4th of july Word Searches

Ophelia + Mikey 2026-02-02

12 Items: Best manProposal cityProposal monthName of our catName of our first carOur favourite cuisineWho’s the coffee drinkerNumber of years togetherOpehlia's favourite hobbyNumber of siblings between usMikey's favourite musical decadeNumber of countries visited together

Should Australia have a Bill of Rights? Word Search 2026-05-25

17 Items: HumanCivilRightsAccessEqualityAustraliaDemocracyPoliticalReferendumProtectionRule of LawConstitutionInternationalBill Of RightsLegal DocumentInterpretationFounding Fathers

Los Preposiciones 2026-04-22

11 Items: underbehindbetweennext toin/on/atfar fromclose toon top ofin front ofto the left ofto the right of

Indian Literature 2025-09-29

10 Items: He is the author of Shakuntalawho is the author of epic RAMAYANA?collection of written hyms in praise of the godComprising prose prayers and litanies for ritualswhat is the name of Rama's wife who get kidnapped?refers to the collection of ancient religion texts from india...

Unit 9: Climate Change 2025-04-29

15 Items: The warm periods that occur between ice ages.A mixture of gases that surrounds a planet or moon.the removal of large areas of forests for human purposes.the development of towns and cities on previously natural areas.Gases Gases in Earth's atmosphere that trap heat near the surfaceWarming An increase in the average temperature of Earth's surface....

Nervous System 2025-02-11

23 Items: Relating to movementRelating to the synapseAnother term for a neuronUnpleasant sensory experienceStructure that detects stimuliSupporting cells of the nervous systemRelating to sensation or sensory organsThe control center of the nervous systemInsulating layer around some nerve fibersThe fundamental unit of the nervous system...

Emor 5.0 2025-05-11

21 Items: KorbanPesach“HaShem”“set apart”“Commandments”‘priests’, Hebrew.The day of complete rest.The 10th day of the seventh month.Punishment for blasphemy of The Name.Animal korbanot are to be without ______.What kind of oil was used in the menorah?The Haftarah Emor comes from the book of ______.A kohen is to marry a ______ from among his people....

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Altar Word Search 2026-02-06

20 Items: – Man's conversation with God.– Help offered to those in need.– Trust in God and His teachings.– A symbol of goodness and truth.Bible – The holy book of Christians.– Following the commandments of God.– A state of tranquility and harmony.– The place where believers pray to God.– The one who watches over and protects....

Mrs. Cowan's 4th Grade 2025-08-07

13 Items: MacAyikJudeGabeSunnyRiverRoldanSiannaAbrahamAdelineCarolineJaybuaiiMrsCowan

S 2024-04-09

19 Items: (mystery)(peculiar)(watchful)(captivating)(proper manners)(group of stars)(sad and pensive)(theatrical dance)(science of sound)(calm and peaceful)(related to horses)(related to cooking)(sentimental longing)(art of good cooking)(lively and energetic)(complex musical piece)(ability to bounce back)(study of celestial bodies)...

Medical Abbreviations 2 2025-02-04

19 Items: historyfractureafter mealsbefore mealsdate of birthcubic centimeterover the counterdate of admissionlower extremitiesdo not resuscitatenon-weight bearingbathroom privilegeswithin normal limitsdischarge/discontinueagainst medical advicecentral nervous systemactive range of motionactivities of daily livingtemperature, pulse, respiration

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Absent Work 2024-09-16

20 Items: / Final step in a CER/ Means afraid of water/ Smallest unit of life/ Powerhouse of the cell/ Building block of matter/ Variable that is measured/ Contains human genetic code/ Variable that is manipulated/ Proposed answer to a question/ Humans inhale this to survive/ Used to support a claim in a CER/ Process by which plants make food...

Citizen Word Search 2024-12-05

12 Items: a member of a political communitythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privilegesa rule of conduct or procedure established by custom, agreement, or authority...

Days, Months, Celebrations 2025-05-22

11 Items: First day of the week.The day you were born.Last month of the year.The beginning of spring.The start of the weekend.The last month of summer.People go to church on the day.The day of love with chocolate.A holy celebration with presents and Santa.Resurrection of Jesus, egg hunt and bunnies.Spooky, monsters, ´trick or treat´, costumes.

Video games 2024-10-30

16 Items: manFifaringhalomarioRobloxmarvelof wartetrisof dutypokemonunravelFortnitevalorantminecrafttakes two

Musical Genres 2024-03-11

17 Items: suiiimusic popularmade for moviesA sub-genre of pieclub and party musicpopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombia...

Reformation 2024-04-18

17 Items: Kings or queens.Church officials.Local church community.Official letter from the Pope.Church tax equal to 10% of income.Church court that punishes heresy.Period of art and learning revival.Major religious change and movement.Group of people gathered for worship.Formal statements of religious belief.Biased information to influence opinion....

Key Word Review 2025-12-09

38 Items: dayMaydadmomhotweekyearJuneJulycoldmonthMarchAprilsunnywindySundayMondayFridayAugustfamilysistercloudyTuesdayJanuaryOctoberbrotherweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptembergrandfathergrandmother

Yoto Carnegie 2023 Word Search 2023-05-03

9 Items: The number of shadowers in TeamBerkoThe surname of the author of 'When Shadows Fall'TeamBerko (The name of our school shadowing group)The title of the shortlisted book by Jessie BurtonThe title of the shortlisted book by Patrice LawrenceThe surname of the author of 'The Light in Everything'The month of the year in the title of the 2022 medal winner...

6th Grade Review 2025-05-05

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The number of teaspoons in a tablespoonThe amount the recipe makes (Ex. 16 cookies)Red, yellow and blue are these types of colors.One of the MyPlate food groups that includes cheeseOne of the MyPlate food groups that includes chickenOne of the MyPlate food groups that includes broccoli....

MileHigh Vocab 2025-10-29

50 Items: Proof of LossReplacement CostActual Cash ValueContinuing EducationTexas Insurance Codeuncertainty of a loss.Commercial Ocean MarineCommercial Inland MarineRecoverable DepreciationInsurance Service Officelegislative acts or laws.Additional Living ExpensePersonal Injury ProtectionCommercial Property PolicySpecial Investigation Unit...

MAG1 NFS Unit 7 Review 2026-06-16

19 Items: Air that moves.A tool to measure rainfall.Swirling wind storms on land.One of four times of the year.A strong storm with lots of snow.A scientist who tells the forecast.A word to describe the air outside.A chilly season with falling leaves.The coldest season with lots of snow.Low temperature, usually during winter....

Here’S Word Search 2025-03-21

55 Items: Having a clear intention or goalA purpose-driven goal or objectiveWork done to help or benefit othersWorking together towards a common goalA new plan or effort to achieve a goalUnity and mutual support within a groupSomething given or done to help a causeAssistance provided to those in distressHelp or support given to someone in need...

Matter 2026-05-19

11 Items: GasesSolidsLiquidsMeltingof stateFreezingof MatterDepositionSublimationVaporizationCondensation

Dungeons 2025-10-14

17 Items: itemMagicchainsDragonszombieskingdomof EvilmonstersTreasureand Doomof KingsPrisonersskeletonsadventureLabyrinthand poisonsTreacherous

South Word Search 2026-06-04

14 Items: Plan Harriet Tubmanv Monitor Elmira PrisonCotton Plan Clara BartonBattle of Bull Run Belle Boydof Chancellorsville Fort Wagnerof Shiloh Battle of GettysburgMarch to the sea Battle of Wildernessof Chancellorsville Gettysburg AddressLincoln elected Battle of Antietam UnionSumter attacked Emancipation Proclamation...

PLF Word Search - July 2024-07-01

8 Items: shredrosessummerrecyclefireworksbullwinklesdefensepaneloaaprenovations

Respiratory System 2024-10-18

24 Items: The total volume of air moved into and out of the lungs per minute.Hemoglobin bound to oxygen the primary form of oxygen transport in the blood.The movement of chloride ions into red blood cells as bicarbonate ions move out.The additional volume of air that can be forcefully exhaled after a normal exhalation....

Ramadan 2026-02-10

27 Items: The pre-dawn meal eaten before the fast begins for the day.Voluntary acts of charity and kindness done to help others.The new crescent moon that marks the beginning and end of the month.The Arabic word for fasting, which is one of the Five Pillars of Islam.The meal eaten at sunset to break the fast, often started by eating dates....

The weather and the seasons 2021-05-26

39 Items: MayhotwetdryicyJuneJulywarmcoldcoolMarchAprilsunnywindysnowyrainyfoggytodayspringsummerautumnwinterAuguststormycloudyJanuaryOctoberthundershoweryrainbowFebruaryNovemberDecemberfreezingtomorrowSeptemberlightningyesterdaytemperature

English vocabulary 2022-06-13

39 Items: maysadonetwotenjunejulyfourfiveninemarchaprilhappytiredthreeseveneightwindysunnysnowyrainyfoggymondayfridaysundayaugustwintersummerautumneleventwelvestormytuesdayjanuarythursdaysaturdayfebruarywednesdayseptember

ALL ABOUT MS LAI 2025-09-24

39 Items: DOGPINKBLUEJULYBABYMSLAISUSHIPIZZAPARISBRIDECOSMOHUMANOHENRYSAMBASLONDONHAWAIIMEXICOARITZIAKETCHUPNEWYORKOCTOBERSEPHORACHOCOLATESTARBUCKSJOSHALLENJACKHUGHESCACTUSCLUBDISNEYLANDQUINNHUGHESRUFFLECHIPSDISNEYWORLDICECREAMCAKESOURPATCHKIDSLEWISHAMILTONCHOCOLATELAVACAKEPUMPKINSPICELATTECHOCOLATECHIPCOOKIESREECESPEANUTBUTTERCUPPEPPERMINTHOTCHOCOLATE

Plankton vocab 2024-01-22

22 Items: respirationother organismsLargersized plankton visible under a microscopeSmall crustaceans that are a common type of zooplanktonExtremely smallsized plankton smaller than microplanktonSmall animals that feed on phytoplankton or other zooplanktonOrganisms that obtain their energy by consuming other organisms...

Askiathegreat Word Search 2024-10-04

24 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Creation of Boeing 2025-05-15

16 Items: CB291915NASA1956planesAirBusbreederE. BoeingSeaplanesV ApolloWestervelt707JetlinerAirplane Company15 1916 Seattle, WAAero Products company

Med terms 2026-04-23

12 Items: Inflammation of the pleuraInflammation of the pharynxSurgical removal of all or part of a lungAn accumulation of fluid in the lung tissuesThe diagnostic measurement of physiological activity during sleepSharp chest pain that occurs when inflame pleural membranes rub against each other...

Vocab list.Pe.2 2023-10-16

36 Items: PenDayMayBookYearWeekJuneJulyMonthtodayMarchAprilFolderPencilMondayFridaySundayAugustTuesdayJanuaryFebuaryOctoberNotebookTomorrowThursdaySaturdayClassroomWednesdayStudent deskStudent (Male)Sheet of paperTeacher (Male)Student (Female)Teacher (Female)What is it today?What is the date?

WEATHER 2025-05-17

18 Items: kõuMaivälktalvsügisuduneJuuniJuuliMärtskevadAprillluminepilvinetormineuduvihmVeebruarpäikselinekeeristorm

Key Word Search 2026-05-18

11 Items: Sacred text of JudaismCommunicating with GodFather of the Jewish peopleSacred book of ChristianityIslamic holy month of fastingOne of the followers of JesusReligion based on the teachings of JesusGiving something important up for a beliefJewish festival celebrating freedom from slaveryAn extraordinary event believed to be caused by God...

Manatees 2025-04-29

12 Items: Where this takes placeOne place of pollutionAnother example of pollutionAnother example of pollutionPeople that opposed the protectionWhen the plan started to take actionAnother group of people that opposedOrganization involved with protectionA problem with evolution in the futureBeds of this dying leading to starvation...

Week 18 Thursday 2024-02-04

25 Items: SpyingYoungera choicehelp or supportFor a short timePermitted by lawAt the present timeMoney for investmentMasses of bread or meatthe act of being presentA way of acting or behavingSomeone who repairs machinesA deep, gaping hole; a gorgeTo have said yes to somethingThe reason why something happensA relative who lived in the past...

united 2024-01-05

32 Items: seamoonlakeatomoceanrivercloudsenergytissueerosionbiologyecologymoistureecosystemacousticsamplitudeatmosphereevaporationtemperaturecondensationaccelerationDwarf planet with two moonsplanet with the biggest ringslargest planet in the solar systemhottest planet in the solar system...

ALL ABOUT ME! 2023-10-04

39 Items: maytimefoodtalleyesjunejulyfalllistsgoalspizzapastacolormusicgamermarchaprilbreaksportsfamilyethnicaugustwinterspringsummerautumnhobbiesfriendsjanuaryoctobericecreamsiblingsholidaysfebruarynovemberdecemberbirthdaysseptembertraditions

Unit 5 review 2025-05-22

37 Items: MaywasbedJuneJulystarsealwereMarchAprilnursepilotfloorbroomAugustdriverwaiterdishesJanuaryOctoberofficerdolphinFebruaryNovemberDecembersheepdogteatowelSeptemberambulancescientistfishermanjournalistbottlenosefirefighterwebdesignersheepfarmerphotographer

The English Renaissance - part 2 (Characters) 2025-11-20

20 Items: mother of Hamletfriend of Sebastianbest friend of Hamletdisguised as a man - Cesariofriend of Toby's; courting Oliviasitting king; murdered his brotherViola's twin brother; thought deadson of Polonius; doesn't like Hamletgood king; ghost; murdered by brotherOlivia ___ Sebastian; Orsino ___ Violasteward (butler) to Olivia; secret crush...

Week 6 Biology Word Search 2025-10-08

11 Items: Maintaining a balanced environment.The movement of water across the membrane.The passive and spontaneous movement of particles across the membrane.The release of large particles in vesicles to the outside of the cell.When the concentration of the solution is lower than the inside of the cell....

Academic vocabulary 2025-12-11

11 Items: The rhythm and intonation of a languageSomeone who regularly travels between work and homeAny of two or more actual representations of a morpheneRelating to the grammatical arrangment of words in a sentenceConnected with the accepted way of spelling and writing wordsConsisting of parts or things that are very different from each other...

Courtroom Vocabulary 2026-02-04

28 Items: a crimea contradiction.to erase or remove completely.a person involved in a lawsuit.accused or charged with a crime.give evidence as a witness in court.a writ ordering a person to attend court.not connected with or relevant to something.action taken in a court to settle a dispute.the lawyer(s) conducting a case. (Atticus Finch)...

Medical Terminology 2026-01-29

14 Items: pregnancyBroken boneto destroy the lensChronic liver diseaseinflammation of a nailrefers to sole of the footinflammation of the thyroid glandSensation of spinning or whirling aroundIncreased formation and secretion of urineinvoluntary muscle contraction of a (blood) vesselInhaling fluid or a foreign object into the airways...

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

compliance and Ethics Day 1 Puzzle 2024-10-02

24 Items: AbuseFraudHIPAAhotlineProgramAuditingMedicareEducationWork Planof ConductGovernmentGrievancesMisconductMonitoringSanctionedAntiKickbackInvestigationFalseClaimsActConfidentialityComplianceOfficerComplianceCommitteeConflictsofInterestCorrectiveActionPlanof Inspector General

Month & Days 2022-12-09

19 Items: MayJuneJulyMarchAprilAugustMondayFridaySundayJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySaturdaySeptemberWednesday

Geometry 2026-01-06

20 Items: conelinecuberatioangleangleproofanglelinesanglescircleanglessegmentcirclesgeometryconversehypothesisproportionof symmetryof a segment

May 2026 Word Search 3 2026-02-18

19 Items: degree of heatto turn over soilpredicted weathersoil water removallimited direct sunrelating to springrelating to a seasoncomplete sun exposurea small garden sectionto allow air into soilamount of sun receiveddistance between plantsa line of planted seedsa prepared planting areato prepare and grow soilsmall local climate zone...

July 9, 2021 Southern Oaks Word Search 2021-07-08

27 Items: bbqouthottanhatjetskilakeswimcookpoolsuithairboatpartymessypicnicfloatstubingpopcornfishingburgersbathingumbrellafireworkswatermelonsummertime

Chapter 7 Vocab 2025-10-21

14 Items: What are the building blocks of protein?What is the resting phase of hair growth?What is a circular growth pattern of hair?What is the outermost layer of the hair shaft?What elements make up the composition of hair?What is the innermost layer of the hair shaft called?What is the short fine unpigmented hair that appears on the body?...

BF10 2.05 Vocabulary Review Word Search 2026-03-09

23 Items: The money that a business spends.The possibility of loss or failure from nature.The possibility of loss or failure from human error.Chances of loss that may result in loss, no change, or gain.Chances of loss that carry with them the possibility of loss or no loss.Rivalry between or among businesses that offer dissimilar goods or services....

Red Word Search 2026-06-22

9 Items: the Colour of Some Winethe Colour of Buttercupsthe Colour of a Cue Ballthe Colour of a Beloved Catthe Colour of Spades and Clubsthe Colour Added to Red to Make Purplethe Colour of Delicious Fish Baked with Lemonthe Colour of a Traffic Light When it is Safe to Gothe Colour of a Cardinals Robe, a Symbol of Authority

math wordsearch 2022-11-30

31 Items: oddeveneventmarkupinverseoutcomedivisionmarkdownsubtractadditionfractionsinferenceprincipalpopulationproportioncross-sectioninterest-ratepercent-erroradjacent-anglescomplex-fractioncomposite-figurepercent-equationinvalid-inferencepercent-of-changeindependent-eventsisolate-a-variablecomparative-inferenceexperimental-probability...

July 4 - Community Helpers 2026-06-10

8 Items: chefnursedoctorpoliceartistsingerteacherfirefighter

4th Grade Unit 6 Review 2013-09-30

50 Items: knitknowsignwrencarescrubclimbkneelwreckbrakecoverphotoroughsnacktrackdriedscreamscreensquaresquealsquirtstreetthrillassigndesignwreathwrenchattackenoughKansaspocketdancedscratchsqueezethroughunknownwritingbecausedolphinopeningworriedalphabetelephantstoppingstudyingworryingscariestsmallestskyscraperstrawberry

Mrs. Primo's 4th Grade Class 2023-08-20

22 Items: elinikoliammilanambermasonmariaameliazaydentaziirlorenasharonmahniyabrinleypaisleeemanuelmadysonvenechiojennifermarielosfelicityalexander

IMPOSSIBLE 4th Grade Word Search 2024-04-03

58 Items: elibenleahnoragigiavenlolaailimilomacyrhysjesusmariajackbrowanmilescallijacklgrantleynaliamvesterbaronhenrylydialiamsjacksadrienaliviacoltonhuxleycarterethanwameliacallensophieaustinalijahmarlieteaganjohnnyclairehenleyethansmadalynkennedypaisleygriffinnovaleemichaelmadelynpastorkdeverauxmakenziemackenziemrsreimermrspackardwillythewildcat

L12 Spelling Words - 4th Grade 2024-04-30

20 Items: goalslidecoachshownblownbrassswingsbecameviolinpasturelecturemixturemoisturepunctureadventuresculptureconductorliteraturepercussioninstruments

L4 Word Search - 4th Grade 2024-07-07

20 Items: quiztodaypupilnasaltwelveacrossduringsimilebridaldentalgerbilpostalproverbpassagepioneermetaphorproposalimmigranthemispherepopulation

Mrs. Hipp's 4th grade kiddos 2024-07-26

21 Items: lukejackleviowenlaceylaylaelenakimmymicahaidencolinhenryharperbettiecooperarthurfultonclemmiebradleycharlottehippenmeyer

Ms. Armstrong's Fabulous 4th Graders 2024-08-11

31 Items: MiaLeviPaulLukeLukasElsieLucyDLucyGWyattRavenRyderRiverGraceKinseyNathanAudreyAubreeHunterIsaiahParkerJacksonLilianaCharlieVictoriaKingstonAndersonVirginiaCharlotteMaricellaClementineChristopher

Ms. T.'s 4th Graders 2024-08-15

33 Items: LeoSaulLeahOmarRudyLaylaJaddeEliasSofiaKiaraEmilySofiaAngelXimenaMatteoEmilioJessieIsmaelFelipeChelseaAnthonyRominnaMarianaJazmineArantxaLeilanySantiagoFinneganBrittanyReynaldoThompsonGuillermoYarisbeth

Mrs. Alfano's 4th Grade Class 2024-08-19

25 Items: TaimZaydNoraZuriRoseRemiAbbasZeinaAlinaTaliaBowenKennaSammyIslamKellyYuhanYiningAlfanoMuntahaHusseinIbrahimDanielaWilliamJenniferYeonjoon

Unit 1 Spelling - 4th Grade 2024-09-19

23 Items: gymdockmoldshelfbuildmajorstraydraingrazeclimbtwicestovewealthcrunchwheezedonkeyheightfrightshadoweveningsqueakyconcreteroasting

Miss Desrosiers' 4th Grade Class 2025-06-09

23 Items: AuviEllaEmmaIrisBethEllieHenryJayceTobinAugustDanielHannahAdalynTeagueCallieKiernanEmersonLeelandMakennaGreysonLochlannChristianDesrosiers

Spelling List #7 - 4th Grade 2025-06-10

20 Items: repayunbornunloadunlockrecallresellrewashrewindretiresubwaypremixunblockunchainillegaloveractpreplanindirectoverheatincorrectsuperheat

Spelling List #9 - 4th Grade 2025-06-10

20 Items: shredscrewsplitthrobshrinkshrimpshrunkscriptstrapsstrandsproutsprangspringsplashthrillthronethroatscreechthroughstraight

Spelling List #3 - 4th Grade 2025-06-10

20 Items: keybeamhealleakweepseemreefdeedfeetgenebusyonlymaybezebrascenechiefmoneypleasespeecheither

Ms. Neff's 4th Grade Class 2025-06-12

23 Items: HankNeffArnavGraceAnkitMasonLoganReeseManishNisijaJaydenDyllinDaphnePeytonJosceyBaileyDylanSDylanWCalvinCameronDominicTristanSymphony

4th Grade Lesson 1~6 2025-07-18

32 Items: goodnamenicemeetlinepushtimebikegreatentertouchangryhappytiredlunchwatchfatherfriendhungryschooldinnerhelmetjacketmorningeveningteacherthirstyumbrellaafternoonbreakfastgrandfathergrandmother

Mrs. Austin's 4th Grade Class 2025-07-30

27 Items: NoxJaxHariMarkJackAndiAsherRileyJordiSofiaNayanAtaraAlinaCallenXimenaKaisenAudreyShahanJurgenKaidenBeckhamCollinsSophiaHRichardSophiaLAlondraCristian

Mrs. Dickson's 4th Grade Class 2025-08-01

20 Items: EliAliDukeMilaOwenMalakJaydaWyattBrettBrytonBaileeAustinBroganAlyssaWaylonArcherMcKaylaJacksonHarrisonCharlotte

4th Grade Friends Word Search 2025-08-05

49 Items: TyIlaAvaEliWrenRyanBeauJackNashBeauRemyOllyLoganIsaacBriarGrantAlanaAspynLukasBennyCalebColinGraceSantyDeclanKeatonHarperAndersColtonKerliiFallonDanielHarperSophieCollinsGraysonEstelleCharlieBeckettDanielaStephenAnabelleStirlingMarshallGabriellaChristianElizabethFrencesca...

Mrs. Lococo's 4th grade Homeroom 2025-08-07

24 Items: EVARAULARIADEANLYLABRADYJAMESDAVIDBRYCEPEYTONMATHEOEVELYNASHLYNSABINASUMMERNATALIASABRINAROSALIEJOURNEYRAELYNNTHEODOREANYTHONYALEKSANDERMRS.LOCOCO

Mrs. Schuessler's 4th Grade Class 2025-08-11

28 Items: LuisAriaKashDaniJasonLoganKatieEllieCalebElianEmilyAspenAveryAaronCaseyJohanCamilaDariusWestinMaddoxKameronNatalieEverettMaxwellHendrixMathiasVictoriaAlejandro

Mrs. Stoker's 4th Grade Class 2025-08-11

26 Items: MaxMiaEmmaMaryOwenDiyaReeseQuinnHalleWyattHazelNairaBlakeJaxsonNivithRaeganTaysonAmairaParkerSuttonMaddieDallinBrianaGraydenShepherdIsabella

Mrs. Ward's 4th Grade Class 2025-08-12

21 Items: ColtNoahLiamJaxonWyattClaraAnnieTraceAlexaMarynTylerParkerAliviaHadleyJudsonKinsleyJacksonAddisonNataliaLyndsayMakenzie

Mr. Nickerson's 4th Grade Class 2025-08-10

23 Items: IslaLucyLyraGretaAidanSophiaCarterVioletJaxsonHoldenKellerRaidenLennonJosephSpencerBrandonWilliamOrlandoBrooklynBrantleyMaryRoseWhitakerMrNickerson

4th Grade Friends Word Search 2025-08-12

32 Items: ARIARILEYMATEOROMANZAIJABRYANFATIMAIZAIAHZEMARIJANIYABRYSONAMELIATRAVONNATHANANNELYXAVIERTAYLORDELILAHDASHAUNZAMARIIBRADLEYANTHONYWILLIAMEDUARDOJAZMINEDARRIUSMADILYNNMOMILANIMAKENZIEALEXANDERSEBASTIENCHRITOPHER

Ms. Santistevan 's 4th Graders 2025-08-13

34 Items: KimMiaEzraKateSamiHughLucasEllieJamieKiyonMileyRockyDonelPiperYohanAniyahBrayanAuroraColtonIsmaelHudsonLilianJoshuaAthenaMarcusHunterI'zaliaJordannKennedyGonzaloRaphaelJuniperJasmineBerlinda

Mrs. DesJardins's 4th Grade Class 2025-08-14

23 Items: IanMiaKianKloeToddAdleyWyattAveryEamonRheanDamianJordynMarcusMisaelPaytonBlakelyMcKennaShayleeShayleeJonathanKaydenceSapphiraDesJardins

Mrs. Schmidt's 4th Grade Learners 2025-08-18

20 Items: MiaKaiAvaLiamPaulJaimeSadieRubenNorahWyattAveryWestinDeclanRafaelElijahYatzilVioletMadisonCameronNikolas

Ms. Vickers' 4th Grade Class 2025-08-19

21 Items: NoahEzraNoraSnowEvanEnzoJaxenAprilWyattSadieKailiKaydenHudsonBrysonImogenJayLynnJanelleBristinForrestBrightonJosefina

Our 4th Grade Class Family 2025-08-19

21 Items: MiaIzelDemiAlexNoahNafasEthanAlexaZiannaAzrielGianniViraatZackiaSerenaTihaamiHonestyLilianaBrantleyZoeyAnneCassandraCharlotte

Mrs. Dimond's 4th Grade Class 2025-08-20

23 Items: DJAdaAvaEnzoEvieLolaLukeNoraFionaGavinGraceJacobJamesJaxonJessaRileyRylieTitusBaileyHunterDelaneyMcKenzieTorstein

Mrs. Gruber's 4th Grade Class 2025-08-20

45 Items: AJAvaGioJoeLeaAbelAlexEwanPaceAbbieAndieGabbyLucasTylerSloanLemmoGrossHardySperkAsterRamosPatelPanekGordonMaddoxShrijiVivianBlakelyJacksonLincolnNelsitoPhillipPalatasCorlettPiskulaLagneseMartinezAndersonEspositoBrandBeyCharlotteMrsGruberAsaturyanBarzellatoDambrosioCooper

Ms. Feinstein's 4th Grade Class! 2025-08-20

25 Items: AmyBeauOtisNoahLunaSyanSageQuinnMilanWyattJamesMasonHazelJasonChaseAshleyElodieKensieSrithaMaggieXanderElliotBrooklynSavannahShreyanshi

Mrs. Cooper's 4th grade class 2025-08-22

24 Items: EllaFinnGigiAxelCaraNikoJaylaDavidJoelyDevinExainNolanAdrielStellaHannahRafaelAthenaUrijahTeaganRyleighBarrettBrittanyAnastasiaAlejandra

Mrs. Swain's 4th Grade Class 2025-08-22

28 Items: LiamNashBradyParisLamarEmelyJesseDiegoRaylynAdaleeAubreyElainePalomaCarterKamdenDamianMiguelJustinMaxwellMadilynLincolnHarmonyMadisonCaleighJerrellBrentleyAlejandraTennessee

Welcome to 4th Grade 4W 2025-09-02

23 Items: ElaBenJaxLiamRoryMayaNikoAydenEmilyAidenEllieEllieKeiraTommyEmilieWillowLondonBrysonJuliusInaietKennethBeatrizCaroline

Our 4th Period Science Class 2025-09-05

37 Items: ZOEALEXLEOYLYLAMILAKINDSAFEALICEAVERYCLARAELIAMEYTANJULIALOGANSHLOKSIONAKIMMIAMALIAAUSTINELOISEHAYLEYISAIAHISHAANJOSHUAPARTLOWAZENETHDOMINIKEMERSONMALCOLMRISHIKAKAMSWAYSCIENCELEONIDASKAMIAKINPROGRESSACCEPTINGALESSANDRA

Ms. Sarabia's 4th Grade Class 2025-09-15

25 Items: TeoKingTommiDiegoGraceAngelDarylEricaKacieAustinEmanieNicoleKeilerMonykaJavierWillowAntonioWleiderAriannaAllisonJovanniSarabiaRavioliEstrellaChristopher