4th of july Word Searches

Different Breeds of Cats 2021-08-11

18 Items: sphynxbengalbirmanangorapersiansiameseragdollbobtailmunchkinsavannahmainecoonhimalayanshorthairnorwegianabyssinianrussianblueegyptianmauscottishfold

Die of Doom 2022 2022-12-29

18 Items: ragemikeytraxxlemontomboythestuffdeadbangunclesamstonecoldmiragemanwhitefiredesecrationbigmanjapannewyorkninjasittingtargetbreathingfirebloodybirthdaypinocchiosrevenge

Stars of Chek Jawa 2023-05-02

18 Items: spinysecretmarinescalesadmireunusualstomachswallowabilitywetlandsbotanistprotectedbackbonesdifferentundersidediscoveredcollectioninteresting

Artists of Furry-Paws 2023-08-09

18 Items: fezdyrfoxnovasnowvolkidessaxscabootskiteimirtarontoestukolilithaislynnmelysahsimplingin a Jarr

Your list of wishes 2023-12-06

18 Items: joyhopefoodlovepeacesleepsmilebooksfamilyhealthwellnessserenityvitalityhappinesschocolatewillpowerfriendshiprelaxation

Washing of the feet 2024-02-14

18 Items: lovewashlordbeltheadfeethandspetertowelwatergarmentserviceexampleservantteacherhumilitypassoverdisciples

The wizard of oz 2024-05-10

18 Items: cityhometotoglindatinmanwizardkansastwisterrainbowscarecrowmunchkinsdorothygalefrancesgummjudygarlandwickedwitchcowardlylionrubyslippersprofessormarvel

William's Control of England 2024-09-08

18 Items: SaltYorkLatinLondonFrenchAbbeysCastlesStoneKeepRebellionsCathedralsMurdrumFineOathOfSarumChristianityChristmasDayDomesdayBookFeudalSystemMotteAndBaileyHarryingOfTheNorth

Percentage 2023-07-25

6 Items: entiregoods and services tax.a deduction from the usual cost of something.can refer to the monetary charge for borrowing money.relating to a system of numbers that is smaller than 1.a small or tiny part, amount, or proportion of something

Competency Worksheet 2 2022-12-21

8 Items: Another way of saying Incompetent to Proceed.When you are charged with a crime, you are then referred to as the Defendant.A finding or answer of a jury given to the court concerning a matter submitted to their judgment.This means advocating on one's own behalf before a court rather than being represented by a lawyer....

Alora's Epic Word Search for *sigh* Math 2023-04-03

11 Items: One item for anotherThe salary of workersA moral principle based on rightsThose who purchase from businessesWord of which is guessable good luckThose who attempt to create a businessThe essence of cheese on a crunchy baseWhat business owners want to increase wealthAll workers in a particular field or industry...

BTS Vocabulary Finder 2023-11-20

11 Items: The opposite of failureA word for famous peopleAnother word for very bigAnother word for greatestThe people who love celebritiesBig Hit Entertainment ______ BTSA person who is part of a group is a __________Another word for a musician or musical performerTraveling around from city to city performing concerts...

Health 12th 2023-08-17

9 Items: I feel ______ at that gym.Fever is a sign of an ___________.He had a stomach _____ after eating.I eat ________ to keep mentality sharp.Fruits and nuts can protect your ________.______ products are an essential part of my diet.The ______ next to my home has gluten-free products.More than half of the word population ———- heart disease....

Promocija putem interneta  2019-01-15

35 Items: ofwebwomputemzakupmrežeworldmouthriječibannersvijetkradjaključnemnoštvojeftinoobuhvaćastraniceprednostpodatakamjerenjapromocijainternetadruštvenesigurnostvirtualninedostacipovezanostdostupnostidentitetainformacijaoglašavanjezloupotrebanemogućnostučinkovitostučinkovitosti

EOW 3 Unit 3 & 4 Vocabulary 2022-12-08

35 Items: ofhughelpfeedcarryteachneverfollowalwaysnexttobehindmuseumbakeryprotectusuallybetweenstadiumcomehometurnlefttoystoremakemybedsometimesinfrontofturnrighttakecareofhaveasnackdohomeworkacrossfromgostraightrestauranttakeashowersupermarketmovietheatermovietheatertrainstation

Go Word Search 2023-02-05

35 Items: iagosoofmemyweupisforandbuthownowseewhothearefindwilllikecomethismanywithwhatheresooncameintofromtheyyourwhere

JAG Vocabulary 61-90 Kelis Evans 2023-03-22

30 Items: dataearncraftcreedcreditdockeddutiesdemoteddisabledeligibleemployeeemployercriticismdresscodeco-workersdentalplandependentsdisabilitydischargeddoubletimedeathbenefittaxdeductionsdeleware,1978discriminationdisplacedworkerdoctoratedegreeeducationalhistoryemployeeratingsheetcost-of-living-adjustmentdictionaryofoccupationaltitles

Leaders 2023-06-05

25 Items: layelderSTARSLEADERbishopushersmembersMEMBERStrusteesOF ALLENstewardsOFFICERSDIRECTORDIRECTORSsecretarymusiciansPRESIDENTpresidentdirectorssupervisorstewardesstechniciansWMS PRESIDENTWMS PRESIDENTsuperintendent

Fraser's wordsearch about a book or books 2023-08-23

36 Items: ta13ofoftuicatkidandytreefirejillbirdalexanhdoterrystoryhousebarkywingskevinstevediarywimpyhotdogdentonlizardlizziebignosewarriorvilligergriffithschamilionminecraftsutherlandthebarkingdog

Election 2024-06-12

23 Items: DayoathchiefTapesBoardBallotVotingCenterprimaryScannercanvasstrainingElectionprecinctcurbsidepollbookRegistrarenvelopesof ConductsignaturesVoter NoticeNight ResultsDay Registration

Election 2024-06-12

23 Items: DayoathchiefTapesBoardBallotVotingCenterprimaryScannercanvasstrainingElectionprecinctcurbsidepollbookRegistrarenvelopesof ConductsignaturesVoter NoticeNight ResultsDay Registration

Word Search 2024-09-18

21 Items: DatatimeRiskHelpabuseAlarmReportReportNetworkHackingMalwarecontentConsentInternetgo thereVigilanceAttentionReportingSelf-regulationDelete, Unfollowuse of technology

game time baby (Q&Jess edition) 2023-11-14

23 Items: Bi-iconHow we metYurt + HomeHeat + waterJess is allergicthis is Q (fire)Best protein everJess's birthstonethis is Jess (water)For the love of ____Camping with friendsYou feel at home hereOur first show togetherFlavor you're obsessed withThought we'd run out of gasOur first time getting drunkOur favorite food spot in LAWe love a good day trip here...

Election of 1844 2014-04-08

12 Items: mandatedarkhorsejohntylerhenryclayjameskpolkannexationjohncalhounmartinvanburenmanifestdestinyjointresolutionwestwardexpansionpresidentialelection

Ring of Fire 2020-03-13

12 Items: waveswaterenergytsunamisvolcanoesringoffirefaultlinesearthquakesindianoceandisplacementpacificoceantectonicplates

Food of Karnataka 2021-03-02

12 Items: DosaRasamMasalaSannasPatrodeNeerDosaKoriRottiMysurePakChitrannaRagiMuddeCoolKadavaBiseBeleBath

Armor of God 2022-02-20

12 Items: BeltShoesTruthFaithSwordPeaceHelmetShieldSpiritSalvationBreastplateRighteousness

Shades of Meaning 2023-02-14

12 Items: enragedfuriousshockedstartledeuphoricjubilantdelightedmortifiedchagrinedhumiliatedastonishedexasperated

PARTS OF MOSQUE 2023-08-10

12 Items: domequranmosquemihrabminbarminaretprayerhallprayerrugsnameofallahablutionareaislamicartworkprophetmuhammad

Parts of flower 2023-11-12

12 Items: ovarystyleovulecarpelstigmastamenantherpetalssepalsfilamentpollentubereceptacle

Battle of Brooklyn 2024-01-09

12 Items: warhowebravebattletroopsbritishfreedomsoldiersbrooklynamericanswashingtonindependence

Disciples of Jesus 2024-08-14

12 Items: JohnJamesAndrewPhilipThomasMatthewSimonPeterBartholomewJudasIscariotSimonTheZealotJudasTheSonOfJamesJamesTheSonOfAlphaeus

Uses Of Water 2024-08-25

12 Items: cookrainfishwashswimWatercleanbrushplantshydrateirrigatehydropower

unit 4 2024-10-23

11 Items: of giving it back after a period of timeto give money as a payment for somethingto get or receive something from someone with theto receive money as payment for work that you doto give something to someone else in return for moneyto amount of money needed to buy, do, or make something...

look inside a box of 2024-02-28

4 Items: oflookboxesinside

Manage Personal Stress in the Workplace 2023-10-29

6 Items: sign of stress beginning with the letter "I"source of stress beginning with the letter "W"when setting goals, ensure they are this "S" acronyman area of stress within personal control beginning with the letter "S"one of the ways to understand your job role priorities is to know your_ _...

Posties - 0122 - Big Read 2024-01-05

6 Items: to hit something gentlyanother word for "problem"to do something more than oncethe part of a person's face below their mouththe inside part of your hand from your wrist to the base of your fingersa treatment for pain or illness in which thin needles are positioned just under the surface of the skin at special points around the body

Felix's favorite foods 2024-04-23

15 Items: NoodlesLeading brand of sodaCheese and Tomato ScauceFood served between ricecommonly served with waterA lemon flavored refreshmentsecond leading brand of sodaCommonly found in the form of toastcommonly found drink, served with icea bird that is used for food, deep friedDrink with bubbles served at a ---- fountain...

ENERGY FLOW WORD SEARCH 2023-02-01

10 Items: A way of measuring energy in a particular level; B_____S.The movement of energy through the food chain; E____Y F__W.A diet in which are lacking all the meat products; V________N.A heterotrophic organism that eats producers, or autotrophs; H_______E.To eat something, or to take something into the body for nutrients; C_____E....

Mutual Word Search 2022-08-21

4 Items: ofomahamutualkingdom

Type of Reptiles 2020-05-16

12 Items: frognewttoadgeckosnakelizardturtledinosaurAlligatorchameleoncrocodilesalamander

List of Pets 2020-05-16

12 Items: CatDogfishMousePuppyKittenParrotRabbitTurtleHamsterGoldfishTropical

Story of Abraham 2022-12-04

12 Items: lotharansarahsaraiabramisaacsodomcaananmoriahabrahamlaughtergommorrah

Rainbow Of Fun 2023-09-28

12 Items: sunredbluealsiawatergreenorangeyellowpurpleimthreejanuaryrainbow

States of Matter 2024-01-07

12 Items: gasionsheatsolidauroraliquidplasmapositivenegativesolarwindtemperaturenikolatesla

Routes of administration 2024-02-23

12 Items: oralrectalenteralgastricparenteralinhalationintravenoustransdermalintraosseussubcutaneousintramuscularintraperitoneal

Types of Hobbies 2024-06-24

12 Items: sportsewingdancingcookingwritingcyclingfishingpaintingswimminggardeninginstrumentphotography

IMPLICATIONS OF WORKPLACE STRESS 2016-04-19

18 Items: TOOLLOYALRELAXSTRESSDESIGNHEALTHOVERLOADOVERPAIDTRAININGSTESSORSUNDERPAIDOVERWEIGHTMANAGEMENTEMPLPOYEESPERFORMANCEENVIRONMENTHYPERTENSIONCOMMUNICATIONS

PATIENT'S BILL OF RIGHTS 2021-10-20

19 Items: lawactdatarightshumanesafetypolicypatientprivacyconsentdignityprivacyautonomyinformedobligationcybercrimeinformationcommunicationconfidentiality

Adjectives of Describing People 2022-11-30

18 Items: bigfatlazythinslimtidynicesmartsmallsweetmessywhitefamouslookingdiligentfriendlybeautifulinnoncent

World of Work Wordfind 2023-10-25

18 Items: jobtaxworkbudgetincomechoicesleisuresavingsemployerexpensesholidaystrainingeducationapprenticeexperienceoccupationopportunitiesqualification

The Elements of Music 2024-01-16

18 Items: beattempopitchbrasstimbrerhythmmelodytexturesilenceharmonystringsdynamicssonoritydurationelementswoodwindspercussioninstruments

Top Weapons of Valorant 2024-08-09

18 Items: aresodinghostbuckyjudgevandalshortyfrenzymarshalphantomclassicsheriffstingerspectrebulldogoperatorguardiantacticalknife

The Dangers of Alcohol 2024-09-27

18 Items: BACDWIWineBeerBingeDrunkBloodLiquorAlcoholPassoutSobrietyImpairedJudgementPoisoningAccidentsAddictionToleranceDepressant

Prophets of The Book of Mormon 2024-07-03

10 Items: enosomnialmanephijacobjarommosiahmormonmoronihelaman

Democracy vs. Republic 2023-09-19

5 Items: power of a group by the majority of its membersthe ability to do something or act in a particular waypower is held by the people and their elected representativea body of fundamental ideas according to the country or organization is to be governeda form of indication of a choice between two or more candidates; expressed typically through a ballot

united 2023-03-07

20 Items: bondsloansturkeyfinancelandscapeinvestmentThe sunshine statecity in central floridathe sixth planet from the sunthe third planet from the sunthe eighth planet from the sunthe seventh planet from the sunThe furthest planet from the sunthe 7th largest country in the worldThe largest planet in the solar systemthe hottest planet in the solar system...

Fences Word Search 2023-05-22

40 Items: johnmary1weekfencesplantsfencesjospehflowersbaseballheisretiringplaybaseball1dayand1nightPeter’s Gatescryoutfortroyhefellofacliffnineteenforties2daysand2nightstendtothegardennineteenthirtiesheisdivorcinghernineteenseventiesheisdyingofcancerhewasinacaraccidenthewantedgabe'smoneyTroywerebeingharassedhecouldn'tpaygabe'sbailthecompanylessenedtheirpay...

Vocab Words 2024-01-31

5 Items: say or pronounce clearly.Providing useful or interesting information.the process of infecting or the state of being infected.a musical orvocal sound with reference toits pitch, quality, and strength.a movement of part of the body, especially a hand or the head, to express an idea or meaning.

Education 2024-02-04

7 Items: Cultural deprivation is which type of factor?The 1944 Educational Act brought in which system?Which code did Bernstein say that m/c pupils use?What is the term for sorting pupils according to their ability?Who identified and discussed three types of capital pupils posses?...

Dustbowl Word Search 2023-05-25

15 Items: storma dust stormdust was everywherethe corps were dyingwhat type of soil is thiswhat was happing in Oklahomado you know what the dustbowl iswhen the soil dries up in an areathe soil in the ground was dried upwhat do you think caused climate changedo you know the meaning of soil erosionone of the places the Dustbowl happened...

6th grade review. Maisie 2024-05-15

15 Items: made of ice crystalswhen a star explodesthe middle of the sunknown for its big ringsmost distant major planethas the hottest atmosphereknown as the 'classic' cloudonly known planet with living thingsthe top of the earth (we live on it)the largest planet in our solar systemsmallest and closest planet to the sun...

N 2024-10-21

10 Items: harpa Triangular musical instrument, with strings placed vertically and played with both hands.guitar A stringed musical instrument consisting of a figure-eight-shaped sound box, a long fretted necksaxophone a musical instrument of the woodwind class consisting of a usually curved metal tube with finger keys and a reed mouthpiece...

2020 Bible Bee Trust--Junior Edition Word Search 2020-06-24

37 Items: ofsunGodLuismoonlinecoatTrustJacobstarsJudahTamarJesusbakerJesuslovedJosephGladysGeorgedreamsRuebenGileadCanaanGenesisforgiveDarleneLilliantraderssheavesPharaohbrothersPotipharAdoniramBenjaminfavoriteredeemedcupbearer

Bailey & Steffan 2023-07-08

33 Items: joylucyloveringcakesuitpartydancemylesaarondressbridegroomfeastbaileyphotostoastsmorganjordanfamilysteffanweddingmarriedbestmanparentsmadisonfriendsceremonyshaelynngroomsmencelebratebridesmaidsmaid-of-honour

Watchtower 9-15 2023-10-10

36 Items: ofmanwardenfromverytreekinglearnyoungloveddreamimagelionsobeyedangelsdanielsexamplesomeonecaptorsjehovahcourageimmenseprophetloyaltypreciousboldnessprisonergiganticpowerfulimpressedconfidentcourageousbabyloniansunbreakablenebuchadnezzar

Places 2024-10-18

30 Items: pewbusfarmCreekMercyRiverHeartLeonsMikesNeenahDurfeeCottageWaupacaMontanaBavariaGermanyIrelandMenashaOshkoshof LakesColoradoVirginiaSouthsideMinnesotaNewLondonCaliforniaChanticleerSturgeonBayClintonvilleKimberlyClark

words of the month 2016-04-08

18 Items: IdealLegalpropeladjunctjusticeCurrentpedophilecadavericposteriorRecurrentclienthoodrespiratorspectrogramhemispherespediatricianpolycythemiamononucleosiscycledialysis

start of the revolution 2016-10-07

18 Items: teasugartoriesbostonhessianpatriotconcordloyalistcongressmercenarylexingtonjohnadamscommonsensethomaspaineolivebranchsamueladamssonsoflibertymassachusetts

Sports of the World 2017-01-19

18 Items: 1icegolfrugbyhorseSoccertennisboxinghockeyracingcricketFormulabaseballfootballathleticsbadmintonbasketballvolleyball

Deb's Words of Wisdom 2017-06-06

18 Items: whyhowleadmorewithlesstoolscoachimpactmanagechangeobserveinspectpositivesolutionscommunicatepartnershipexpectations

Week of 9/9  2019-09-13

18 Items: isweitcutandthenowfullweekovermadepastefirstrhymescollagewritingpracticemeerkats

class of the titans 2020-09-13

18 Items: jayneilodiezeusheraharryjasonarchiecronushermesatlantaartemistheresatheseusherculesachillesodessyesnarcissess

Beings of the sea 2020-08-20

18 Items: patoaguasandkelpcrabislaPlayapalmaperlasharkturtleconchaseastarsunshinestarfishcrustaceancephalopodgreenthings

The Wizard of Oz 2020-09-29

18 Items: TotoHeartBrainKansasGlindaTinManAuntEmDorothyCourageTornadoScarecrowMunchkinsEmeraldCityCowardlyLionTheWizardOfOzYellowBrickRoadRubyRedSlippersTheWickedWitchofthewest

A Taste of Murder 2021-05-02

18 Items: illweakgreyringapronshakethiefblondemirrorvillagecorridorsuitcasejewelboxwonderfulmysterioushousekeeperfrighteninghypochondriac

The Gift of Giving 2024-02-06

18 Items: areforwhogivethemeachfindkindnextwantfeelneedtherethinkhappywritefamilytogether

Mary, Queen of Scots 2024-03-31

18 Items: popefrancejamesvidarnleyscotlandcatholicbothwellexecutionlochlevenprotestantmarystuartelizabethiabdicationparliamentreformationspanisharmadaelizabethanerachurchofscotland

Tribute of the Month 2024-08-26

18 Items: CashRentPhoneHeelsSlimePearlsPantiesJewelryShoppingSneakersLingerieSkincareManicurePedicureGymshortsDatenightDenimjeansBreakfastsandwich

Making Of the national movement 2024-03-25

13 Items: Ambabai organised thisanother word for non violencethis movement took place on August 1942in 1905 ------------------ partitioned Bengalthis act prescibed provincial autonomy for Indiathe Natal congress was established in ------------a three member mission sent by the British to DelhiGandhiji gave a call for satyagraha against this act...

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

8th grade Andrew Henry 2024-05-17

15 Items: To increase speeda positively chargedneutrally charged atomThe weight of an objecta negatively charged atom.An element with a symbol of HWhen an object turns 360 degrees.a compound that can be seperated.A compound that isn't seperatable.: Charged particles that create energy.A compound made from hydrogen and oxygen...

Bailey & Steffan 2023-07-08

33 Items: joylucyloveringcakesuitpartydancemylesaarondressbridegroomfeastbaileyphotostoastsmorganjordanfamilysteffanweddingmarriedbestmanparentsmadisonfriendsceremonyshaelynngroomsmenof Honourcelebratebridesmaids

Summer 2013-04-30

73 Items: FUNFOODGOLFHEATJULYLAKEPOOLMELTWARMBEACHBUNNYGRASSHONEYCRUISEHIKINGPICNICSPORTSTENNISTRAVELBREEZECLOVERGARDENAIRPORTBOATINGCAMPINGCOOKOUTDRESSESHOLIDAYLEISUREDOGPARKPARTIESPLAYFULSAILINGSURFINGTOURISMWEATHERALFRESCODRINKINGEXERCISELAUGHTERMEMORIESOUTDOORSPOPSICLESLUSHIESSUNSHINESWIMMINGVACATIONBASEBALLADVENTUREFESTIVALSFIREFLIESFIREWORKSITINERARY...

Major Dental 2023-06-06

14 Items: the fake tooth used in a bridgewhen a tooth is removed by a dentistused to determine eligibility and coveragecovers damaged tooth for structural supportrecommended for any service of $500 or morerequired to determine eligibility for crownsscrews into the jaw bone to replace a missing toothcovers front of tooth only providing structural support...

What is a mineral? 2024-04-28

9 Items: A paste-like material made from minerals, used for coating walls and ceilings.makeup: The specific combination of elements and compounds that constitute a mineral.A powdery substance made from minerals, used in construction to bind materials together.A mineral used in ceramics, known for its distinct chemical composition and crystal structure....

The 4th Grade Times Birthday Word Search 2022-12-19

10 Items: tencaketoyssnowpartygamesmusictommyandpaulhappybirthdaythe4thgradetimes

Week 2 2022-10-04

10 Items: a list of numbers in specified orderthe value in a sequence given its positionthe algebraic expression given to find any term in a patternthe position of a term in a sequence such as first, second, etc.numbers that follow each other in a regular counting order or patternthe difference between two consecutive terms of an arithmetic sequence...

Payments 2023-10-25

17 Items: This means the check has been stopped by us.What type of payment can we make the same day?What carrier do we use for any expedited payments?We can take a verbal on what type of hazard policy?What website can a caller upload a policy document to?What type of payment will arrive in 3-5 business days?...

Casey at the Bat Vocabulary 2023-04-21

10 Items: someone's facial appearance __________to remove an item of clothing __________proud and arrogant like a snob __________having a sinister or ghastly character __________something impressive in the way it looks __________a gloomy state of mind or extreme sadness __________comes before something in time or position __________...

Omit Word Search 2023-12-09

10 Items: Cautious and watchfulTo leave out or excludeFull of energy and enthusiasmCalm, peaceful, and untroubledFully in agreement or of one mindAttractively unusual or old-fashionedTo move back or away from a point or limitHaving or showing zeal; fervent or enthusiasticTending to keep a firm hold of something; clinging or adhering firmly...

Omit Word Search 2023-12-09

10 Items: Cautious and watchfulTo leave out or excludeFull of energy and enthusiasmCalm, peaceful, and untroubledFully in agreement or of one mindAttractively unusual or old-fashionedTo move back or away from a point or limitHaving or showing zeal; fervent or enthusiasticTending to keep a firm hold of something; clinging or adhering firmly...

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

END 2024-10-01

5 Items: OFTHEENDTHEPUZZLE

Ian 2024-06-21

13 Items: jumpFloydthreesoccerMartinappleswalsallCollegeof Yorkforty-twoand tonicBromwich Albion FCUniversity Professor

CannaChallenges 2023-11-27

6 Items: Type of nursing care for individuals using medical marijuanaExamples of these include drowsiness, restlessness, and changes in blood pressureA word to describe a nurse's role in helping patient's suffering from chronic painPrescribing Marijuana for chronic pain will potentially reduce the number of prescriptions of this medicine...

Columbus Word Search 2022-09-16

30 Items: Yorkgoldasiaspainglorycabotworldclaimpanamacanadaspicesfrancebalboahudsoncartierenglandde LeonbahamasfloridacolumbusconflictLawrenceexplorerof youthreligionAmericanseuropeansadaptationnetherlandscooperation

New Jersey 2023-03-30

25 Items: MayWarCityBellHillwawaShoreStateedisonbagelstrentonbeachesBarrenscannoliturnpikeSopranospizzeriaboardwalkprincetonof LibertymeadowlandsJersey DevilfuhgeddabouditWashington BridgeBoss Bruce Springsteen

s 2024-03-31

30 Items: MANvielsuitalexlovekissGIRLbertvowsdressbridegroomjaydenbutlerBEARERmarleelachiecheersfamilyCAMPANAweddinggeorgiafriendsscarlettseptemberhoneymoonOF HONOURchampagnearmstrongbridesmaid

ww4 u10 2024-06-07

14 Items: What _______ you?The knight ______ the dragon.What is the _________ of the lake?What are the ________ you are experiencing today?The dog _______ from the sound of the vacuum cleaner.It is kind to __________ your friend if they are sad.It is important to ______________ well in a friendship.The king decided to _________ the thief from the Kingdom....