4th of july Word Searches

Pulmonary Genetics 2025-04-01

15 Items: feature of 50% of PCD casesskin findings of Birt Hogg Dubefeature seen in 30% of AFAB with TSCcondition caused by TERT, TERC, DKC1gold standard of cystic fibrosis testinginjury or inflammation to the alveolar spaceoculocutaneous albinism, Puerto Rican founder mutationsymptoms include high pressure in arteries of the lungs...

emotions word search 2025-06-11

18 Items: most people are ...what people say when there cryingmarried people feel this for each othera feeling of worry, unease, or nervousnessmost people feel thins when they see a spidermost people feel this when a good thing happensmost siblings feel this when they get into an argumentpeople feel this when they see or hear something grows...

Tatum Lucero 2024-05-16

15 Items: The starting pointThe total distance movedThe process of changing directionAtoms of two or more elements combinedSubstance made up of atoms with the same identityThe difference between the starting and final positionan objects distance and direction from a reference pointMixture in which two or more substances uniformly spread out...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

Chapter 6 2026-04-30

14 Items: _______ - Evidence that briefly describes events that have occurred._______ - Evidence that describes in detail events that have occurred._______ - Numerical information about people or events used to ground claims._______ - Evidence in the form of actual objects, audiotapes, videotapes, photographs, or diagrams....

Vocabulary - Memory 2026-04-29

14 Items: StrongImprove.ProbableIdentifyRemember.Certain and sureSo that others can hear.From memory, by memorizing.bring memories of somethingAn illness of the mind and body.Correct, exact and without any mistakes.The fact of being unable to do something.The state of not having something anymore.Aware of,knowing what is happening around you.

IDEO: idea 2025-11-10

16 Items: ideoIdeaideogramideologyideogenyof ideasideologueideocracyideosphereideophobiaor mistrust of ideasruled strictly by an ideology or set of principlessystem of ideas and ideals, especially in economics or politicsarea where ideas are thought to be created and grown, intellectual space...

The weather and the seasons 2021-05-26

39 Items: MayhotwetdryicyJuneJulywarmcoldcoolMarchAprilsunnywindysnowyrainyfoggytodayspringsummerautumnwinterAuguststormycloudyJanuaryOctoberthundershoweryrainbowFebruaryNovemberDecemberfreezingtomorrowSeptemberlightningyesterdaytemperature

On our Calendar 2025-09-15

39 Items: MAYDAYJUNEJULYWEEKYEARMARCHAPRILMONTHFIRSTTHIRDFIFTHSIXTHEIGHTNINTHTENTHAUGUSTMONDAYFRIDAYSUNDAYSECONDFOURTHJANUARYOCTOBERTUESDAYSEVENTHTWELFTHFEBRUARYNOVEMBERDECEMBERTHURSDAYSATURDAYELEVENTHSEPTEMBERWEDNESDAYFORTNIGHTFIFTEENTHTHIRTEENTHFOURTEENTH

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Absolutism 2025-03-25

12 Items: of lawarmadahereticcapitalrepubliccrucifixinflationAbsolutismLegitimatedisciplinepresumptiveright of kings

Mrs. Ramirez 4th grade classroom 2025-08-06

20 Items: LiaIkerIkerAxelLiamRubyEmilyRubenSofiaPabloDarioReginaDylansMarlonCarlosVictorJazmineIsabellaSebastianYullianna

3rd & 4th Grade Word Search 2025-09-08

19 Items: AvaKidGoldDogsHenryGoofyClumsyBikingSoccerPartonPotterFriendsRonaldoMelchiorBaseballJeffersonGymnasticsSitter ClubHouse Books

Mrs. Huston's 4th Grade Class 2026-05-12

19 Items: AliRyanOwenEmmaAveryElijahYeiYeiParkerSpencerAvistynGraysonBeckettClaytonDominickBrantleeVirginiaMrsHustonMissBrandieMrsGoettsche

Music theory 2026-01-05

16 Items: the volume of musicthe layers of musicA cadence chords V - IA cadence chords IV - Ithe speed or pace of musicA cadence, anything to chord VA key signature with two sharpsA key signature with three flatsA key signature with no sharps or flatsmultiple notes all sounded one after the othera type of texture with two or more main melodies...

Trigonometry Identities 2025-05-07

21 Items: a² + b² = c²Reciprocal of sineReciprocal of cosineReciprocal of tangentBest pre calc teacherOpposite over adjacentStudy of triangle mathSpace between two linesGreek letter for anglesAdjacent over hypotenuseSays two things are equalMath rule or relationshipFlipped version of a valueFunction where f(–x) = f(x)True equation for all values...

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

Atom - nuclear 2023-10-17

20 Items: protons + neutronssaid electrons travelled in orbitals.radiation with high penetrating powersubatomic particle with neutral chargeparticle that is basically an electronsubatomic particle with positive chargesubatomic particle with negative chargeidentity of element. Number of protons.discovered electrons. Cookie dough model...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

NATP Chapter 14 2025-04-09

22 Items: Heart relaxesSlow breathingRapid breathingHeart is at workNormal breathingDifficulty breathingInhaling air into lungsThe absence of breathingExhaling air out of lungsUsed to measure temperatureWarm soak of the perineal areaUsed to measure blood pressureConsistently low blood pressureConsistently high blood pressure...

Vocab Odd Years 9 2026-03-10

24 Items: freedomto set freea leaning towardto lean back and relaxsomeone who beautifiesa polygon with 10 anglesa mature white blood cella surface that slopes or leansunit of computer storage spacepertaining to a sense of beautya white, crystalline amino acidthe sensation of bodily movementa geometrical figure with 8 angles...

DNA 2026-06-08

21 Items: The D in DNAthe monomer of DNAconnects with thymineSet of genes in an x-shapeDNA is a _ helix structure_ bonds hold together the DNAthymine and cytosine are thisPair Guanine and Cytosine, eg.comparing different strands of DNAThe genetic information in the cellsA process through which DNA is copied_ group holds together the nucleotides...

Los meses 2025-10-09

19 Items: MaywasJuneJulydateMarchAprilmonthtodayfirstAugustJanuaryOctoberFebruaryNovemberDecemberbirthdaySeptemberyesterday

4th Grade Unit 3 Verbs 2023-02-28

19 Items: to doto goto seeto eatto helpto callto needto haveto wantto liveto opento readto writeto learnto decideto attendto receiveto drink/taketo understand

In our 4th Grade Era 2024-08-30

19 Items: KimReetGavinAmberDerekKarlaAltafGiannaOliverAndrewTahliaTanishaGabrielAkshitaJanelleDhanushSamraathVaishnaviRidithvardhan

4th Grade Class Word Search 2025-08-19

19 Items: AceJackLeiaGavinDyRonGradyRomanJewelRowanStellaDaijahCarterKaiserJosiahKamariWilliamVictoriaGeoffreyCharlotte

Ms. Donnelly's 4th Grade Class 2025-08-28

20 Items: EvanKateLaneAylaQuinMackRubyJamesEllieJoelleMorganSamuelCameronLincolnLincolnLeonardClarissaVictoriaDonnellyMackenzie

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

Volleyball 2025-03-24

12 Items: total points in a gamemost popular type of servename a type of forearm passhow a ball is put into playhow tall the top of the net isit's in the middle of the courtfast offensive hit to a specific spotChief official of the volleyball gamenumber of players on the volleyball teamDefensive technique for stopping a spike...

Globalization 2025-08-19

27 Items: In comparison.Public perception.Area of expertise.Provider of goods.A reduction in priceTo use up completely.To take something awayA product not made abroad.To leave out or not include.Operates in several countries.Purchase and use of goods and services.Making something easy to use or access.Most important, powerful, or influential....

Ch. 33 Arthropoda Word Search 2026-04-05

12 Items: The process of shedding a cuticleArthropods have this type of symmetryArthropods belong to this clade of animalsThe number of tissue layers in an ArthropodArthropods have this type of main body cavityThis is shed for growth and provides protectionExample of an appendage specialized for sensingArthropods have this type of developmental mode...

Chapter 11 Word Search 2024-05-03

37 Items: the outermost layer of our atmospherethe lowest layer of Earth's atmospherean instrument that measures temperaturemeasures the distance north or south of the equatorwinds that occur in belts that go all around the planetan instrument that measures wind speed and wind pressure.heat-driven cycles that occur in the air, ocean, and mantle...

Monday's not coming by Tiffany D. Jackson 2024-11-29

16 Items: Name of the highschool?What happened to Monday?Name of Monday's sister?Name of Claudia's church?What sound haunted Claudia?What is Monday's moms name?Name of the housing complex?What is Claudia's dads name?Monday's favorite color was?Name of Claudia's boyfriend?Where did everyone think Monday went?What color was the house they spent time in?...

Absolute Word Search 2026-05-19

45 Items: suitable for growing cropsthe use of goods and servicesa serious disagreement or argumentan English-speaking resident of Quebeca good or service sold to another countryrain: rain mixed with pollutants in the aira good or service bought from another countrymoney that is earned from work or investmentsa climate that is dry with very little rainfall...

Les jours de la semaine et les mois de l'année 2024-09-03

19 Items: MayJuneJulyMarchAprilMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

German Months and Days 2026-01-12

19 Items: MayJuneJulyMarchAprilMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

Russia 2025-12-19

14 Items: beet soupfish eggsbiggest countrycapital of Russiaat war with Russiacapital of Ukrainepresident of RussiaSea south of Ukrainerare animal from Siberiadolls inside of each othersecond coldest place on earthclosest American state to Russiacountry with name like a US statesea that connects to the Black Sea

Environmental Events and their Implications to Human Lives 2023-03-11

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Environmental Events and their Implications to Human Lives 2023-04-01

15 Items: The extent of being liable.It is a potential source of harm.A real threat to general welfare.It is commonly known as biohazards.It is also known as social hazards.It is commonly known as tidal waves.The gradual caving in or sinking of an area.The sudden and violent shaking of the ground.These are hazardous substances that can cause harm....

Weathering, Erosion & Deposition Word Search 2026-02-25

15 Items: the force that pulls rocks and soil downhilla large moving mass of ice that shapes the landthe process that breaks rock into smaller piecesthe process where sediment is dropped or settledthe movement of sediment from one place to anothera type of weathering that changes the rock’s composition...

JUST BETWEEN US 2026-06-15

20 Items: kisskissmothbearglobetowerParisPoemscharmDatesAlwaysSafariCuddleexpressCampingKareokeof loveMistletoechocolateof minutes

Kenna's word search 2026-03-25

10 Items: sepoymarchcottonempirerailwaysof indiaof plasseyin the crownof india actindia company

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

Summertime 2023-05-05

39 Items: bbqhotjulyjunebeachboardchalkchillgamessleeptexasaugustcruisefamilyhikingmoviesskiingsmoressoccertennisairportbicyclebubblescampingfriendshydratebaseballcarnivalfestivalshoppingsunshineswimmingvacationfireflieslakehousesnowconessprinklersunglassesgrandparents

Teddy Inspired Word Search 2025-01-17

39 Items: JOYOMIROBTEDBABYBIBSBURPCRIBCUTEJILLJULYLORILOVEPLAYANGELBRYANOLLIETEDDYBOTTLEDIAPERFAMILYGIGGLEGRAHAMGRAMMYGRAMPSKISSESONESIERATTLECUDDLESLULLABYNAPTIMEPAJAMASRACHAELSWADDLEBATHTIMEPACIFIERTEETHINGSAUFFERERSEVENTHEENTH

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

Chapter 6 2026-04-22

14 Items: _______ - Evidence that briefly describes events that have occurred._______ - Evidence that describes in detail events that have occurred._______ - Numerical information about people or events used to ground claims._______ - Evidence in the form of actual objects, audiotapes, videotapes, photographs, or diagrams....

Chemistry Vocabulary Word Search 2026-02-17

19 Items: single unit of an elementmade of only 1 type of atom2 or more atoms bonded together2 or more elements bonded togethermixture that is the same throughouta mixture in liquid (usually water)mixture that is not the same (different)anything that has mass and takes up spacea new substance is created in a ____ change...

2025 in Review 2025-12-10

24 Items: Mark's big catchthe sun is waking upheadstand consequenceMilo caught his first one!what Mark hopes to do in 2026special sunset cloud formationMilo and Lucy's favorite playmatea Sunday evening special monthly eventwhat Papa tried to teach Lucy how to dogot cut off from the family photo by snapfishwhere Mark and Renee are every sunday morning...

Global I Review 2024-01-09

30 Items: Be goodBe chillBe good or elsePlebeians and...The first civilizationThe Islamic code of conductChristianity, Judaism, IslamThe Greek word for city-stateThe dynasty started by Liu BangA city-state that rivaled AthensAncient Mesoamerican civilizationCapital of the Eastern Roman EmpireHinduism, ancient Egypt, Rome, Greece...

Unit 14 Word Search 2026-02-14

30 Items: a six-pointed stara seven-sided shapeto multiply by sevena shape with six sidesone of six equal partsa shape with eight sidesa person in their eightiesa group of seven performersa person in their seventiesa group of eight performersto multiply something by sixa sea animal with eight armsa solid figure with six facesto multiply something by eight...

Aerospace Engineering Vocabulary 2026-03-27

30 Items: Main body of an aircraftDownward force due to gravitySpeed and direction of motionForce exerted by air or fluidShape designed to reduce dragFaster than the speed of soundSlower than the speed of soundHeight above sea level or groundAmount of mass in a given volumeAir resistance that opposes motionAirfoil surface that generates lift...

CP S2 Word Search 2025-05-12

38 Items: the charge on an ionstarting substances​substances that are formed​substances are not evenly spread out​Chemical reactions that absorb energy ​The mass of a substance per unit volume​number of protons & neutrons in an atom​Chemical reactions that release energy ​anything that takes up space and has mass​...

JAMES MADISON 2026-05-15

10 Items: FilesMadisonMansionof 1812soldiersAmericansbuildingsPayne Toddof Americaof the Constitution

Medium Level 2021-02-23

40 Items: SamLOLRedMayELAGymNiceBluePinkJuneJulyMathEasyHardFunnyGreenMarchAprilDanceAudreyOrangeYellowPurpleAugustSocialMeduimSoccerJanuaryFebuaryOctoberScienceReadingStudiesNovemberDecemberSwimmingSeptemberGymnasticsVolleyballBasketball

February Word Search 2023-10-25

40 Items: idoannlovehughmarydavejennterppylejulybridegroomjuliascottsarahloganblakedavidkevinncatslaythsilvergoldenaugustcarlylelindsayflemingweddingtestudokavetskyfebruaryredskinsmarylandfirstkissjambalayacakesplusfatherjohnwashingtongusthegoosecitrussquall

Summer Word Search 2024-05-24

40 Items: hottanjunejulybeachsunnyaugusttennisvacationcarnivalicecreambarbecueswimsuitlabordayoutdoorsbaseballsunscreenhurricaneflipflopsfireworkslawnmowermarcopolosharkweekwaterslidesandcastlesunglassesgraduationtrampolinebasketballvolleyballsummertimeblockpartyfrieddoughsummerbreakferriswheelperspirationamusementparkrollercoasterairconditioner...

Zxxxxx 2024-06-02

40 Items: zooangjulylumapinkwifezachboratyoshishrektacosconanqueenaugusthawaiimarvelsummerpandasmoviesanimalsfloridafriendsmihalikhibachitangledhusbandwatchesaquariumicecreamsixyearsbabyyodastarwarsbikeridestheofficedinosaurspointpeleevideogamesmapleleafstaylorswiftjurassicpark

asdf 2025-07-06

40 Items: funred,blue,July,flag,Bell,white,Tacos,stars,block,party,Quincy,family,summer,Anthem,friends,america,freedom,Hotdogs,stripes,Memories,Dunktank,IceCream,Barbecue,Sunshine,Fireworks,neighbors,LongBeach,Sparklers,Lawnchair,Sunscreen,BaldEagle,Patriotism,Declaration,SixthAnnual,Starspangled,firecrackers,unitedstates,Independence,Constitution,

Summer word search 2025-07-23

42 Items: sunhotfunpooldeerJulypoolswimsunnybeachoceanmangobunnycloudGrasssportwatersummerstitchfloweryellowgelatoseasonAugustslushypicniccoconutrainbowchickenicecubegogglespopsicleicecreampalmtreetropicalswimsuitpineapplebutterflyplaygroundwatermelonsummerbreakawesomeMarley

Months of the Year 2026-05-14

40 Items: MayFebOctDecJuneJulyYearTimeFallMaysSeptDatePlanMarchAprilMonthJunesJulysAugustMonthsSeasonWinterSpringSummerAutumnAprilsSchoolJanuaryOctoberMarchesAugustsHolidayFebruaryNovemberDecemberCalendarJanuarysBirthdayScheduleSeptember

Bride Word Search 2026-05-31

40 Items: TruJoyKyloLoveCakeWifeJulyVowsJCSUVeilSuitBrideGroomRingsPeaceUnityRoyalToastAisleFamilySmilesLaughsTuxedoFriendsWeddingDancingHusbandDevotionSoulmateGroomsmenChristinaHoneymoonReceptionTwentySixCommitmentAdventuresNineteenthBridesmaidsCelebrationTheJacksons

Adventure Word Search 2026-06-05

40 Items: JulytripBeachBooksRelaxFamilyGardenHikingPicnicSummerSunsetTravelBicycleCampingExploreFishingFlowersFriendsJourneyLibraryReadingAirplaneBarbecueFunGamesIceCreamKayakingLemonadeMemoriesOutdoorsSunshineSwimmingVacationAdventureButterflyFirefliesFireworksSunscreenPlaygroundSandcastleWatermelon

summer 2026-06-16

40 Items: fanskyfunhatsunjunejulyboatsandbikepailswimballwaterclearfloatwavesbeachoceantowelcreamknickssocceraugustshellscastleshoveltanningrunningplayingbaseballsunshinepopsicleumbrellaswimsuitbasketballvolleyballstrawberrywatermelonsunglasses

Macbeth 2024-10-30

10 Items: his heirs will be kingthe author of the playthe protagonist of the playmanipulates Macbeth with magiccomes up with the plan to kill Duncanthe son of Duncan who flees to Englandthe son of Duncan who flees to Irelandthe only person Macbeth should beware ofthe king of Scotland at the beginning of the play...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

social studies vocabulary 2022-06-14

14 Items: jurycivilgroupenlistof lawappealvaluesdonatedemandsupplyinquiryof rightsconventionpoint cabinet

Caribbean & Central America 2026-04-16

16 Items: Music found in JamaicaLargest country by sizeNatives of the CaribbeanMajor waterway in PanamaIsland with swimming pigsMain economy of the CaribbeanThe #1 export in the CaribbeanMix of native and Spanish bloodMost populated in Central AmericaMost dangerous country in the worldPopular tourist resort in Nassau, Bahamas...

States of Matter 2022-11-30

17 Items: an example of a gasan example of a solidan example of a liquidgases can take this shapekeeps its own shape & volumesolids do not _____ or expandsolids have ______ kinetic energytakes the shape & volume of its containergas particles move in rapid random ______particles of a solid move like this in placeparticles of a liquid can flow past each other...

4TH GRADE 2026-02-28

6 Items: WOLFBEARTIGERHUMANPANTHERORANGUTAN

Lunes Word Search 2025-01-29

19 Items: MayJuneJulymarchAprilmondayfridaysundayAugusttuesdayJanuaryOctoberthursdaysaturdayFebruaryNovemberDecemberwednesdaySeptember

Kim's Word Search 2025-03-12

15 Items: CampYorkBearsGolferGivingHawaiiLovingSpunkySkiingof fourHostessPiedmontShoppingFargo Bankof Southern California

Sharks Word Search 2025-03-25

22 Items: What are mermaid’s purses? ________What are baby sharks are called? ________What type of skeleton do sharks have? ________What is the fastest species of shark? ________What is the smallest species of shark? ________How do sharks communicate with each other? ________What is an excessive fear of sharks called? ________...

Water from the Rock 2025-06-02

26 Items: Israel's leaderMoses' successorPast tense of bringSet up, as in a tent_____________ of IsraelAnother word for a rockA hard geographical itemThe children of ___________Another word for "traveled"Meaning "based upon all this"To take in liquids into the bodyWhere the rock was (Exodus 17:6)God told Moses to _______ the rock....

Wedding 2025-02-09

14 Items: doManLoveVowsWifeKissBrideGroomDanceHusbandof HonorBridesmaidsof the Brideof the Bride

BriZee's Baby Shower 2015-07-23

40 Items: BibBabyCribMilkGirlJulyCrawlBottleDiaperRattleCryingOnesieCradleWalkerShowerBlanketTeetherBouncerCarseatFormulaNurseryLullabyBootiesLayettePacifierStrollerBabyfoodBassinetSwaddlerSippycupHighChairDiaperBagWashClothBurpclothBabyshowerBriZeeBabyBabyRizwanTwentyfifthNurseryrhymesTwoThousandFifteen

21-22 - Word Search - U5 - Level 2 2021-03-18

40 Items: buyMaymessloudJuneJulypoundpennycoinswritebringlightMarchAprilfirstthirdfifthsixthchooseMondayFridaySundayAugustsecondfourthcandlesparentspartnerTuesdayJanuaryOctoberreassurecalendarThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

DAILY WORDS 2021-10-18

40 Items: agecowmaygoodnamelivemeetnicebluejunejulynightbrowngreenhorserulermarchaprilyellowerasermondayfridayaugustmorningeveningtuesdayjanuaryoctobernotebookscissorssaturdaythursdayfebruarynovemberdecemberafternoonwednesdayseptembernationalityhighlighter

Love Word Search 2024-05-27

44 Items: lovejunevowssuitloveringjulysarahtysonpiperbridegroomdressdanceyoubouremmenfamilykitimatweddingbouquetstevensflowerstequilakitimatromancefriendsforevermarriagetogethermarriagesteenbucknashvillegreatdanehoneymoonleviathanhappinessengagementcumberlandcelebrationkendalavenueclingmansdomelaketownranchcampbellriverhighschoolsweethearts

Long i words 2025-02-27

40 Items: whyshedryfrysilotinywisepipetiedtyperelyjulydenyshinyfinalpilotalikebrideglidetriedfrieddriedstylerhymelightfightsightrightapplycyclespidersilentstrifepolitebrightknightcomplytycoondelightcyclone

Revision 2025-09-21

40 Items: sixmaypensayzerofivejulypinkblueopenworkthreesevenfortyfiftyblackwhitebrownrulerwriteclosecheckthirtyaugustsummerwinterspringautumnyellowmarkerpencileraserlistenfifteenhundreddecemberseptembersharpenercalculatorhighlighter

Days, months, colours and school supplies 2025-09-26

41 Items: penMayredglueJuneJulybluegreypinkpaperdiaryrulerMarchAprilblackgreenbrownpencileraserAugustMondayFridaySundayorangeyellowpurpleJanuaryOctoberTuesdaynotebookscissorsFebruaryNovemberDecemberThursdaySaturdaysharpenerSeptemberWednesdayhighlightercontactbook

Florida Summer 2026-05-21

41 Items: HOTGOLFJULYJUNEPOOLSRAINYAUGUSTBIKINGHIKINGBOATINGFISHINGKEYWESTMUSEUMSPICNICSSEAWEEDAQUARIUMGRILLINGHUMIDITYKAYAKINGKEYLARGOSUNSHINESWIMMINGVACATIONWEDDINGSLIGHTNINGSUNSCREENCOCOABEACHHURRICANESMARGARITASSOUTHBEACHTHEMEPARKSWATERPARKSPLAYGROUNDSSANDCASTLESDAYTONABEACHSIESTAKEYBEACHANNAMARIAISLANDBOKTOWERGARDENSCLEARWATERBEACHGEMINISPRINGSSTATEPARK...

Pope Word Search 2025-06-10

26 Items: ofMaypopeheadawaybornfromstaypoorhopeAprilpapalpeaceEarthbravefaithchosencaringleaderhumblenaturememoirprotectencouragethe age ofguesthouse

Solar System 2025-10-22

14 Items: orbits star directlyfails to clear orbitorbits planet directlysame as asteroid but smallerSun-based solar system modelEarth-based solar system modelmass from space hitting surfaceforce of attraction between massescelestial mass of rock, gas, & dustmass from space striking atmospherefield of comets & debris past Neptune...

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

Game Online of Colaboration Project (National Hero, Province/Capital City, Local Foods, Tradition, and Culture) 2025-11-12

10 Items: A hero from MalukuOne of Palembang's typical foodsThe capital of North Sulawesi provinceThe capital of West Kalimantan provinceThe name of the capital of Central JavaThe name of the capital of East KalimantanAngklung and gamelan musical instruments come fromLompat Batu is a traditional culture from the island of...

BSN Fair Treatment of Financial Consumers Word Search 2024-03-13

20 Items: BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's ____________________________________________.There are _________________________________ principles of FTFC stipulated in Bank Negara Malaysia Policy Document of FTFC....

Leo Lens - April 2026 2026-04-30

10 Items: The writer of a bookA main division of a bookA long work of fictional proseA list of sources cited in a bookAn introductory section of a bookThe protective outer binding of a bookThe edge of a book where pages are bound togetherA drawing or picture that decorates or explains a bookAn author's handwritten or typed text before publication...

Unit 4 Vocabulary Word Search 2025-10-24

18 Items: independent poweran addition to a documentapproval of a document or policyan agreement between opposing partiesA complaint about something unfair or wrongA law or rule made by a city or local governmentan alliance of states created for a common purposeA person who is running away, especially from the law...

Lesson 4: Father of Many Nations 2024-04-05

14 Items: heirisaacshieldrewardnationnationsbehavioralmightyoffspringtestamentof promisedemonstrateof the earthrighteousness

Module 10 HMH Vocabulary 2025-02-01

23 Items: The 2nd VP of JacksonsNickname of the high tariff placed on importsThe creator of the Cherokee system of writingAn informal group of trusted(by Jackson) advisersThe practice of giving government jobs to political backersAn agency created to manage Indian removal affairs in western lands...

Econ concepts 2023-07-16

16 Items: iloveeconomicsmyfavoriteclassbestteacherevergreatlifelessonsThe study of the economic behavior of individuals and firms.A situation in which extra units of something produce successively smaller benefits.A school of economic thought advocating government spending to pull economies out of recession....

Lisa and Rob's wedding wordsearch 2025-06-02

14 Items: City we live inRob's middle nameRob's birth monthLisa's middle nameLisa's birth monthName of our pet catHazel's middle nameMatching tattoo animalSchool we both attendedLast gig we went to seeOur most watched TV seriesOur first holiday destinationBig nut that brought us togetherWhere we hung out together in our teens

4th grade 25/26 2025-08-14

13 Items: AnaRyanSarahDavidKevinVanesaNoeliaAdrianaWilliamBethanyValeriaAnthonySalvador

The word search of Hathor 2026-04-24

14 Items: COWDISKMENATOF RASISTRUMGAZELLEHATHORSHET-HERTTURQUOISEMALACHITESOVEREIGNJUBILATIONOF SYCAMOREDISTANT ONE

Geometry 2026-04-21

11 Items: Having the same size and shapeA transformation across a lineA transformation that shifts or slidesThe original figure in a transformationA transformation known as the center of rotationSymbols used to label the image in a transformationA transformation that does not change the size or shape of a figure...

APP Week 2025-05-31

17 Items: ExpertsAutonomyMidwivesEmpoweredEducatorsSeptemberAdvocatesChampionsAssistantLeadershipof PracticeAnesthetistPublicationsPractitionerCertificationBased Practiceof Nursing Practice

WEEK 1 SPELLING SEARCH 2026-04-06

20 Items: MORE THAN ONE OXTO SEIZE OR CAPTUREWITH THE EXCLUSION OFUNABLE TO DO SOMETHINGA REFLEXIVE FORM OF ITA SPRING OR SOURCE OF WATERA CHILD WHO LOST BOTH PARENTSFREE FROM DOUBT OR RESERVATIONFREE FROM IMPERFECTION, COMPLETEA VISIBLE IMPRESSION OF SOMETHINGEAST OR WEST ON THE EARTH'S SURFACEA SENTENCE IN AN INTERROGATIVE FORM...

Chapter 7, Part 4: Digestive Terms 2026-05-13

26 Items: A CLEFT PALATEA SWELLING OF SALIVAPERTAINING TO ORGANSPERTAINPERIODONTAL WALLAROUND/NEAR CONTRACTIONPERTAINING TO THE PALATEPERTAINING TO THE THROATTHE ACT OF BACK FLOODINGPERTAINING TO THE PYLORUSINFLAMMATION OF THE MOUTHPERTAINING TO THE PANCREASPERTAINING TO AROUND TEETHPERTAINING TO AFTER A MEALRECONSTRUCTION OF THE PALATE...