animal Word Searches

Ben’s 25th Birthday Adventure Puzzle #1 2025-09-05

10 Items: Antlered animalThe big celebrationWhere the trails leadThe age you’re turningThe month of your big dayWarm glow under starry nightYour hobby with rods and reelsA small wooden home in the woodsA small boat powdered my paddlesWhere hidden treasures are waiting for you

Valentine's Puzzle 2026-01-24

10 Items: Your favorite foodYour favorite drinkWhat do I call you?Your favorite animalYour favorite flowerYou love these with buldakA place where you fought a warA place we shared many glances everydayYour answer to "Will you be my Valentine"The month we first met in the train tracks

trs23 ver3 u8 2023-03-24

8 Items: A kind of flower.Wow! That is _________!A person who does magic.The clown does a magic _____.A kind of small, cute animal.Use this to keep your neck warm.Use this to keep your body warm.Use these to keep your hands warm.

A'lana 2026-02-10

15 Items: creepyto freefree timevery correctto hold downa big mistaketo set on fireto add more detailthings at/from hometo put in your own wordsto go after someone/somethinga plant or animal no longer alivesomething the same as something elsesomething that is better than something elsetrying to convince someone of something fake

Agriculture Revolution & Development of Civilization 2025-08-18

14 Items: Growing or making somethingThe growing of plants or crops.A person who manages and works on a farm.The act of gathering food from wild plants.Rich in nutrients and good for growing plants.The practice of taming wild animals for human benefit.The large-scale planting and growing of a single crop.Husbandry The organized raising and caring of animals....

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

The Actor Word Search Puzzle 2022-07-29

15 Items: ActorActorActorVideo EquipmentVideo EquipmentWilson's Main JobHenry Loves This AnimalJune Loves Creating ThisWilson Loves To Play This SportVideo Equipment (Use _ As Space)Henry's Main Job (Use _ As Space)June's Favorite Character To Play AsHenry's Favorite Character To Play AsWilson's Favorite Character To Play As...

changing ecosystems 2026-04-21

12 Items: redoing an ecosystemleaving the ecosystemcoming into an ecosystempopulations can shrink fromliving parts to an ecosystema community starts from scratchorganisms starting an ecosystemnonliving parts to an ecosystemthe first things in an ecosystemhaving different spices of treesanimal wanting the same resources...

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

To Kill a Mockingbird CH 24-25 Vocabulary 2025-04-09

11 Items: hesitationto find one’s waya thin surface layerconstant threat; coercionmoral or religious beliefssuspended until a later timesomeone who pretends to havefoul and repulsive; neglecteddevoted to divine worship or servicean undesirable animal, usually a scavengera device for blowing air on a flame in order for it to grow

Word Search Puzzle 2026-03-06

12 Items: A tiny ant is the (small) ______ insect in the garden.The blue whale is the (big) ______ animal to ever live.A cheetah is the (fast) ______ land animal in the world.If you get 100% on your test, your score is the (good) ______.The person with the widest smile is usually the (happy) ______....

2 2025-02-07

10 Items: What kind of animal is Franklin?What famous comic strip is also the name of a food?What animal swore that one day he would kill Mowgli?Who is the youngest of all Winnie the Pooh’s friends?Who owned a hammer so heavy that only he could pick it up?What was the fourth word used in all the Harry Potter titles?...

Creativity Word Search 2022-05-25

5 Items: of great significance or valuethe ability to do something wellusing thought or rational judgmentUse of the imagination or original ideasthe existence of an individual human being or animal.

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

PMC Tech Week Word Search 2024 By Dr. Kristin 2024-09-06

22 Items: Our RescueWe work atClinic CatDogs are __PMC ManagerOur Pet StoreBlood SpinnerOur newest vet!Our CorporationWho’s that girl?Dr. Chuck’s breedThe OG technicianDr. Todd’s nemesisNot just a mustardSqueeze with caution!Heather’s favorite animalDr Kristin’s fabulous dog!Diabetic monitoring systemThe Great Pretender (dfdx)Dr. Kristin runs a lot of ___...

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

April 2026 Word Search 3 2026-02-18

20 Items: a baby ducka young cowa young sheepa young horsea young rabbitoutdoor play areawalking leisurelymelodic bird callsa fruit tree flowera young bird in nesta bell-shaped flowera two-wheeled vehiclean animal tunnel homerunning at steady pacea tubular flower spikea toy flown in the winda large fragrant blossoma pink spring tree flower...

Iholidi 2026-04-24

41 Items: howwhocryusenowbodybagswhenlicehairplayboatfishwellenterboardlouseitchynightwheretodaya lotbadlyhousesinjectsnakesdolphinsupportpictureanimalsholidayto fishmorningexplainbe foundmachineshow manya littleafternoonlargest land animalwhere animals are kept

Les larmes de l'assassin - chapitre 1-5 2024-03-06

12 Items: violenceserpentsimpressionnerNom de famille de PaoloLes ______ de l'assassinLe nom de la ville de Luis ?Animal donné à Paolo (p. 43)Auteur du livre : Anne-Laure _______Qui a gagné à la fin du chapitre 5 ?Nom du pays où se déroule cette histoireAngel utilise un _______ pour assassinerQu'est-ce qu'Angel a demandé à Paolo de cuisiner pour lui ?

trs23 ver3 u3 2023-02-24

12 Items: Sound.Scared.Not loud.By yourself.Wow! I am ____!From sunset to sunrise.You turn it on so you can see.Sleep in this when you go camping.When you eat in the middle of the day.Noise you make when you are very scared.Dogs, elephants, mice, lizards, chickens.Place where you can borrow and read books.

unit12 2024-02-28

12 Items: to agreenot strongto zone outfit to be seento turn arounda standard scalea thin tiny stripnot taking any sidea helpful thing for work or your housean animal or person that moves non-stopnot feeling sorry about something you didhurting for no other reason than to do it for fun

trs23 ie2 u4p2 2022-11-16

8 Items: More good.A bird's mouth.Birds use them to fly.Go up a ladder or a tree.It is at the back of an animal.Picture made with pencils or crayons.Birds have them all over their bodies.A place you can go to see wild animals.

Kipling Word and Symbol Search 2025-02-04

30 Items: WinterCub CubBat BearCity ClawKing Kitelair Lairrat RiverRock RockCave ChickDeep DholeEarth EchoHare HillsWolf CopperHunt Jungleleaf LeavesMang MonkeyMugger MuskRun SeeoneeTrain WaterCold CounselLost MammalsSunlight ThePanther PeaceSilence SnakeWhispers WildCouncil CoyoteElephants FangFootprints FrogOutcast Outdoor...

Abiotic Word Search 2026-08-31

90 Items: foodcodonfinchfluidnichestudysugarwateralleleanimalatriumbioticcarbondarwinenergyenzymefusionislandlivingoxygenabioticanatomybiologybiomasscarrierchamberdioxideecologygametesmeiosismitosisnephronosmosisproteinsegmentspeciessystemstrophiccapacitycatalystcellularchemicaldistinctdivisiondominantgeneticsgenotypemembranemoleculemutationmutationorganism...

Gatsby Vocab #2 2025-03-03

5 Items: a wild gatheringa plant or animal naturalized in a regiona slight suggestion or vague understandingcharacterized by extreme care and great effortcontented to a fault with oneself or one's actions

A Bear of a Search 2026-06-24

25 Items: Squishy movie snackBetter than goldfishA pleasant labyrinthHow I feel having youDefault wordle guess wordFlorida adventure somedayOriginal Ice Hotel locationWhat I want to win of yoursMortal Kombat and bird singsWhat I want to share with youAnimal Sarah wants to swim withWhat makes you want to hibernateYour current subscription package...

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

united 2023-01-20

33 Items: leafsagemodemlaptopserverrouternutmegpenguinprinterwindowsdesktopcomputerdatabaseinternetfirewallhardwaresoftwarerosemarylavenderalligatorbandwidthcoriandertechnologyabsorptionthe study of mushroommain herb found in pestothe national spice of hungarythe main circuit board in a computerthe fastest land animal in the world...

Organization of Life 2025-02-04

82 Items: DNAFURDOGEGGKEYFOXLIFETREEFISHACIDTREECELLBEARSKINCLASSORGANPLANTFUNGIVIRUSGERMSTEETHORDERGENUSWHALECORALCLAWSAMOEBASYSTEMPHYLUMFAMILYSYSTEMENERGYDOMAINTISSUEARCHEAANIMALYOGURTDARWINTRAITSAVIANSSIMPLEKINGDOMSPECIESFLOWERSANTLERSMAMMALSBLOODEDCOMPLEXPROTISTBIOLOGYECOLOGYBLOODEDBACTERIAFLAGELLATAXONOMYLINNEAUSEVIDENCEREPTILESFEATHERSORGANISMBACKBONE...

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Draft 1 2025-09-03

94 Items: NPISKIDDMNDAESWSSAWESDDUFMMBUSPODSSURFZONEHOMECODEDISCKASSCADSOCHENRYSTUDYGAMESMOTORNURALOMEGAHANGARONTRACVISNAVCLARKEWALTONBEAUTYDIETFCDYSONGVACUUMANIMALMAXWELLJACKSONVILLAGELIBRARYCHAPMANCYCLONEJEMISONAIRWRAPFARMINGMOROCCOMAHJONGBIGBANDCONCORDETRAININGROEBLINGMALAYSIASECURITYHAMILTONGILBRETHAIRBLADEDELIVERYCLIMBINGROCKSTARBIRDCAGEISTANBULCHITOSAN...

DIET MEGA WORDSEARCH 2025-09-08

92 Items: DDMDDUNDANPISKIWESFMMMSCSSAPODSHOMEZONESURFBENGDISCMENGHENRYMOTORNURALOMEGAADSOCKASSCGAMESSTOMPSTUDYHANGARCLARKEWALTONANIMALONTRACVACUUMVISNAVBEAUTYDIETFCDYSONGCHAPMANLIBRARYJACKSONMAXWELLVILLAGEJEMISONAIRWRAPCYCLONEFARMINGBIGBANDMAHJONGMOROCCOCONCORDEMALAYSIAROEBLINGGILBRETHHAMILTONAIRBLADECHITOSANDELIVERYEMBEDDEDSECURITYCLIMBINGROCKSTARTINTAGEL...

unit10-grade9 2026-03-30

20 Items: animal wastevery importantfood for plantsan animal's homevery interestingbalance in natureto damage or hurtspace beyond Earthto value somethingto watch carefullya shape of the landsomething dangerousextremely importantto go around a planetto influence somethinga protected natural arealand with a lot of grasschanges in weather over time...

Our Word Search 2026-01-25

13 Items: Our artistWhat you areOur first mealOur love languageYour favourite animalHow I know you love meMy favourite place to beOur children's hair-typeWhat makes us feel betterMy favourite name you call meMy favourite feature about youThe first anime we watched togetherThe class I was in when we started talking

Biotic and Abiotic Factors Word Search 2026-03-18

23 Items: A single living thingNonliving parts of an ecosystemHow hot or cold an environment isAnything organisms need to surviveAn animal that hunts other animalsWhen organisms rely on factors to liveAn animal that is hunted by a predatorA factor that restricts population sizeIncrease in size or number of organismsAn abiotic factor essential for survival...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Basketball Word Search 2025-04-04

89 Items: pianovideopotatotomatocamerabananaanimalcelerybicyclelibraryprivacyapricotvitaminladybugimagineanotherhistoryunhappybolognapajamasOctoberavocadobroccoliumbrellaenvelopetortillacomputerhospitallemonadecategorygiganticsandwichcoloringmagazinetomorrowSaturdayNovemberDecemberelevatormacaroniblueberryprincipalpiggybankpolicemantelephonebeautiful...

KERJAYA 2025-11-04

30 Items: DoulaActuaryShipbrokerProsthetistGeoscientistCIA LinguistFoley ArtistPuppet MasterHippotherapistEthical HackerCourt ReporterData DetectivePiano TechnicianWelding EngineerCity IoT AnalystVoice-Over ArtistWaterslide TesterMedical ScientistCreative CatalystForensic LinguistStunt CoordinatorAirplane RepossessorBlockchain ArchitectAnimal Control Officer...

The Zoe And Conner Word Search 2026-05-24

21 Items: My birth monthMy favorite petThe food I hateOur first childJewelery I wearOUR lucky numberWhere I was bornOur second childYour birth monthThe girl you loveMy favorite colorMy favorite doggyMy favorite animalOUR favorite candyYour favorite colorYour favorite chipsYour favorite candyColor I wore to promMy favorite football team...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Christmas 2024-10-23

7 Items: Animal that pulls Santas sleighFrosty winter figure made of snowDecorated evergreen for ChristmasHung by the chimney for small giftsSantas little helper in his workshopWhat you give and receive on ChristmasJolly man who delivers gifts on Christmas Eve

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Ecosystems Word Search 2026-04-20

21 Items: A species that no longer existsTo be able to live successfullyA place where an animal or plant livesThe role an organism plays in its ecosystemThe process of making more organisms of the same kindAn organism that kills and eats other organisms (prey)The seasonal movement of animals from one place to another...

Materials 2025-03-27

16 Items: A thick and stiff type of paper used for boxes.A strong, heavy metal used in buildings and tools.Dried plant stems used for animal bedding and hats.A soft, fluffy fiber used to make clothes and fabric.A hard, natural material found in rocks and buildings.A shiny, yellow metal often used for jewelry and coins....

R Word Search 2026-03-11

2 Items: dallas's fav animalthe boy sitting next to you

Have fun 2026-06-15

7 Items: The city you live inThe capital city of ChinaThe capital city of South KoreaWall The biggest wall in the worldA large African animal with a hornSouth African food similar to barbecueKorean food made with vegetables and spices

2B Lesson 1-3: Make a Drum Set, The Animal Band, Musical Glasses 2025-12-15

30 Items: AddCanHitIanLidLowTapBoneDrumHighKikiKyleShowSoupBaronCarolFluteGlassGuessSoundTrunkBottomSingerDrumsetGlassesKitchenTrumpetDifferentDrumstickOrchestra

Animal Body Parts (Level 3 - L2) 2025-05-19

5 Items: necktusktrunkgiraffeelephant

Animales 2024-08-27

2 Items: Qué animal salvaje tiene un cuerno en su nariz y una piel gruesa.Qué animal salvaje es conocido por sus aullidos y pertenece a la familia de los cánidos.

Clare's Big/Little Clue 3 2024-02-22

10 Items: What state am I from?What is my hair color?What sorority am I in?What color are my eyes?How many dogs do I have?Where do I do to college?What is my favorite movie?What music genre do I like?What is my favorite animal?What jewelry color do I like?

Medical Terminology C. 5 - The Body as a Whole 2024-11-13

10 Items: groinred blood cellblood productionpertaining to the tailpertaining to the extremitiesparalys of one or both eyelidsinflammation of the peritoneumdestruction of red blood cellscancer cells spreading to sites away from where they originatea minute microorganism that replicates only within a cell of a living plant or animal

Vocabulary Text Smart 1 Station2 2026-03-09

10 Items: BildThe white keys of old pianos were often made from ...After walking in the sun, I was so ... that water never looked so good.My little sister thinks she’s a ________ because she has 200 followers.The doctor told me to take my ________ twice a day so I can feel better.Polar bears will become ... in a couple of years: There are only a few left....

Anniversaire 2024-03-24

13 Items: 1500Dans quel lieu ?Un point cardinalUne note de musiqueQui n'est pas encore mûreLà où le soleil se couchemettre à l'abri des regardensemble de pièces de monnaieAction de pour-suivre quelqu'un, un animalQui indique l'unité de début dans une sérieFaçon de s'exprimer, intensité d'une couleurCe qui guide dans une recherche, suivre une piste...

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

#FINDINGDAHL - Matilda 2024-12-09

10 Items: Miss Honey's first name.The name of the librarian.Miss Trunchbull's real name.The name of Matilda's brother.The name of Miss Honey's father.Age when Matilda started reading.The name of Matilda's favorite author.The boy who ate Miss Trunchbull's cake.Animal that was in Miss Trunchbull's glass.A book full of mystery according to Matilda.

. 2025-05-13

10 Items: Bossa's mateNashville's hockey teamWe rode these around the netlove's trilogy water escapadeThe animal you petted at the zooPasta dish we helped my mom makeWe found an art _______ in a hotelWe are in a medium ____ relationshipHow we see each other while we're apartYour favorite veggie with lemon and honey

Autumn vocabulary 2025-11-15

10 Items: used to frighten birdsmade from autumn fruitlights in the night skyused to keep you hands warmused to keep your head warmused to keep your neck warmlight to help you find the wayan autumn fruit for making jamanimal which stores nuts in winterprovides heat at night near your tent

Mulan 2026-02-18

8 Items: Showing courage.A person who fights in battle.Mulan's loyal animal companion.The leader of China, who Mulan serves.Mulan disguises herself to become one.To change appearance to hide one's identity.Respect or good reputation, crucial to the story.The main character who disguised herself as a man.

Wedding Wordsearch! 2025-07-06

9 Items: The best man's name.Toms favourite sport.Where they got engaged.Bec's favourite animal.The Man of honour's name.Where they had their first date.The best (men's) football team (according to Bec).The best (men's) football team (according to Tom).Who performed the song Bec walked down the aisle to.

BESA Wordsearch 2025-07-21

10 Items: Which exec is Part V ENGSCI?What is Dharshan’s spirit animal?Which club was the Friendship Beads event in collaboration with?What is the surname of the exec with first name starting with ‘Y’?What popular game did Day 1 of the BESA Exec Retreat kick off with?Kevin, BESA’s Treasurer, loves which K-pop girl group (starts with L)?...

trs23 ver3 u2 2023-02-16

10 Items: Ha ha ha.Jump into water.Don't do something.Water that goes far down.Some water you can swim in.An animal that swims and jumps.What you get when you hit water.A colour between white and black.Between two corners. A dice has six.The place where you can walk across a road.

Jobs 2026-01-29

10 Items: Who works at a bank?Who works at a cafe?They work at a theatre.Who works at a hospital?Who uses a lorry at work?Who works for an airline?Who works at a flower shop?Who works at a meat market?Who works at an animal clinic?Who makes the food at a restaurant?

Popular Kids' Series 2026-08-13

15 Items: Fancy NancyWho Was ..?Pete the CatWings of FireWhere's Waldo?Dog Man & Cat KidNarwhal and JellyElephant and PiggieDiary of a Wimpy KidThe Babysitters ClubWho Would Win? Animal Vs.If You Give a Mouse a CookieDon't Let the Pigeon Drive the BusI Survived the Great Molasses Flood (and others)How Do Dinosaurs Brush Their Teeth? (and others)

animales cual es el animal mas inteligente 2024-01-20

6 Items: catlionzebrahippoelephantMan's best friend

Amazing C 2026-02-11

15 Items: We sit on thisWe see the timeI's a sea animalWho lays the eggs?We drive with thisWe color with thisWho makes the milk?It is made of sugarRain falls from thisMouse's favorite foodRabbit's favorite foodIt's inside the schoolWe eat this on our birthdayWe wear this when it's coldWhat's the weather like in winter?

POSTIES 0325 BIG READ 2024-03-07

6 Items: very hota young catopposite of "strong"used a describe an animal that does not have a homea place where food and drink are served in a schoolto watch and check something carefully over a period of time

EMD Word Search Part 1 2025-12-02

6 Items: Pain Found on Card 1Type of Pain Found on Card 5Type of Attack Found on Card 3Type of Action Found on Card 4Type of Problem Found on Card 6Type of Reaction Found on Card 2

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...

Bats 2025-08-20

7 Items: Baby batsWhat bats like to eatA place where bats liveA name for bat droppingsSomething that bats do in the wintertimeHow bats find their way around in the darkWhen an animal is active at night and sleeps during the day

God Protects and Heals His People 2026-01-30

18 Items: catlionzebrahippoelephantMan's best friendTo make well againTo keep safe from harmAnimal God used to speakWhat God kept His peopleThe protector and healerMan hired to curse IsraelA snake sent into the campWhat God gave instead of a curseWhat happened when they obeyed GodGod’s loving concern for His peopleWhat the bronze serpent was placed on...

For you my sweet boy 2025-12-03

14 Items: What’s my nameWhen did we meetOpposite of grassI love ___ so muchYou ____ me obviouslyYour my favorite __________My favorite trip we’ve takenI hope you find this _______Let’s blow this ________ standI can’t wait to _____ you babyI put a lot of _______ into thisThe nickname I call you the mostDo you remember my favorite animal...

Word List 1 2025-12-05

7 Items: comfortable and warm: ______________comfortable and warm: ______________a type of person or thing: ______________to make or see a connection: ______________giving off steam due to being very hot: ______________the amount of time a person or animal has lived: ______________information that helps a person find, understand, or solve: ___________

Easter 2026-03-24

10 Items: what you put eggs inA cross with Jesus on it.The thing eggs are made of.the things rabbits do to moveanther word for painting eggsThe season easter is celebrated.The holiday celebrated in spring.jelly filled sweets you might finda flower that starts with the letter DThe animal most associated with easter.

Spelling list 2024-01-08

9 Items: A lung diseaseTo attempt somethingBelonging to a collegeSomething men use to smell goodA fancy sparkling alcoholic drinkA pocket of puss on animal or humanA voice in your head to tell you what to doWhen you are torn between 2 different thingsA way of pronouncing words in different countries

99 Nights In The Forest 2026-04-28

14 Items: Attacks Youthe G.O.A.Tpounces on youThe Strongest animalcreature in the cavesareas you can exploreCan use to do anythingSame as wolf but darkerMake animals yur friendsEntity form the snow biomecan kill and make them meatcan craft anything with logs and scrapSomething that attacks you in the forestcan use logs, fuel, oil barrels, coal to expand more

13 2025-08-16

14 Items: A planned group ride or eventFemale members united as familyStrong bond between club membersA group of riders traveling togetherFaithfulness and devotion to the clubanimals killed on the road by vehiclesA line of motorcycles riding in formationA large gathering of bikers and enthusiastsa sum paid for killing or capturing a person or animal...

East Asian Cultural Elements 2026-01-04

25 Items: A popular condiment in East Asian cuisine, including Chinese.A sacred animal in China, one of the four benevolent animals.China's national animal, recognized for its black-and-white-coloring.In China, it's not just used for illumination, but also symbolizes peace and good fortune....

Animals 2024-04-28

20 Items: MilkShellTrumpetSlitherRibbit...Feline friendFast boi lionUgly pink fishyMan's best friendKing of the jungleStriped black and whiteGoldilocks and the threeGray dog with sharp teethBaby _____ do do do do do doGigantic semi-aquatic creatureSlowest animal stereotypicallyGiant reptiles that went extinctThey have wide heads/eyes with no lids...

Level God Word search 2026-08-25

100 Items: dogcatruneatasksadbigoldhotnewbadbookbirdfoodgameparkcitywalkjumpplayreadlookhelpworkopenmakedrawsingtallfastslowweakuglykindloudeasycoldgoodtablechairhousewatermusicstorywritespeakwatchdrinksleepthinklearnteachclosestartbuilddancelaughsmilehappyangrytiredsmallshortyoungfunnybravequietcleandirtyschoolpencilfriendfamilygardenanimallistenfinishanswer...

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

1 2026-09-13

5 Items: The fastest land animal.It is the city flower of Jinan.A tall green plant. Pandas love eating it.One of the parts of a country, like Shandong.A big beautiful flower, it is China’s national flower.

kairi's bday! 2026-04-05

9 Items: kairi's favorite colorkairi's favorite animalkairi's favorite subjectwhat age is kairi turning?kairi's real BOYFRIEND and HUSBAND.the type of food that kairi ABOSULUTELY avoidswhat brand of shoes is kairi wearing right now?kairi's fave pjsk character of all the time (its a girl)the activity that kairi is passionate about but SUCKS at it

Ancient Professions and Trades. 2024-09-20

15 Items: Made candles and soap.Made barrels and casks.Repaired and made shoes.Made arrows for archery.Crafted objects from silver.Created maps for exploration.Specialized in shoeing horses.Built and repaired wooden wheels.Turned animal hides into leather.Operated mills for grinding grain.Sold mens clothing and accessories....

Guadeloupe et Martinique 2025-05-12

9 Items: firecrackeron se déguise avecbeaucoup de personnes/gensil y a des chars dans un....c'est la période après le mariageun animal qui se bat avec les serpentsportée par les hommes pour etre éléganton les utilise pour observer les oiseauxon peut voir les tortues marines en faisant la ___ sous-marine

The Grandma Dorothy Word search 2025-07-26

16 Items: Dorothy's middle nameDorothy's favorite bookDorothy's father's nameDorothy's sister's nameDorothy's mother's nameDorothy's maiden last nameDorothy's first son's nameDorothy's third son's nameDorothy's second son's nameName of church Dorothy attendsNumber of grandchildren Dorothy hasName of the school Dorothy taught at...

02.14.2026 2026-02-02

16 Items: where we metour first datethe year we metlab hannah work atour favorite animalethnicity of hannahewan's football teamewan's favorite colorbest thing in van nuyshannah's favorite colorhannah's favorite holidayhannah's favorite sandwich placehannah's favorite protein sourcepunk band we saw the first time we went together...

Abel Word Search 2025-08-16

101 Items: OXAWEDAYGODNEWSIXABELBENTCITYDAYSEVILFEARFIREFOODHOLYLORDLUKERIDERISEYOKEZIONAMONGBLOODBONESBOUNDCROWDCUREDGLOOMDEATHEARTHOFFERGLOOMGUIDEJACOBJESUSJUDGELIGHTMOSESMOUNTNEEDSORDERRUINSSATANSHAMESTOODUNTIEWOMANYEARSANGELSANIMALBREACHDONKEYENDUREENTIREESCAPEFESTALFINGERGARDENHUNGRYISAIAHLEADERLIVINGMANGERPHRASEPLACESREJECTREMAINABRAHAMAFFAIRSAILMENT...

Christmas 2025-11-15

100 Items: ARTARMANTCARCUPDOGEGGEYEFANFOXHATICEINKJARKEYBIRDBOATBALLBOOKCOOKCAVEDOLLDOORDESKDEERDUCKFISHFROGFIREGATEGIFTGOATGAMEHANDHILLIRONIDEAJUMPKITEKINGKNEELAMPLEAFLAKELIONLINELOCKLOVEAPPLEACTORANGELAWARDBRAINCLOUDCHAIRCANDYDREAMDRESSEARTHEAGLEFRUITFENCEGLASSGLOVEGRASSHOUSEHORSEJUICEJEWELLIGHTLEMONANIMALAUTUMNBOTTLEBANANABASKETBUTTONBRIDGECANDLECIRCLE...

P1-Giant Halloween Word Search-Answersheet 2026-06-09

100 Items: BatBugCatHatOwlRatWebWigCropCrowDeadFallGownMaskWormAcornAlienAppleBloodBonesBrainBroomCandyCloakCryptEerieFairyFemurGhostGhoulGourdHouseMummyNightPartyPrankQueenScareScarySkullSlimySnakeSpellTreatTrickWitchYummyAnimalAutumnCackleCandleCoffinCorpseCreepyGoblinLeavesOrangePotionPrinceSafetySpiderSpiritSquashTurkeyWickedCostumeDraculaGhastlyHarvest...

Psychology Chapter 2 Word Search (50 terms) 2026-06-12

50 Items: FactSampleSurveyTheoryDebriefOpinionValidityAttritionCasestudyDeceptionEmpiricalReplicateGeneralizeHypothesisPopulationCorrelationFalsifiableReliabilityControlgroupObserverbiasParticipantsRandom (Sample)ArchivalresearchConfirmationbiasDoubleblindstudyExperimenterbiasPlacebo (effect)DependentvariableExperimentalgroupDeductivereasoning...

Tangerine Vocab Set 1 Word Search 2023-01-24

10 Items: steadilyopposite of beliefsynonym for restlesswork jointly toward the same enda word to describe a wild animalyou usually do this before sportssounds like a government/political wordmake full use of and derive benefit fromWhen the old lady crossed the street, I stopped _____go or move back or further away from a previous position

Aquariumofthepacific Word Search 2026-01-21

10 Items: your go-to restaurantbest duo game we playyour "pet name" for meyour favorite boba shopwhere we had our first datethree letter word you always sayfav protein you always cook for mesomething i will always say to youthe first city we traveled to togetherthe first animal we want to get after moving out

Thoseeyes Word Search 2025-07-01

9 Items: Nuestro colorNuestra canciónNuestra tarta favoritaEl apodo que más te digoLa primera comida que me hicisteNuestro animal preferido para imitarUna de las cosas que más me gusta de tu caritaLo que necesito leer o escuchar antes de dormirmeLo que más me gustaba que hicieses todas las mañanas del insituto

How Can We Tell If An Animal Is Happy Without A Wagging Tail? 2023-03-19

17 Items: tailkickwatchhappytwitchpouncetreatsfriendwaggingrabbitsferretspurringplayfulrelaxedsteeringenergeticguineapigs

Animals and the environment 2022-12-30

8 Items: continue to livecatch and difficult to finduncommon and difficult to finda set of similar animals or plantsa living thing that is not a plantthe natural surroundings where we liveanimals or plants which could disappear without out helpthe place where animal or plant naturally lives or grows

platypus 2025-09-26

8 Items: Not like othersbabies hatch out of theseSomething that is not trueConnected by a layer of skinA word meaning toxic or poisonousThe country that platypus lives inSomething that breathes air, has hair, and nurses it's youngAnimal with webbed feet , brown fur, wide, flat tail, and a bill

1 2022-02-20

96 Items: ofohoractagoandbadbagbedbutbuyendgasherhitlaylownornotoiloneouroutredtenthewayyetableareaawaybabybackballbankbasebeatbestbillcallfallgameheadlongmostonceaboutaboveadmitadultafteragainagentagreeaheadalonealongamongapplyargueavoidboardleastmediaotheracceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattack...