4th of july Word Searches

Electromagnetic Waves 2024-05-09

12 Items: blocked by bones and teethused in heat lamps for reptilesconverted into sound and pictureemitted by radioactive materialsa disturbance that transmits energybees can see this type of radiationthe transfer of energy by electromagnetic wavesthe distance from one crest of a wave to the nextwaves that transmit energy through matter or empty space...

CHAPTER 14 2023-04-21

16 Items: eraeonfossilepochsperiodshalf-lifekt-boundrypaleontologistplatetectonicsrelative-datingradiometricdatingcambrian-explosionlaw-of-superpostiongeologic-time-scaleendosymboint-theorytheory-of-biogenesis

Stem List 3 - Find the example words hidden in this puzzle. Look at the clues and definitions at the bottom of the paper for clues on which words are hidden. Use your stem notes! 2024-11-04

22 Items: the act of forgivingcapable of being submergedaffected with or inclined to claustrophobiaattended by or causing suffering or disasterShe suffers from some ____ without her glasses.one of the same or nearly the same age as anotheran undertaking usually involving danger and unknown risksthe adhesive friction of a body on a surface on which it moves...

Quality Definitions 2025-03-27

20 Items: waste materialrequirements have been metDoing it right when no one is lookingexisting, happening, or done at the same time.for a specific intended use have been fulfilledWhere requirements for a procedure are retrievedrelating to a corporation, especially a large company or group.a thing that makes something better or is better than something else....

MS Drama Music Vocabulary 2026-03-19

27 Items: to invent or create musicpublic performance of musicdirector of a musical groupthe highest-pitched male voiceItalian dynamic term for “loud.”Italian dynamic marking for “soft”the regular repeated pulse in musica piece of music for two performersItalian dynamic term for “very loud.”the rate of speed of a piece of music...

Memory Word Search 2024-12-17

18 Items: "Flash Drive" of the brain​Inferior to hippocampus proper​Paired, almond-shaped structure​Learning stage of memory creation​Ability for brain to adapt and learn​A type of memory correlated with smell​Receiving input from Entorhinal Cortex​A type of memory correlated with hearing​gateway between hippocampus and neocortex...

Chapter 14 - The Nervous System 2026-05-08

18 Items: gap between neuronsmeans "little brain"largest part of the braincommand center for the bodychemical messangers in your bodygroup of cells near base of brainelectrical message sent by neuronsan action that happens before you think about itcarries information from your nose to your braincarries information from your ears to your brain...

opium wars 2026-03-03

30 Items: sapPragZexuportstradesaleschinagoodsdrainrightscottonBengaldynastyforeignof trademonopolyTaxationApproachof Opiumopium warOpium warimbalancePolarizedof silver"Pushers"QuarantineEnforcementLegalizationsuperintendentExchange Demand

Constitution 2023-09-19

20 Items: vetoratifyReviewPowersPowersPapersProcessCollegepreambledelegaterepublicamendmentbicameralof Powersof RightsfederalismConventionSovereigntyconstitutionand Balances

The Nutcracker Ballet 2023-10-11

20 Items: taleclaraPrinceCoffeemagicalde deuxof SnowelegancegracefuldazzlingballeticSoldierswhimsicalof SweetsgrandiosedreamlikeenchantingPlum Fairytchaikovskyof the Flowers

Happy Birthday, Michael!! 2025-08-02

13 Items: to the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthjust next doorbackwards loopdrive with easewithout minionsbefore an audiencesounds like enchiladas

Which word in the puzzle is one of the seven plagues of Egypt 2025-03-20

10 Items: licehailbloodfrogsfliesboilslocustsdarknessof livestockof firstborn

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Occupational Therapy Care vocabulary 2023-03-10

23 Items: adulteatinghealthdevicereportbathingof lifeleisureculturegroomingmobilitydressingtoiletingpediatricassessmentadaptationenvironmentproductivitydevelopmentalaccommodationof daily livingcare activitiesrecommendations

Community Services 2026-02-18

22 Items: RisksRightsof riskConsentRespondRespectsupportPrivacyof careAdvocacyservicesPoliciesviolencereportingDiversityTransportProceduresEmpowermentHomelessnessopportunitiesConfidentialityhealth services

International Celebrations and Festivals. 2024-09-18

16 Items: festival of colorsMuslim fasting monthBeer festival in GermanyHindu festival of colorsWater festival in ThailandFestival of lights in IndiaJewish celebration with candlesLunar New Year celebrated in ChinaMexican holiday honoring the deceasedIrish holiday honoring the patron saintStAmerican holiday with a feast of gratitude...

3 Worlds Meet 2025-09-08

10 Items: a large farm zonea series of religious warsa monotheistic religion of the muslimsWhen you travel from one place to anothera mixed woodland grassland biome and ecosystemthe line of descendants of a particular ancestora period marked in time of Classical learning and wisdoman ethnolinguistic group of indigenous people of mesoamerica...

The Periodic Table 2026-03-27

18 Items: The name of Group 1The name of Group 7The name of Group 0A particle with no chargeWhen a solid becomes a liquidHow an element reacts or behavesSmallest whole part of an elementHow easy it is for elements to reactHorizontal rows on the Periodic TableThese are listed on the Periodic Tablevertical columns on the Periodic Table...

4th Grade Spelling Words 2025-11-05

13 Items: eruptabruptverdictdictateaquaticdictiondistracteruptionabstractinterruptterritotycorruptiondictionary

Aerodynamic Word Search 2025-10-30

25 Items: Real-world applicationEarly models of designsStudy of motion and forcesScientific tests conductedPhysical model for testingOutdoor real-world testingUsing computer calculationsHow well a system functionsFactors that can be changedPositive aspects or benefitsFacility for airflow testingPower efficiency measurementNegative aspects or drawbacks...

Nonfiction/Memoir Vocabulary. 2025-10-10

20 Items: Roll call of prisonersTo give false representationA person who carries out harmful actsThe fear and hatred of anything strangeA Jewish prayer recited in the daily ritualA person not recognized as a citizen anywhereAn official whose job is to inspect new thingsA prisoner who is elevated to a better position...

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Civics 2026-03-19

12 Items: lawCourtof Lawof PowersExecutiveJudiciaryDemocracyParliamentFederationGovernmentConstitutionAccountability

Spelling 6 2024-03-27

10 Items: opposite of shortthe opposite of pushanother word for nicethe solid form of waterthe eighth month of the yearused to make windows and cupspart of an animals foot, especially catsa mineral used in jewelry, like a diamonda small round piece of metal used for moneyparts of the body muscles connect to (plural)

Building Components 2023-02-20

25 Items: a lowest part of basea top that covering of a buildingto guide water flow from the roofa protection from the rays of the sunthe bottom horizontal member of a walla very tall building with many storiesthe part of a wheel or tire that makes contacta triangular portion of a wall between the edgesprovide the structure's stability from the ground...

Word Search - 2nd Game 2025-04-10

24 Items: Famous rice dish with chickenMost popular bun in BreadtalkA popular savory fried dough snackA small, steamed bun with a filling-BaoSoft and tender grilled skewers of meatSweet, chewy dessert made from glutinous riceMinced meat and dough and being fried afterwards.A thick rice porridge served with different toppings...

Chapter 7 Foundations Electricity 2025-05-17

31 Items: also known as probe1.1,000 of an amperealso known as insulatorray Tesla high-frequency currenttherapy also known as phototherapyany material that conducts electricitycurrent rapid and interrupted currentelectrode used on the area to be treatedsubstances that speed up chemical reactionsuse of electrical currents to treat the skin...

Unit 3 Vocabulary Word Search Review 2025-11-07

40 Items: a minor wrongdoingnot harmful or offensivevery unpleasant, annoyingbeyond criticism, faultlessbrisk and cheerful readinesscountless or extreme in numbernoxious, harmful, or poisonouscareful of one's speech/actionswarn or reprimand someone firmlyauthoritative counsel or warningthe state of being without guiltnot showing respect, impertinence...

7TH GRADE VOCABULARY WORD SEARCH 2026-04-16

52 Items: – Story writing.– Reliable source.– Intended readers.– Improving writing.– Correcting errors.– Cannot stand alone.– Proper comma usage.– First-hand account.– Informative writing.– Writing to convince.– A complete sentence.– Second-hand account.– An opposing argument.– Pronouns match nouns.– A scene from the past.– Support from the text....

Improperfraction Word Search 2023-01-12

12 Items: part of wholetop of fractionbottom of fractionnumerator is larger thanfractions that are equalthe product of two factorsnumber whole number with fractionnumerator is smaller than denominatorfraction using lowest number possiblea number multiplied with another numberknown size or amount that helps understand the difference...

Psych Disorders Review 2026-04-22

20 Items: unwanted thoughtsunwanted behaviorsOCD of keeping itemsintense irrational fearabbr. for persistent worriesprolonged emotional sufferingdeparture from "normal" behaviorAPA guidelines to diagnose disorderspersistent emotional distress due to traumadisorder with unwanted fear of embarrassmentperspective that studies impact of childhood...

Sara 2026-06-15

26 Items: Best man's nameOldest dogs nameTheir Cat's nameSara's professionConnors ProfessionBride's middle nameMaid of honor's namehoneymoon destinationGrooms birthday monthMonth Connor ProposedStyle of Sara's dressDating app they met onGroom's favorite vodkaName of Groom's motherColor of the Sara’s eyesYear Connor and Sara metBrides favorite cocktail...

Mrs. Henry's 4th Grade Class 2025-05-13

19 Items: AriEmiHindAlmaLunaChloeDemaniSophiaAdrianJohnnyAlainaJaydenAnthonyGreysonJourneyEmmanuelBenjaminMrsHenryChristian

Ms. Ahrens's 4th Grade Class 2025-08-29

19 Items: AvaJohnSeanLilyGraceChloeLucasPaytonGiannaPeytonJosephClaireBriannaBrendanCharlieAnthonyBenjaminGiovanniAlexander

Mrs. Harju's 4th Grade Class 2025-08-29

19 Items: EzraMayaAriaVeraAlexBrodyLaylaHazelPiperCiaraCarterElliotHannahCarsonSkyleiEvelynColterEmmettVeronika

Tristan's word search it's hard 2026-01-23

15 Items: actactorscenepropsstoryscripttheaterproblemdialoguenarratorsettingsof dramadirectionsof charactersme if you can

Legacy of the Congress of Vienna 2026-02-01

15 Items: RussiaAustriaPrussiaBritainAllianceof Powerof ViennaMetternichHardenbergTalleyrandLegitimacyCastlereaghAlexander IRevolutionsPolitical Map

Unit 3 Vocab Word Search 2025-11-14

12 Items: skewedspreadoutlierassociationcategorical dataline of best fitquantitative datameasure of centermeasure of spreadstandard deviationinterquartile rangecorrelation coefficient

St. Brendan the Navigator Word Search 2023-11-16

12 Items: fenitmonkstraleeirelandfinnianscotlandmonasteryannaghdowncolumcilleof Irelandthe Navigatorof the Blessed

Macro Chapter 21 Vocab 2024-10-29

17 Items: exports minus imports (X-M)a period during which real GDP decreasesgoods and services purchased from other countrieswhen governments buy goods and services from firmsThe purchase of new capital goods (tools, instrumentsTaxes paid minus cash benefits received from governmentsThe expenditure by households on consumption goods and services...

Origins and Insertions of the Neck, Face, and Respiration Muscles 2025-09-25

23 Items: Origin: Temporal fossa. Insertion: Coronoid processOrigin: Spinous process C2. Insertion: Transverse process C1Origin: Transverse process C1. Insertion: Inferior nuchal lineOrigin: Spinous process C2. Insertion: Lateral inferior nuchal lineOrigin: Posterior tubercle C1 Insertion: Medial Inferior nuchal line...

ntro to Arts A/V Tech and Comm Weeks 13 - 14 2025-12-03

24 Items: A unit used to measure the intensity of sound.The art and technique of motion-picture photography.The written text for a play, film, or broadcast production.A public display of art, objects, or information for viewing.The process of repeating a segment of audio or video in production....

Middle School ELA Literary Terms 2026-02-12

21 Items: Boom! Zing! Crunch!the problem in a storyMain character in a storyusing words that sound alikethe leaves danced in the stormcomparing two words using like or asa major category or type of literaturecomparing two words not using like or asgroup of lines in a poem; poetic paragrapha word that means the same as another word...

Gov Vocab 2025-12-07

25 Items: information from congressImplied presidential power to withholdPresident's annual message to Congressauthority of a court to hear and decide casesA person who brings a legal action against anotherLegal rule or rule established in previous court casesLegal right of a party to bring a case to federal court...

Caput II 1st Declension Nouns 2024-11-07

20 Items: lifepoetsmoneyangerlivespoet'spoets'of livesgate (acc.)of the roseof thoughtsto the girlsthe sailor'sshapes (acc.)rumors (abl.)sailor (acc.)for philosophywith penaltiesfortunes (acc.)fatherland (voc.)

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

Heaven Word Search 2026-02-26

10 Items: GodGoldPureJesusHeavenThroneof LifeWorshipof KingsSalvation

Stage 20 Culture Review 2023-05-11

23 Items: nikenikenikepseudo-sciencefather of medicinecenter of learninggreat griffin golfergreat griffin runnermade first water-clockAlexandrian astronomermade first steam turbinewrote a geometry textbookmeasured the circumferencefamous 20th century doctorfamous 20th century authorRoman contribution to healthtitle of first geometry textbook...

Nail Diseases and Disorders 2025-03-12

20 Items: nailspoon nailswhite spotsbitten nailstrumpet nailfolded nailsingrown nailsfungal infectionram's horn or clawtiny pits roughnessdeformity or diseasethickening of the naildarkening or black bandlifting of the nail plateskin becomes split or tornsplit brittle nails with ridgesthin white nail plate very flexible...

God's Names - By: Dillon Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Gods Names - Eli Postma 2024-04-10

18 Items: sonwordabbajesusbiblerabbisaviorof Godof GodfathermessiahteacherMessiahof JesusDelivererDelivererChosen OneRelated to Man

Algae Word Search 2026-05-11

30 Items: - one half of a diatom’s shell- whip-like structures that help cells move- a microscopic algae with a glass-like cell wall- the hard outer shell of a diatom made of silica- the bottom part of a microscope that supports it- blue-green bacteria that use photosynthesis to make food- the buildup of harmful substances in an organism over time...

Heather's Mortgage Word Search 2022-10-27

20 Items: Fannie MaeFreddie MacWhat is a 1003To buy real propertyThe number of days the lock is effectiveproperty secured to the repayment of the loanThe numeric value issued by the credit bureauFee paid to an appraiser for preparing an reportThe annual cost or fee associated with a serviceThe first individual listed on a loan application...

Rock Word Search 2024-11-14

23 Items: - A use or marble.Mountains - Where Granite is found.- What is a common sedimentary rock?- What type of rock is coal classified as?- What type of rock forms from cooled magma?- What are limestone and sandstone used for?- What is an example of an intrusive igneous rock?- What is an example of an extrusive igneous rock?...

final 2024-12-18

20 Items: a band of nerve fibersthe process of chewinga curvature of the spineinflammation of the sinuslongest and strongest boneinflammation of the appendixthe liquid component of bloodsecond largest part of the brainan illness that affects the lungscells that prevent the body's loss of bloodthe number of times your heart beats per minute...

5 & 6 Vocab Review 2022-09-27

40 Items: hasherhimhismaynotshewhyyoudoesfallgoeshavejulyjuneusesyouraprilcookslikeslovesmakesmarchplaysreadsaugustautumnspringsummerwinterbecausejanuaryoctoberstudieswatchesdecemberfebruarynovemberpracticesseptember

Birthday party 2023-03-21

41 Items: boywkdbeercakecokegirljunejulylovewinemarscomemilkfantapepsimusicchrissweetmarchaprilwarpsfantapeopledrinksfamilysisterauntiesummerballoonbrothersausagechickenjanuaryweekendbowlingbirthdayinvolvedsandwichswimmingfavouriteenjoyning

everything 2023-10-06

40 Items: dadmomzoemaycoolmarcjunejulydadslouiebradycornymarioluigipeachaprildrinkmaggiegeorgecringysundaymondayfridayaugustmatthewmichaeltuesdayjanuaryoctoberjohnpaulsaturdaythursdayfebruarynovemberdecemberfavoritekatherinewednesdayseptemberoldfasion

SUMMER 2024-10-25

40 Items: SKYHATHOTANTSBEESGOLFJULYJUNERAYSBEACHFLIESGRASSSWEATWASPSAUGUSTBREEZEHIKINGPICNICSOCCERSUNTANBICYCLEBOATINGCAMPINGFISHINGFLOWERSSANDALSSUNBURNBARBECUEBASEBALLHOLIDAYSSOLSTICESUNSHINESWIMMINGGARDENINGSUNSCREENMOSQUITOESSKATEBOARDSPRINKLERSSUNGLASSESWATERMELON

Los Meses Del Año 2025-02-23

20 Items: MayJuneJulyyearMarchAprilmonthyearsAugustmonthsdecadeJanuaryOctobercenturyholidayFebruaryNovemberDecembercalendarSeptember

Nanci Word Search 2025-03-21

40 Items: elfluispinkbluejulycowsbabeultananciramosduranblackwhitebrowncandyfloresinnoutbailesmakeupcoffeesummertargetpadillaflowersfishingdancingonesizevanillajaripeoanimalseyelashwalmarticecreamlemonadevacationdutchbrosextensionsgoldeneaglestrawberriessoldejaniero

Summer Word Search 2025-05-21

40 Items: sunfunjunejulypoolsandparkballbeachwatertowelbikesrelaxsummertravelshellsaugustpicnicfamilyhotdogsburgerssandelsfriendsfishingcookoutoutsideswimmingicecreamvacationsleepingnoschoolbarbequeroadtripumbrellaswimsuitbonefirewaterparksprinklersunscreensunglasses

Discovery World Summer Camp 2026-05-04

41 Items: FunArtJuneJulyBugsCampLakeBirdsWaterLEGOSBuildMusicSpaceAugustSummerSnacksNatureDesignRobotsEscapeCodingGuitarMoviesRecessFishingFlowersOutsideReadingSciencePhysicsBiologyDiscoverSailboatSunshineHabitatsAquariumSunscreenChemistryClaymationSkateboardPrintmaking

Adventure Word Search 2026-06-05

40 Items: JulytripBeachBooksRelaxFamilyGardenHikingPicnicSummerSunsetTravelBicycleCampingExploreFishingFlowersFriendsJourneyLibraryReadingAirplaneBarbecueFunGamesIceCreamKayakingLemonadeMemoriesOutdoorsSunshineSwimmingVacationAdventureButterflyFirefliesFireworksSunscreenPlaygroundSandcastleWatermelon

Summer Word Search 2026-06-22

40 Items: PARKJULYBEACHTOWELCANOEKAYAKTRAILSUMMERPICNICHIKINGHELMETFAMILYHOTDOGSOCCERSUNSETCAMPINGBICYCLEFRIENDSFISHINGFRISBEERAINBOWHAMMOCKVACATIONSUNSHINESWIMMINGBARBECUELEMONADEICECREAMSEASHELLBASEBALLROADTRIPBACKYARDADVENTURESUNSCREENFIREWORKSBUTTERFLYDRAGONFLYSANDCASTLEWATERMELONPLAYGROUND

Vocab Word Search 2022-09-08

20 Items: to ask a questionthe act of hunting for factsthe size or amount of somethingto work effectively with othersmodel a constructed model of somethingmodel a picture that represents somethinga guess or hypothesis based on observationsa factor in an experiment that affects the outcometools and supplies needed to conduct an experiment...

Geography Terms 2022-11-16

28 Items: A small streamWet spongy groundNatural elevationA small wooded hollowNarrow gorge with streamrounded hill or mountainA high steep face of rockA ring shaped coral islandA waterway dug across landA slowly moving mass of iceA steep rugged rock or cliffsmall low lying coral islandA small sheltered bay or inletA ridge of sand created by wind...

Ida B. Wells-Barnett 2025-05-06

15 Items: NACCPIdaJrHermanAlfredaCharlesJournalistSuffragistCourageousBirth PlaceDeath PlaceCause of DeathWhen She was BornNumber of Children She HadName of the Book She AuthoredComplete the Sentence - Anti-Lynching _____

Chapter 8 Hair and Scalp Disorders & Diseases 2024-12-09

27 Items: split endstechnical term for beaded hairtechnical term for brittle hairtotal loss of all terminal scalp hairloss of terminal hair on the body and scalpinflammation or infection of the hair folliclesinfestation of the hair and scalp with head licepartial or complete hair loss from where it typically grows...

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

Saved by the Lab 2023 QuidelOrtho 2023-03-09

20 Items: Na,K,Cl,CO2BUN,CREAT,GFR testingIAT, IS, or EXM are optionsQuidelOrtho Chemistry PlatformWinner of the 2015 Edison AwardWaterless chemistry methodologyWhen will the test be resulted?Brought PCR testing to many labsbody system that regulates hormonesDeveloped in the 80's by Dr LaPierreLessens incubation time in AHG testing...

Quantum Word Search 2025-01-28

21 Items: A colorful manSnakes can see itAlpha, Beta, this.One packet of lightWhich way light goesPrefix meaning one billionthThe study of colors of lightA specific amount of somethingAs light, or a range of thingsThe distance from peak to peakThe father of quantum mechanicsEM waves good for communicationBlack lights are in this EM range...

Literary Terms, Elements & Devices Word Search 2022-10-05

40 Items: A voice behind the peomThe objective meaning of a wordThe choice of words a writer usesThe Central character and a storySomething is given human attributesThe classification of literary workThe perspective a story is told fromThe highest point Tension in the plotThe use of informal language in writingThe struggle between two opposing forces...

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

X Word Search 2025-03-06

13 Items: XrayXenonXeroxXfactorXrayfish(a name)Xylophone(a type of ship)(part of a plant)(hugs and kisses)(a type of fruit)(a garden walkway)(short for xylophone)

Fantasy Cartoons 2025-07-27

15 Items: TimeShrekPrinceTangledthe PoohOwl HouseDuckTalesof ArcadiaSchool BusLion GuardLittle PonyTales of ArcadiaFairly OddParentsto Train Your DragonThe Labyrinth of Magic

Chapter 15 Vocab Word Search 2024-03-21

11 Items: A solution of known concentrationA compound whose color is sensitive to pH.The point at which an indicator changes color.The pH range over which an indicator changes color.The negative of the common logarithm of the hydronium ion concentration.The negative of the common logarithm of the hydroxide ion concentration....

Word search 2023-09-28

40 Items: warmauntwifejulyfoursunnyhumidrainyfoggywindyunclenieceaprileightthreenephewfathermondayautumnspringaugusttwelveeleventwentyfamilybrotherhusbandtuesdayjanuaryoctoberfifteenfreezingthursdaysaturdayfebruarydecemberthirteenfourteenwednesdayseptember

Sarah and Tyson 2024-05-03

43 Items: lovejunevowssuitloveringjulysarahtysonpiperbridegroomdressdanceyoubouremmenfamilykitimatweddingbouquetstevensflowerstequilakitimatromancefriendsforevermarriagetogethermarriagesteenbucknashvillegreatdanehoneymoonhappinessengagementcumberlandcelebrationkendalavenueclingmansdomelaketownranchcampbellriverhighschoolsweethearts

Rosalind's Word Search 2025-01-16

38 Items: NoTeaDogBeefJulyBlackBibleHawaiiGreensWinterDooneyMorningChickenReadingSaturdayFootballBenihanaRed.DoorCallalilyChristmasChocolateMargaritaTelevisionMade-A-WayWatermelonPerry.MasonBig.TroubleThe.JetsonsLife-SaversSweet.PotatoMary.J.BligeDecaf.CoffeeCicely.TysonEddie.MurphyBlack.PantherSugar.CookiesKirk.FranklinDenzel.Washington

Nervous System 2025-05-15

40 Items: ViaDietJulyBrainOrganItalyFocalPaviaNervesSportsSeizureMachineBalanceJanuaryEpilepsyMessagesMedicineDiscoveryNerveCellsBodySystemSpinalCordEnviromentElectricalTreatmentsNobelPrizeHomeostasisInformationPathologistInvoluntaryGeneralizedCamilloGolgiNerveNetworkBrainSurgeryCoordinationNeuroscienceWorktogetherNervousSystemCommunicationSilverNitrate...

Stars Word Search 2025-06-23

30 Items: USASamBellFlagDrumStarsEagleFloatBatonFourthStatueIslandBannerLibertyFreedomFathersBuntingTrumpetUniformFranklinMarchingSpangledFireworksJeffersonWhite BlueWashingtonFirecrackerCelebrationConstitutionIndependence

Zero Word Search 2025-09-22

40 Items: sixmaypensayzerofivejulypinkblueopenworkthreesevenfortyfiftyblackwhitebrownrulerwriteclosecheckthirtyaugustsummerwinterspringautumnyellowmarkerpencileraserlistenfifteenhundreddecemberseptembersharpenercalculatorhighlighter

Key Words Review 2025-12-09

40 Items: dayMaydadmomhotweekyearJuneJulycoldhellomonthMarchAprilsunnywindySundayMondayFridayAugustfamilysistercloudygoodbyeTuesdayJanuaryOctoberbrotherweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptembergrandfathergrandmother

GAME FOR FUN 2026-03-06

40 Items: SNPFoxDogCatMayLionBearWolfJuneJulyTigerZebraPandaEagleHorseMarchAprilParrotRabbitAugustMondayFridaySundayGiraffeDolphinRaccoonJanuaryOctoberTuesdayElephantKangarooSquirrelFebruaryNovemberDecemberThursdaySaturdayAlligatorSeptemberWednesday

Days of the Week and Months of the Year 2026-04-21

24 Items: MayJuneJulyMarchAprilMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptemberI was born .... 2010.I will travel .... June.I have a quiz .... 27 May.I will go to McDonald's .... Monday.I have an online class .... 6:00 pm.

Summer 2026-04-29

40 Items: hatsunjunejulypoolbeachtowelmusicsleepgamessummertravelshortstennissandalshangoutfishingfriendsvacationbaseballsoftballicecreamswimmingcrawfishtanktopsfootballfloatiescookoutsumbrellaswimsuitsflipflopssleepoverroadtripssuntanningsunglassesrelaxationgatheringsvolleyballbasketballwatermelon

CANADA DAY 2026-06-26

40 Items: RedJoyJulyFlagLakeMapleWhiteMusicProudUnityCanadaNationParadePicnicFamilySummerNatureForestOttawaSpiritHolidayFreedomCountryFriendsCultureHistoryCampingCapitalCitizenCanadianFestivalMountainWildlifeCanadaDayMapleLeafFireworksTraditionAdventureCelebrateCelebration

Excellence 2025-08-26

20 Items: Never giving upProcess of improvingTreating others wellAchievement of a goalCreating something newAlways aim for the bestImportance of somethingConcentrate on one thingClear idea of the futureHard work towards a goalGuiding others to achieveStrong commitment to workReason for doing somethingWorking together as a groupSelf-control and consistency...

UNIT VII 2026-04-26

40 Items: WarSDSHUACIraqPlanNSC68UnionReaganSuburbsIdeologyof 1980.InternetSun BeltDoctrineMilitaryMovementsMovementsRed ScareAfghanistanContainmentand VietnamCoexistenceInnovationsand LiberalsConservativesMissile CrisesLuther King JrIndian Movementof the Cold WarEast – Cold WarFarewell AddressAmerican MovementsRights Act of 1964Christian Churches...

Antibody Word Search 2026-02-28

12 Items: f 2 types of light chains present in ~2/3 of immunoglobulinsf 2 types of light chains present in ~1/3 of immunoglobulinsOne of the polypeptide units that makes up and immunoglobulin moleculeGlycoprotein that links immunoglobulin monomers together – only found in IgM and IgA...

Molecule Word Search 2023-01-10

13 Items: general makeuphow something is arrangedthe sum of all living matter on Earthis made up of many different kinds of atoms and moleculessubstances that cannot be separated into simpler substancessubstances formed when two or more elements are chemically joinedthe layer of gas surrounding a planet that is held in place by gravity...

Unit 2 Vocab Review 2024-10-29

13 Items: The study of God and religious beliefs.A Greek word meaning "assembly" or "church."A system of beliefs and practices about the divine.A personal connection to the divine or higher purpose.Someone who follows Jesus and adheres to his teachings.A Hebrew word for the assembly or congregation of Israel....

THE BLOOD 2024-04-04

24 Items: ELSEloveWINEjesusBLOODWHOLEsavedcrossgloryLIVEStruthenoughchristOF GODCHAINSfreedomvictoryhealingsurrendercrucifiedhallelujahforgivenessresurrectionOF SUFFERING

Branches of Government Wordsearch 2024-12-18

22 Items: VetoBillsHouseSenateBranchOrdersPolicySpeakerCabinetCongressMajorityMinorityLawmakingCommitteePresidentPresidentFilibusterImpeachmentof the UnionBranch (Congress):of RepresentativesCommander-in-Chief

Mock Trial 2025-11-10

29 Items: JuryJuryjurorCourtIssueJudgeFelonycorpusMotionCounselprocessHearsayVerdictWitnessof proofof courtreporterevidenceMistrialAcquittalDefendantPlaintiffProsecuteTestimonyAdmissibleConvictionIndictmentMisdemeanorinstructions

The Basal Ganglia & The Cerebellum 2025-11-22

20 Items: Unclear, slurred, poorly articulated speechLack of coordination during voluntary movement of the limbsA lack of motor coordination that impacts one's ability to walkInability to rapidly alternate movements due to cerebellar damageAn involuntary movement causing the eyes to rapidly move back and forth...

Geometry Vocabualry 2026-04-20

25 Items: In the same line.Collinear Not in the same line.Having the same size and shape.A statement that has been proven.To divide into two congruent parts.Segment A line with two distinct endpointsLines Lines that intersect a 90 degree angleThe common endpoint of the sides of the angle.A statement that is accepted as true without proof....

MITOSIS WORD SEARCH 2025-04-29

17 Items: the stage before mitosisthese pull chromatids apartnew nuclei form around chromosomeschromosomes line up at the equatorcytoplasm divides into two new cellsorganelle which has cell chromosomescell containing one set of chromosomeschromosomes are pulled to opposite polesa cell containing two sets of chromosomes...

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...