4th of july Word Searches

NMSI World Environment Day 2024 2024-06-04

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

Aretha Franklin 2024-07-19

15 Items: vozsouldivaéxitoWomanmúsicagospelgrammyof SouldetroitrespectbaladasFranklincantanter-e-s-p-e-c-t

Soul Surfer Word Search 2023-04-11

20 Items: Someone who guides and advises.jewelry that Bethany likes to wear.What Bethany suffered after the attack.Bethany's youth group leader and friend.the name of Bethany's best friend.something that is ongoing and never stops.Treating others with dignity and admiration.Bethany's favorite activity that she excels at....

Week 17 Thursday 2024-02-04

25 Items: PersonTo excludeA group of alliesIn a joyous mannnerAn arm, leg or wingCareful or cautiousOpposite of backwardTo show or point outSharp-edged utensilsThe right to use powerAble to do many things wellWanting what someone else hasCompeting for a better positionThe first person to create somethingTo rub fat on a surface while cooking...

Michelle and Dominic 2024-09-30

36 Items: Who is olderBride’s eye colorGroom’s eye colorWho is the best manBride’s birth monthGroom’s birth monthGroom’s middle nameBride’s middle nameGroom’s favorite foodBride’s favorite foodBride’s favorite movieGroom’s favorite movieBride’s favorite actorBride's favorite colorGroom’s favorite colorGroom’s drink of choiceBride’s drink of choice...

Duo 47 2024-03-05

47 Items: credit(το) the dollar(η) the credit card(το) the social media(το) the profit, gain(τα) the social media(η) the saving, thrift,(το) the friend request(το) the social network(το) the request, demand(το) the money, capital,(η) the payment, defrayment(ο) the (economics) inflationto be increased, raised, put up(το) the coin, physical currency...

Before Thy Coffee Gets Cold. 2024-04-26

12 Items: For something to stick outForming small waves on a surfaceIn a very friendly or pleasant wayTo be not able to be easily seen or noticedIn a polite, respectful, or considerate wayTo surrender/give up or get rid of somethingA large quantity of smoke that rises from a smoking deviceThe reason that something happened but that reason is a lie...

Movies and tv shows 2023-12-11

13 Items: psychchuckjessielion-kinghome-alonebrooklyn99french-kissoceans-eightwhite-collaroceans-elevenhanna-montanabody-of-proofmadam-secretary

Look at the clues and find the word (in brackets). Shadows in the snow: Part 1. 2022-05-28

25 Items: (tore)shredded(legend) myth, saga(domestic) not wild, tame(savage) ferocious, fierce(kinship)blood relationship(roam) wander, rove, ramble(biological) organic, living(breed) reproduce, procreate(deserve) merit, earn, warrant(shiver) tremble, quiver, shake(spine) backbone, spinal column(claim) assert, proclaim, profess...

Our Pets 2024-07-09

8 Items: eats bugssits prettydainty lil thangorange and sturdyloves blueberriesloves gatorade bottlesruler of the countertopsone of these is not like the other

Vocabulary Lesson 7 2022-11-08

11 Items: The coasts are _____ with fish.I _____ mushrooms and can't stand them!His/her rights must not be _____d upon.If you chew gum in Singapore, it is an _____.After robbing a bank, the criminal _____ed to Canada.It's common to have a long set of data before _____ing a trend.The _____ texture of sandpaper smoothes the surface of the wood....

Ch. 23 Medical Terminology 2024-05-03

5 Items: Movement that turns the palm upMovement that turns the palm downBending of the foot or the toes upwardThe circular movement at the far end of a limbMovement of a limb toward the midline of the body

Decolonizing SE 2022-09-19

13 Items: The type of beads wornThe so call BLANK problemHow each child was identifiedThe sort of talents shown offHow they thanked God each morningWhere Richard Thomas left his noteThe purpose of residential schoolsHow the atmosphere of the school was describedThis was complicit in manufacturing public support...

Dia de los Muertos 2024-05-02

8 Items: aztecmexicospiritfestivalskeletonindigenousof the Deadde los Muertos

nitzys word serch 2024-05-16

15 Items: hottest planeta very big starthe biggest planetthe planet we live onsmall dots in the skyoutermost layer of earthsixth planet from the sunfourt planet from the sunsecond plane from the sunlayer between the lithosphere and corelayer of the core closest to the mantlethe only other planet people have been onthe continet that fits with south america...

Kingdom Living 1 2014-02-24

23 Items: LordMoralLocalMaybeSocialPresentKingdomNationalCovenantCelestialSpiritualUniversalPrincipleMillennialEternal-SonNot-ExactlySupernaturalAlways-ExitsEcclesiasticalEschatologicalAlways-ExistingUnconditional-RuleRule-of-god-directly

PROSE WORD SEARCH 2019-11-19

32 Items: OFFLATPLOTVIEWROUNDESSAYLOCALCOLORTHEMENOVELPOINTPROSESHORTSTORYSTYLECOMEDYSYMBOLSUBPLOTROMANCESCIENCEFICTIONSETTINGALLEGORYFOLKTALESUSPENSEDYSTOPIACHARACTERCHARACTERNARRATIVECHARACTERSANTAGONISTPROTAGONIST

Dietetics, Unit 2, Tasks 1B and 1C 2020-11-04

31 Items: inofaidevisitstaffaccesschargesafetymanageprisonelderlypresentaddresshealthyspecialqualitycanteeninstructwellnessdisableddeliverycooperateintroducecafeteriaworkplaceindividualcoordinatemaintenancesupervisingimplementingrequirements

Clauses 2023-11-15

31 Items: oftoyouverbrunonclausesimplephrasesubjectcomplexhelpingingruleprocessb4rulesa2rulesa4rulescompoundsentencefragmentcompleteinvisibledependentdirtywordimperativeincompletedeclarativeconjunctionindependentsubordinateinterrogativecompoundcomplex

list 8 2024-01-28

32 Items: ofdoshyshethisthatthenwithspotcrabtwigdripshadesheepbrushfreshspeakspellcrackcrashcrosstwinstwistsplatspraybrushbrokecleansplashsprinthendrickhanewich

Lesson 6 2024-07-17

32 Items: ofnocanmapgetyessitpenthistakesureheresomehavetouchsorrytouchflashrulerjuicebroomcoursepleaseborroweraserpencilbrokenpicturecookiesproblemrestroombeautiful

WATERFALL 2024-08-13

25 Items: AngelRhineIguazuStairsHavasuNiagaraShannonRussellToketeeVictoriaYosemitePlitviceGullfossKaieteurMultnomahDettifossof FoyersMurchisonBeauchampSutherlandBridalveilKintai-kyoSvartifossGioc-DetianTaughannock

NHLPA 2024-03-11

7 Items: What does the NHLPA help createWhat does the NHLPA support the mostHow many NHL lockouts have there beenWhat is the first name of the NHLPA founderWho looked to restore the NHLPAs reputationHow many directors of the NHLPA will there be as of 2024What is one of the main problems the NHLPA has to help fix

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

Ava's Word Search 2024-05-17

14 Items: We grew themStraighten your armplace of living thingsWho spilled the _____?Spongy part of the bonepart of the ocean floorWhat plants need to liveMuscle that bends you armHelp you jump, walk, and runSomething red that flows in your bodyMove your arms in different directionsProtects your organs and help you balance...

Weathering Word Search 2024-09-25

5 Items: It is the topmost layer of soilIt is made of sand, slit, and clayIs a natural process of rocks on earth being broken downIs the layer made up of large rocks that have not been broken downIt is made up of rocks that have been broken down into smaller pieces

Ch. 16 Medical Terminology 2024-02-16

5 Items: fear of heightsfluid in the brainuncontrollable sleep attacksfear of enclosed or narrow spacesdrug that prevents pain by causing a loss of feeling

"THER" words! 2023-02-09

16 Items: In a group.This or that.To have more.Not all alone.A different one.Want something else.A present from a bird.A male who has children.A sibling who is a male.The opposite of rougher.A female who has children.A male who has grand children.A female who has grand children.Something a baby uses to calm themselves....

Unit 7 2024-04-25

11 Items: when usage exceeds supplynot returned quickly/at allProlonged period of consistently below average rainfalltype of mining where Large shafts dug deep into the groundthe type of mining that is a blend of surface and subterraneanboiling water and collecting the water vapor and condensing it...

Manifest destiny 123454321 2024-02-22

10 Items: last of these eventsthe worlds best contentwar in this time periodwhat we did to the nativeswhat we found in Californiaa trail to the Oregon territorypresident who broke a lot of ruleswhat we forced the natives to walkpopulation of California after gold rushthe belief that the USA should cover the entire content

Nia's word search! 2023-12-18

19 Items: our galexythe study of spacethe study of zodiac signa rock floating in spacea smaller bear constalationsomthing that gives off lighta bear constalation thats bigwhat earth does around the suna person who goes up into spacesomthing that bounces off lightlooks like a big spoon in the skylooks like a small spoon in the sky...

unit 8 2024-05-01

13 Items: uses microbes to absorb or digest toxinschemicals are magnified through the food webincrease in death rate occurs over a large areaincrease in death rate occurs over a local areaflow of all wastes produced by the average persontype of waste that is from chemicals and constructionturning organic wastes into a sustainable fuel source...

12 Elements Of Tone Of Voice 2023-02-11

12 Items: pacetempopitchpausevolumejargonclaritypronounspracticeintonationconcisenessarticulation

Genocide Key Terminology 2024-02-06

16 Items: meet in the middleon the outside or on the edgedoes an illegal or harmful actfanatical political or religious viewsused to promote a certain point of viewlimiting or restraining, often by forcea person who belongs to a targeted groupindirect word use to hide or soften the truthmass expulsion or killing of a specific group...

Kingdom Living 1 2014-03-06

23 Items: LordMoralLocalMaybeSocialPresentKingdomNationalCovenantCelestialSpiritualUniversalPrincipleMillennialEternal-SonNot-ExactlySupernaturalAlways-ExitsEcclesiasticalEschatologicalAlways-ExistingUnconditional-RuleRule-of-god-directly

fun Yellowstone 2015-05-08

34 Items: 91.of10Itofas000300has290thethePark"Thethanoverwith308'it'sLowerFallsRiverWondersthermalgeysersvisitorcentersNationalfeaturesshowpiecewaterfallsYellowstoneYellowstone

fun Yellowstone 2015-05-08

34 Items: 91.of10Itofas000300has290thethePark"Thethanoverwith308'it'sLowerFallsRiverWondersthermalgeysersvisitorcentersNationalfeaturesshowpiecewaterfallsYellowstoneYellowstone

Villains 2023-05-14

20 Items: lokiscarjokerjafarsauronursulajigsawthanosmagnetodraculavoldemortmaleficentlex-luthorcount-olafdarth-vaderthe-penguinnorman-batesfreddy-kruegerhannibal-lecterwicked-witch-of-the-west

SUPER SOUPER SUPPER 2023-10-16

24 Items: phoPEAmisoONIONchiliramengumboNOODLESQUASHtomatowontonBISQUElentilN RICEpotatoCHOWDERcabbageCHEDDARCHOWDERtortillavegetableasparagusOF MUSHROOMvichyssoise

Unit 17 Word Search 2024-03-05

12 Items: causing damage, harmful.cheerful and full of life.supporting one another’s life.in a dying or death like state.to preserve in the memory foreverable to be broken down naturally.harmful to physical or moral health.causing the death of living organismsto cause the extreme embarrassment to.the act or process of bring back to life....

Vocab word search 2024-04-26

12 Items: definition listening to ordersdefinition its like being treated crueldefinition to bark quick in a sharp tonedefinition something that supports wood for sawingdefinition a group of shelter like a bunch of tentsdefinition an inner voice bringing someone to rightness.Definition is when your crying and have tears in your eyes...

Human Dignity & Human Rights 2024-01-23

7 Items: is the worth (value) each individual has for being humaninvolves reverence, ________, and protection towards each personour worth was originally based on merits, _______, or achievementsa privilege or freedom all individuals have for the fact of being humanour worth comes from the fact of being created in the image and likeness of _____...

Nonfiction 2023-10-13

17 Items: topicessaysjournalsnonfictionstatementscommunicationA small eventCan be proved true.Written by that person.Records of daily eventsWritten by someone else.From one person to another.Order or sequence of events.One asks the other questionsPersonal beliefs; cannot be proved.Meant to explain, persuade, or informDiagrams, maps, charts, and photographs.

Sound of Speech 2019-05-12

14 Items: StopsNasalsVelarsDentalsGlottalBilabialsAlveolarsFricativesAffricatesInterdentalLabiodentalsAlveopalatalsPlaceOfArticulationMannerOfArticulation

lemons of love 2024-03-26

15 Items: WWigregbethkarenscottdonnalindachuckjanetdavidjasonjuliejeanneroslie

Book of Job 2024-09-17

14 Items: JobGodTestLossFaithFamilyWisdomPrayerFriendsPatienceRecoverydijiste:SufferingBlessings

Things in the Classroom 2024-03-20

10 Items: used for sittingused for cutting paperused to measure lengthused to sharpen pencilsused for write somethingused for writing on white boardused to write in front of the classused to see the location of an areaused to put things and place to writesmall world map depicting the shape of the earth

Wedding 2024-03-31

64 Items: idocakedateelksjulylokilovenalaringsuitveilvowswifeadoreaislebridedressgroomkiarapartyscotttoastbowtiebrunchcandlecheerscouplefamilyfreyjaoilersspeechalbertabouquetcherishdiamondeternalflowersforeverfriendshusbandmuttartpromiseromanceweddingceremonydevotionedmontonjenniferlaughtermarriagememoriesproposaladventurehappinesshoneymoonofficiantreception...

functions of communication 2020-08-15

14 Items: socialmessagespeakercontrolbarriercontextchannelfeedbackdecodingreceiveremotionalinteractionexpressionscommunication

Ethnobotany of Turmeric  2021-05-17

15 Items: IndiaSpiceModernGlobalHawaiiCookingNaturalCultureMedicineMedicineProductsCosmeticCaliforniaTraditionalDomesticated

Bride of Chucky 2022-09-19

14 Items: Dolljessechuckyrevengekillerdollserialkillervoodooritualofficernortoncharlesrayleewarrenkincaidlapetitemortebrideofchuckytiffanyvalentinelieutenantpreston

Types of Reactions 2024-05-20

14 Items: productformulabreakupcompoundreactantmarriagecheatingsynthesissubstancecombustionpartnerswapdecompositionsinglereplacementdoublereplacement

Structure of heart 2024-06-06

14 Items: pumpaortaatriabloodmuscleoxygencardiacvenacavaventriclepacemakeroxygenateddeoxygenatedpulmonaryveinpulmonaryartery

Elements of Plot 2024-09-04

14 Items: DRAMACLIMAXEVENTSENDINGSETTINGCONFLICTEXPOSITIONINTRODUCESCHARACTERSANTAGONISTRESOLUTIONPROTAGONISTRISINGACTIONFALLINGACTION

Easter Games 2024-03-14

10 Items: HuntRaceRacegamesrelayeasterpinataof WarRollingSack Race

kara 2022-11-30

9 Items: one complete wave cyclethe measurement of frequencythe measurement of displacementmaximum displacement in longitudinal wavemaximum displacement in a longitudinal wavemoves the medium parallel to the wave motionmoves the the medium perpendicular to the wave motionthe maximum upwards displacement in a transverse wave...

Word Search 2022-06-22

12 Items: (n) a swimming pool(adv), (adj) not far away(n) a single apartment in a bigger building(n) a tall modern building with many floors(adj) old-fashioned, or based on ideas from the past(n) an opinion, belief, or idea, or a way of thinking about something(n) the area of a town that surrounds someone's home, or the people who live in this area...

Understanding Loss Drafts 2024-08-01

17 Items: A list of materials needed to complete the repairs.An examination of the condition and safety of the home.The entity that represents the homeowner in a court case.The amount the insured is responsible for in case of a lossThe actual cost to replace a structure at its pre-loss condition...

Ecology Word Search 2024-05-10

14 Items: Land biomeWater biomeIndividual living beingDescent with modificationPopulation growth with limitsVariety of species and organismsPopulation growth without limitsOne organism hunts and eats anotherRemoval of trees/ forests for human useDone by plants to create their own energyAll living and nonliving things of an area...

Thunder Rolling In the Mountains 2024-10-09

15 Items: ElkElkHawkCoatsCrowsGlassWomanWillowLapwaiJosephOllokotWallowaNecklaceAssiniboinsof Running Feet

trs23 ver3 u5 2023-03-06

6 Items: Take a break. Relax.A big area of water.An insect with a long body.The noise of hitting water.A kind of leaf that sits on water.A green things that grows and needs sunlight.

Movie "42" preview terms 2021-10-15

32 Items: ofmvppagearmyhallfamesmithjackiebranchrickeyroyalsrachelrookietalentdodgerssatchelcalvarywendellantiwarrobinsonbaseballbrooklynmontrealfortytwofirstbasefalloffamenegroleaguesegregationnonviolencecolorbarrierdiscriminationaprilfifteenth

Movie "42" preview terms 2021-10-15

32 Items: ofmvppagearmyhallfamesmithjackiebranchrickeyroyalsrachelrookietalentdodgerssatchelcalvarywendellantiwarrobinsonbaseballbrooklynmontrealfortytwofirstbasefalloffamenegroleaguesegregationnonviolencecolorbarrierdiscriminationaprilfifteenth

Unseen Faithfulness 2023-12-12

32 Items: ausintoitofatgodhasouthisandoneactthatusedwaystimewomencarryplanschurchalwaysunseenhistoryremindsservinghappensordinarysovereignsacrificialfaithfulness

GOVERNMENT 2024-10-07

30 Items: StatePowerof lawNationSocietyFederalPoliticsTaxationMonarchyRepublicPreambleSocialismTerritoryAuthorityInfluenceJudiciaryGovernancePopulationLiberalismAristocracyBureaucracyCitizenshipTraditionalSovereigntyPresidentialConservatismConstitutionCommonwealthTransparencyParliamentary

Systems of Equations & Inequalities 2023-05-25

9 Items: methodmethoddependentconsistentinequalityindependentinconsistentof an inequalityof a system of linear equations

Lesson 17- Right Dog for the Job (4th grade) 2023-12-14

20 Items: judgetwicestagesinceridgeglancedamageofficebridgechancenoticemanagepalacepackagebaggagemessagebandagecarriagepracticemarriage

NMSI World Environment Day 2024 2024-05-09

10 Items: The process by which fertile land becomes desert.This country is aiming to plant 20 million trees annually.These events are responsible for 60% of worldwide crop loss.The multi-national body who have led world environment day since 1974.Soil fertility has reduced by 60% due to land degradation in this country....

Mr Curran's Word Search 2023-10-05

10 Items: Choice of wordsAble to be seen or known in advanceWhat a jury says is true after a trialTo say the opposite of what someone saysto charge with a crime by finding of a juryReference that provides the definition of wordsA leader who has complete control over a countryThe student with the highest rank in a graduating class...

Zodiac Word Search 2023-03-20

12 Items: My zodiac signNot a real animalA ferocious animalA man's best friendThis zodiac is very cheekyThis animal lives in a styPeople born in the year 2025People born in the year 2017The seventh animal in the zodiacThe smallest out of all of the zodiacsThe animal that was supposed to be firstThe baby version of this child is called a kid

English IH Unit 6 2023-09-20

15 Items: pompousunconcernedshort-livedsevere povertyturn int vaporharsh and shrilldestroy completelygracious; heartfeltpractical; possibleunselfishly generouspacify; lessen the anger ofrelieve; make more bearableexamine closely and criticallypicture made of colorful, small, inlaid tilesgoing in different directions from the same point

PHELBOTOMY 2021-01-13

33 Items: OFOFDRAWCLIAEDTASCOPEORDERGAUGELANCESERUMVEINSPLASMAETHICSDERMALNEEDLESHEPARINALCOHOLSYRINGEPRACTICESPECIMENBIOHAZARDHEMOLYSISCHEMISTRYBUTTERFLYPHLEBOTOMYTOURNIQUETCENTRIFUGECOAGULATIONVENIPUNCTURETHROMBOCYTESFASTINGGLUCOSESHARPSCONTAINERHEMOCONCENTRATION

Jackson - Nicholas Tesla  2022-05-01

33 Items: byofACdiedpoormotorradiopowerLovedbirdsmemorycaringiPhoneremoteSerbianeidetic”mastercontrolinventortargetedvehicleswirelessBrilliantcompriseslightningambitiousforgottenEccentricaltruisticBenevolentEnvisionedHomeschooled

CH 12.1 2024-02-19

24 Items: AgeZhaotypewendiCanalgentryTaizongdynastyDynastyDynastyDynastyDynastyjurchenCompassBindingwarlordof Talashangzhougunpowderporcelainhereditarybureaucracyacupuncturescholar-officials

Sight words 2024-10-04

32 Items: tosoorofbeohnogodoputarefortheboyhertwooneanyshelooksaidtheywhatgirlmanysomeyourfromcomelovetherelittle

GOVERNMENT 2024-10-07

30 Items: StatePowerof lawNationSocietyFederalPoliticsTaxationMonarchyRepublicPreambleSocialismTerritoryAuthorityInfluenceJudiciaryGovernancePopulationLiberalismAristocracyBureaucracyCitizenshipTraditionalSovereigntyPresidentialConservatismConstitutionCommonwealthTransparencyParliamentary

Famous people 1.w 2022-11-01

14 Items: Teslas ceoAmazons ceoThe old queenPrince of whalesGenius scientistliberal presidentFamous basketballerInventor of gravityFamous white rapperrepublican presidentFamous female singerPopular serial killerNo longer in the royal familyPrincess who died in a car accident

Pure Substances and Mixtures 2023-10-18

10 Items: Anything that has mass and takes up spaceA homogeneous mixture can also be called thisA heterogeneous mixture that a rabbit might eatA homogenous mixture that you might drink at breakfastA pure substance you might sprinkle on top of french friesMatter that has a specific composition and can't be broken down...

Geometry Words 2023-02-02

10 Items: a 90 degree angleone part of a linea polygon with four sidesa rectangle having all four sides of equal lengtha triangle with all sides equal and all angles equalthe intersection point of two sides of a plane figurea triangle with one internal angle equal to 90 degreesan angle less than 90 degrees but greater than 0 degrees...

Unit 1 Review 2024-09-03

10 Items: When energy is movedThis is stored energyThis is the energy of motionThese carry energy from one place to anotherType of energy stored in the bonds between atomsWhat it's called when energy changes from one form to anotherThis is done to an object to give it Elastic potential energyGravitational potential energy is affected by these two things...

Personal Financial Planning-LK 2024-05-17

15 Items: spanfundbudgetincomewealthexpenseexpenseexpenseexpensecharityanalysisspreadsheetyourself firstresponsibilityof financial planning

4th Grade Times X-mas Word Search 2022-11-18

14 Items: toyssantajesuselvescookiessnowmanhotcocoreindeersnowballpresentschristmasornamentschocalatechristmastree

Effects of Imperialism  2014-11-03

14 Items: rulespreadchangesculturefaminesexportsEuropeanresistedimproveddisrupteddestroyedinfluenceresistanceindustrialized

war of 1812 2016-03-08

14 Items: BowandarrowRifleswordspearMusketpistolMortargunnersnipergunboatmilitaryartillery

SYNONYMS OF BRIGHT 2020-02-20

15 Items: SHINYAGLOWFULGIDBLAZINGRADIANTRADIANTBEAMINGLUMINOUSDAZZLINGFLASHINGGLEAMINGSPARKLINGSHIMMERINGGLITTERINGGLISTENING

Names of God 2020-05-17

14 Items: IAmElohimElOlamYahwehAdonaiFatherElElyonJealousHolyOneElShaddaiYahwehJirehYahwehNissiYahwehShalomJehovahNissi

Health of foods 2020-09-21

14 Items: CPRFoodMoldSickacheGermsvirussporesSafetyHygieneStomachBacteriaSicknessTemperature

Types of Cheese 2022-12-18

14 Items: briegoatgoudaquarkswisstilsitcheddarricottahandkasemuenstercambozolalimburgerbutterkasemozzarella

name of town 2023-02-03

15 Items: omaghwalestyronegalwaybelfastmaghrerascotlandgaiballymaghrerabanbridgecookstownballyclaredraperstownportstewartdesertmartin

Means of transportation 2023-02-06

15 Items: carbuscarshiptaxitruckplaneairshipbicyclescooterambulancesubmarinelimousinemotorbikehelicopter

Branches of Government 2023-03-21

14 Items: lawstrialjudgebranchrightssenatelawyercapitoljudicialexecutivegovernmentwhitehouselegislativesupremecourt

Types of Nouns 2023-05-27

14 Items: junnounleahcommonproperpluralsingularconcreteabstractcompoundisabellacountablecollectiveuncountable

Body of Christ 2023-10-26

14 Items: eargodeyesfeetnosegifthandsbrainheartchurchwisdomtogetherknowledgecorinthians

Life of Pi 2023-11-10

14 Items: pijoyboatindiatigerhyenazebramartelthirstpacificsurviveorphanedorangatangdepression

Rate of Reaction 2023-12-27

14 Items: ratesolidvolumecatalystincreasepressurereactioncollisionssurfaceareatemperatureclosetogetherconcentrationkineticenergyactivationenergry

Sounds of Y 2024-04-05

14 Items: yetyesgymshykeyyellmythcysttypeplayoncetalefairyfiction

Collections Word Search 2024-06-21

9 Items: The quality and timeliness of the work performed by the Canada Revenue Agency (1 word, 7 letters)The official decision of the court resolving a dispute and determining the rights and obligations of the parties (1 word, 9 letters)...

Vocab 10 2023-10-23

11 Items: footto sharpengreat sufferingcause of unhappinesscome together as one unita total or humiliating defeatto defraud or swindle; to cheatinjurious to health or morals; poisonousto increase the severity of; to aggravateone who is intolerant especially in matters of religion, race, or politics; racist...

Persecution of Muslims 2023-09-06

12 Items: __________ was the first martyr in Islam_______________________spat on the Prophet's face_________ harassed the Prophet (s) when he prayedQuraysh would call the Prophet (s) ___________________________ scattered prickly bits of wood on Prophet's pathThe daughters of the Prophets (s) were ________ by sons of Abu Lahab...

Family 1 2022-12-01

9 Items: you dadyour momthey made youwhat makes a wife?people you live withwhat makes a husband?who is with your auntopposite of a daughteropposite of your sister