais gosta de soltar?

Angora Goats 2025-11-27

20 Items: A young angora goatA group of angora goatsThe coat of an angora goatA type or kind of livestockThe standard of mohair fibreSomeone who raises angora goatsIndustry that uses mohair fibreSending mohair products overseasThe grassy area where goats grazeHow goats feed on grass and plantsFarm animals raised for production...

wordsearch 2026-06-01

6 Items: My favorite colorMy favorite sportThe month I was bornMy favorite sea animalSomething I'm scared ofOne of my favorite movies

Guinea pigs! 2025-06-15

19 Items: An orange vegetableThe act of eating faecesAn animal that eats plantsTerm for a male guinea pigThe technical name for pooTerm for a baby guinea pigTerm for a female guinea pigA type of hay from oat grassCaused by a lack of Vitamin CA type of faeces to be consumedThe genus guinea pigs belong toA breed known for their spiky fur...