4th of july Word Searches

Askiathegreat Word Search 2024-10-04

24 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Education in Zion Gallery 2025-06-04

15 Items: One of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsEducation in ______ GalleryThe first permanent principal of Brigham Young Academy“If any of you lack wisdom, let him _____ of God” (James 1:5)The first temple built by the Church of Jesus Christ of Latter-day Saints...

Chapter 7 Econ 2025-03-13

19 Items: Market structure characterized by a single producerGroup of firms producing similar or identical productsIllegal agreement by firms to charge a uniform price for a productPhilosphy that government should not interfere with business activityReal or imagined differences between competing products in the same industry...

math wordsearch 2022-11-30

31 Items: oddeveneventmarkupinverseoutcomedivisionmarkdownsubtractadditionfractionsinferenceprincipalpopulationproportioncross-sectioninterest-ratepercent-erroradjacent-anglescomplex-fractioncomposite-figurepercent-equationinvalid-inferencepercent-of-changeindependent-eventsisolate-a-variablecomparative-inferenceexperimental-probability...

Chapter 3 Vocabulary 2023-10-19

41 Items: Earth's outer layer _____________Earth's thinnest layer______________Earth's innermost layer______________layer beneath the crust __________________when magma reaches the surface _____________layer above the troposphere _____________________water vapor forms water droplets on dust particlesLayer beneath the lithosphere ____________________...

Kingdom Hearts 2024-09-13

32 Items: PumpkinFinny FunNot ChewyThe GAMESSky FriendUnion LuxuTerra AnsemJunior HeroThe Mage DuckRumbly TumblyKing of DisneyHold on to youfooling myselfWisdom in ZeroNot the planetFull of Strifethe other JackMaster by sleepEarths DarknessMaster of MagicWith an I, no XAnsem with an XThe Loyal ShieldCloud's DarknessHeartless MemoryThe Others Nobody...

Happy Anniversary! 2025-05-04

38 Items: BABECRABDORKHOMEJUNEJULYKINDLOVESNUGWARMBABOOHONEYSILLYKISSESLOVINGDEARESTMYHEARTSINCEREAXOLOTLSBESTHUGSCREATIVECUTIEPIEPENGUINSROMANTICSWEETESTBEAUTIFULCRISPYFRYFANTASTICHEDGEHOGSBESTFRIENDDELIGHTFULDESERTROSESNUGASHARKANNIVERSARYDAVEDREAMERMANICMOGWAILOVEOFMYLIFEPLENTYOFFISH

Lesson 2 2025-06-27

38 Items: MayverywellsongsuremoveJuneJulysmilevoiceteachpiecespaceunclespeakMarchAprilfirstthirdtenthsingerpleasecannotAugustsecondpopularforwardChineseJanuarypowerfulfavoritelanguageFebruaryNovemberDecemberSeptemberskateboardfirefighter

Musical Genres 2024-03-11

15 Items: suiiimade for moviesA sub-genre of piepopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombiamusic made with digital instruments...

Absolutism 2025-03-25

12 Items: of lawarmadahereticcapitalrepubliccrucifixinflationAbsolutismLegitimatedisciplinepresumptiveright of kings

Nature 2024-10-29

10 Items: a natural wide flow of fresh watera raised part of the earth's surfacethe small, soft, white pieces of icean area of land, used for growing cropsa large area of water surrounded by landa high area of rock with a very steep sidea piece of land completely surrounded by waterwater, dropping from a higher to a lower point...

Flowers Word Search 2024-05-13

23 Items: MANdancakekissvowsloveYORKringsdresskirrenflowersbramblesiewertforeverceremonyOF HONORpetersoncoloradogroomsmenbridesmaidsOF THE GODSphotographerHICKORY HILL

Plantation Word Search 2023-09-26

21 Items: -petite gulf cotton seedtype of evil for slaverylarge agricultural estateMS outlawed all blacks from ittype of slave who worked indoorsto act against inhumane treatmentMS institution established in 1844type of slave who labored outdoorstwo causes were slavery and tariffswithdraw to protect MS's state's rightsMS prohibited free black people from it...

Electrical Circuits 2025-04-21

15 Items: unit of powera part of an elementthe opposition to flowone path in a circuitbomultiple paths in a circuitbase unit of an electrical unitboth series and parallel circuitsomething that can deliver energyallows electrical current to flowa circuit with a break in the pathhow hard it is for electricity to flowthe flow of electricity in one direction...

Korach 2025-06-22

15 Items: Israel’s 1st King.His staff produced almonds.The prophet of the Haftarah?Korach means ___ ______ ______.The main character of Portion Korach?“He who guards his _______ preserves life.”“The ________ has power over life and death.”Israel’s first King was from the tribe of _________.The 250 men offering incense were consumed by ______....

Word Search - Elijah Smith 2023-09-13

31 Items: Moving airair that surrounds Earthtoo much water in one placeThe distance above sea levelHow hot or cold something isthe current outdoor conditionswater found in lakes and glaciersbuilding up of something overtimeInformation that has been collectedThe amount of water vapor in the airthe continuous flow of water on earth...

vocabulary 2023-10-05

27 Items: an ancestorlead by, guided(of a place) without inhabitantsan airplane with one set of wingscontaining or using only one colornext to or adjoining something elselikely to be the case or to happen.relating to or resulting from motionoperated by or equipped with machinesliving the life of a nomad; wanderingmeter used to determine the altitude attained...

Askiathegreat Word Search 2024-10-04

29 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from Alexandriaspans much of southernAfricathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

Key Word Review 2025-12-09

38 Items: dayMaydadmomhotweekyearJuneJulycoldmonthMarchAprilsunnywindySundayMondayFridayAugustfamilysistercloudyTuesdayJanuaryOctoberbrotherweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptembergrandfathergrandmother

WEATHER 2025-05-17

18 Items: kõuMaivälktalvsügisuduneJuuniJuuliMärtskevadAprillluminepilvinetormineuduvihmVeebruarpäikselinekeeristorm

B&N 2024-07-31

21 Items: Brides first jobBrides occupationBrides birthstoneGrooms middle nameGrooms birth monthName of Grooms gymNumber of bridesmaidsGrooms favorite drinkState the Bride is fromBrides favorite holidayGrooms major in collegeCouples favorite concertName of Brides oldest nieceBride is the queen of theseNumber of tattoos Groom hasVenue of couples first concert...

Daniela and Adam 2024-12-11

24 Items: - Wedding Hotel- Grooms BestMan- Maid of Honour- Name of the Bride- Name of the Groom- Name of their son- Location of Church- Town they live in.- Bride's maiden name- What is in the air?- School Adam attended- Name of their Daughter- First holiday together- The Couples new Surname- School Daniela attended- Favourite Football team...

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

KPOP DEMON HUNTERS 2025-08-20

15 Items: The tigerThe magpieHuntr/x's managerHuntr/x's best songSaja Boys' best songMain dancer of Huntr/xLeader of the Saja BoysRuler of the demon realmThe lead vocalist of Huntr/xSaja Boy who wears a yellow beanieSaja Boy whose hair covers his faceThe "maknae" (youngest member) of Huntr/xSaja Boy whose hair is shaped like a heart...

IDEO: idea 2025-11-10

16 Items: ideoIdeaideogramideologyideogenyof ideasideologueideocracyideosphereideophobiaor mistrust of ideasruled strictly by an ideology or set of principlessystem of ideas and ideals, especially in economics or politicsarea where ideas are thought to be created and grown, intellectual space...

Sixth Year -Week 3 2024-11-05

15 Items: Filth; miseryTo live in or onAn area of land; a regionNot the same; unmistakableA place of safety or shelterHard or impossible to believeA great amount; more than enoughOf or relating to the countrysideVery dry; having little to no rainfallMagnificence; brilliance of appearanceHaving a large amount of moisture in the air...

Islam Word Seach 2025-05-15

15 Items: The holy book of IslamThe Arabic word for God.the last prophet sent by GodA cube-shaped building in MeccaA place of worship for Muslims.The Islamic declaration of faithAn annual Islamic pilgrimage to MeccaThe migration of the Prophet MuhammadAn obligatory act of charity in IslamAn Arabic word that literally means "veil"...

Monday's not coming by Tiffany D. Jackson 2024-11-29

16 Items: Name of the highschool?What happened to Monday?Name of Monday's sister?Name of Claudia's church?What sound haunted Claudia?What is Monday's moms name?Name of the housing complex?What is Claudia's dads name?Monday's favorite color was?Name of Claudia's boyfriend?Where did everyone think Monday went?What color was the house they spent time in?...

Criterion Challenge 2025 2025-04-10

52 Items: ThiefGummoCrumbVampyrStalkerDaisiesRoboCopTampopoRepo-ManNashvilleChoose-MeHappinessThe-BeastLa-StradaLa-CienagaFunny-GamesCitizen-KaneSafety-Last!Paris,-TexasPerfect-DaysTaipei-StoryThe-Third-ManPink-FlamingosHeart-Of-A-DogPan's-LabyrinthAce-In-The-HoleThe-CelebrationThe-Burmese-HarpFantastic-PlanetDouble-IndemnityPunch-Drunk-Love...

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

human development 2025-09-04

20 Items: : Connected to feelings and mood: The life stage before adolescence: One's sense of self or who they are: The acquisition of knowledge or skills: The process of becoming fully developed: Physical increase in size or development: Key developmental achievements or stages: The stage of maturity or full development...

TpT Email 2022-07-30

13 Items: judaismbradburystarwarsRelating to the Middle Ages.The "end times" in Norse mythology.The primary religion of people from India.The last of the Ptolemaic leaders in Egypt.Short story from the perspective of Lady Capulet.His assassination sparked the beginning of The Great War.Approximately one-third of the SAT and ACT are based on this....

May words 2022-06-06

33 Items: Of or pertaining to a year.The using up of a resource.Stick fast to a surface or substance.In spite of the fact that; even though.Craving or consuming large quantities of food.Rigorously binding or exacting; strict; severe:A union or association formed for mutual benefit.A group or system of interconnected people or things....

4th grade vocabulary 2021-01-29

10 Items: eatknitwearringplaywantenjoytravelborrowpractice

social studies vocabulary 2022-06-14

14 Items: jurycivilgroupenlistof lawappealvaluesdonatedemandsupplyinquiryof rightsconventionpoint cabinet

CNA Lesson 17 Review 2023-01-22

15 Items: walkingturning upwardturning a jointturning downwardbending backwardbending a body part or jointstraightening of a body part or jointmovement of a limb toward the midline of the bodymovement of a limb away from the midline of the bodydevice used to maintain a body part in a fixed positionpermanent stiffening of a joint or muscle caused by atrophy...

Zoren 2025-12-09

15 Items: Zoren's assumed RaceAsuang and Zoren are this creatureZoren Claims to be this professionZoren is trying to capture this personThe name of the village Zoren is targetingThe time of day Naesala is associated withThe name of the village healer Zoren killedWhat the villagers of Thistlepine Hollow needThe group of elves Solarian's made amends with...

Volleyball 2025-03-24

12 Items: total points in a gamemost popular type of servename a type of forearm passhow a ball is put into playhow tall the top of the net isit's in the middle of the courtfast offensive hit to a specific spotChief official of the volleyball gamenumber of players on the volleyball teamDefensive technique for stopping a spike...

Common Diseases 2025-12-11

20 Items: The study of the causes of disease is called?This disease is transmitted through flea biteJoint inflammation that can be acute or chronic.Evaluating tissues with a microscope is termed is called?Causative organism family of this disease is Rhabdovirus.Causative organism family of this disease is Giardia Lambia....

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

High Holy Days 5785! 2024-09-20

15 Items: 'All Vows'Days of ___Day of AtonementGreat with applesHoly, Holy, Holy!Ten Days of ______.Literally 'Good day'Last month of the year'Return' or 'Repentance'Yiddish Holiday GreetingFirst month of the New YearHorn used during High Holy DaysFruit, said to have as many seeds as there are mitzvot.Blessing recited when doing something for the first time...

jogos 2025-04-15

19 Items: GTAfnfFifaMarioSonicZeldarobloxPac-ManFortniteMega-MenminecraftFree-firebear-alphaGod-of-Warbrawl-starsDonkey-KongCall-of-dutynicos-nextbotsStreet-Fighter

Word Search 2 2024-10-18

16 Items: Pleural membrane attached to the lungs.The only elastic cartilage of the larynx.One of the paired cartilages in the larynxprevents food from getting into the airways.Pleural membrane attached to the thoracic wall.The part of the respiratory system above the larynx.The part of the respiratory system below the larynx....

Wedding 2025-02-09

14 Items: doManLoveVowsWifeKissBrideGroomDanceHusbandof HonorBridesmaidsof the Brideof the Bride

7th Grade Review 2024-05-07

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The acronym for the 4 areas of child development.A kitchen tool used to flip pancakes or turn hamburgers.A kitchen tool used to beat eggs and add air to mixtures.The type of stitch we used for our final sewing projects.The type of project we did where you chose what you would cook....

Development Grade 11 Geography 2025-07-11

23 Items: Goods sold by one country to another.Regulations or policies that restrict trade.Goods bought by a country from another country.Financial summary of all payments made by a country.Refers to the carrying and moving of goods across the globe.Countries which are also referred to as 'countries of the south'....

Hospice Word Search 2025-08-03

28 Items: – The expected outcome or course of a disease.– Accurate recording of patient care and clinical decisions.– The process of evaluating a patient’s needs and condition.– A federal insurance program that often covers hospice care.– The act of directing a patient to hospice or other services....

Dove Holiday Word Search 2023-12-04

10 Items: Jewish New YearHindu festival of lightsHindu festival of colorsCelebrating the birth of Jesus ChristA day honoring Buddha's enlightenmentMexican holiday reuniting the living deadA holy, month-long observance for MuslimsCelebrating the resurrection of Jesus ChristCelebration of African-American culture held in December...

Enjoy Shorty 2025-05-26

15 Items: A citrusCapital of OmanTo be or not to beOne of the Jackson 5Largest Greek islandThe national flower of FranceSomething you no longer get at meetingsWhat is the national animal of Scotland?What is the world's most expensive spice?What color is the skin of an adult polar bear?What is the main ingredient of a Greek tzatziki?...

Famous Word Search 2025-10-26

16 Items: personauthortouringmonumentitineraryoutstandingtravel by cartravel by planeit is 342 m highopposite of arrivedopposite of was bornPast simple of buildopposite of equalitywas born in stratfordtravel by ship or boatfamous landmark in London

Kim's Word Search 2025-03-12

15 Items: CampYorkBearsGolferGivingHawaiiLovingSpunkySkiingof fourHostessPiedmontShoppingFargo Bankof Southern California

Pulmonary Genetics 2025-04-01

15 Items: feature of 50% of PCD casesskin findings of Birt Hogg Dubefeature seen in 30% of AFAB with TSCcondition caused by TERT, TERC, DKC1gold standard of cystic fibrosis testinginjury or inflammation to the alveolar spaceoculocutaneous albinism, Puerto Rican founder mutationsymptoms include high pressure in arteries of the lungs...

4th Grade Word Search 2024-08-16

14 Items: JuanRyanMaylaClaraMsTseMatiasAudreyReillyMikalyaGabrielMsOlanoMsGarzaNicholasMsKyriazis

Tatum Lucero 2024-05-16

15 Items: The starting pointThe total distance movedThe process of changing directionAtoms of two or more elements combinedSubstance made up of atoms with the same identityThe difference between the starting and final positionan objects distance and direction from a reference pointMixture in which two or more substances uniformly spread out...

Deaf Appreciation Month Word Search 2025-03-11

15 Items: Not completely deafDeaf Awareness MonthTo have loss of hearingA device that can help people hearA famous deaf inventor and businessmanThe last name of the inventor or hearing aidsA famous deaf disability rights activist and an authorThe past of deaf or hard of hearing people and cultureA famous deaf composer and pianist in the 1700s and the 1800s...

John Word Search 2025-02-21

7 Items: Servicein Junein JulyHistoryColtraneSaxophonerights movement

July 2025 Chewy Pharmacy Word Search 2025-07-18

15 Items: NeomycinLactuloseAlbuterolCidofovirSelamectinFurosemideColchicineMethimazoleMirtazapineAmoxicillinVoriconazoleGriseofulvinThiabendazoleDexamethasoneCyanocobalamin

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

Algebra 1 Unit 1 Vocabulary 2025-09-25

17 Items: Q3-Q1. Measures variability in dataMedian of the first half of the dataMedian of the second half of the dataconsists of the minimum, the three quartiles, and the maximum.Average. Add up the data points and divide by total number of data pointsMiddle value. Put data in order from least to greatest to find the middle...

MNP Word Search 2023-05-30

20 Items: She offers protection from rabies.These are usually found flanking the goddess.This deity is placed on the top arch of the Mata’s temple.The Chitara family come from the _____ taluka of Ahmedabad.This is the symbol of the sun which controls day and night.She is symbolized only by a fly whisk made of peacock feathers....

Intro to Botany 2025-02-04

29 Items: scientist that study plantsa plant having one cotyledona plant having two cotyledonplants do this to conserve waterouter layer of tissue in a plantspace on a stem between two nodesgrowth that increases plants widththin stalk that attaches the blade to the stemsecond set of leaves that appear after germination...

Which word in the puzzle is one of the seven plagues of Egypt 2025-03-20

10 Items: licehailbloodfrogsfliesboilslocustsdarknessof livestockof firstborn

Trigonometry Identities 2025-05-07

21 Items: a² + b² = c²Reciprocal of sineReciprocal of cosineReciprocal of tangentBest pre calc teacherOpposite over adjacentStudy of triangle mathSpace between two linesGreek letter for anglesAdjacent over hypotenuseSays two things are equalMath rule or relationshipFlipped version of a valueFunction where f(–x) = f(x)True equation for all values...

Macbeth 2024-10-30

10 Items: his heirs will be kingthe author of the playthe protagonist of the playmanipulates Macbeth with magiccomes up with the plan to kill Duncanthe son of Duncan who flees to Englandthe son of Duncan who flees to Irelandthe only person Macbeth should beware ofthe king of Scotland at the beginning of the play...

Global I Review 2024-01-09

30 Items: Be goodBe chillBe good or elsePlebeians and...The first civilizationThe Islamic code of conductChristianity, Judaism, IslamThe Greek word for city-stateThe dynasty started by Liu BangA city-state that rivaled AthensAncient Mesoamerican civilizationCapital of the Eastern Roman EmpireHinduism, ancient Egypt, Rome, Greece...

Plate Tectonics Wordsearch 2023-02-15

14 Items: The outer layer of the EarthWhen one plate slips below anotherThis continents are in constant ___When this rises and cools, it creates new crustWhen plates push up, it creates this kind of landformType of heat transfer that causes tectonic plates to moveLast name of the scientist who proposed continental drift...

4th Grade Vocabulary Words 2022-02-10

14 Items: defyvasteagertauntbrutalcomplexdeclineparchedrivalrycollapseshortagebountifulnegotiateboisterous

Mrs. White's 4th grade class 2023-05-18

30 Items: k12tallmathlsoadogscatsshortsmartfunnyhappystaarfifthfriendsummerkahootgimkitfourthmoviesonlinecameraenglishscienceblooketexcitinglearningsunshinecomputerswimmingsocialstudiesiwillmissyousomuch

Coming Distractions- Lesson 7 (4th) 2023-10-01

20 Items: puttoolwoolbushhookroofsoupbloomstoolproofprovegroupbrookboothgroomshampoofoolishcrookedraccooncookbook

lesson 20- Sacagawea (4th Grade) 2024-01-19

20 Items: lumberpepperborrowthirtyattendcanyondangersoccerengineseldomeffortmillioncollectplasticsupportperfecttrafficfortunepicturesurvive

4th Grade L8 Spelling Words 2024-02-06

20 Items: preyonioncableankleslowlysquashcarrotjunglepuzzledimplelettucespinachcrumblefreckleknucklehabitatimitatesprinklepredatorcamouflage

L1 Word Search - 4th Grade 2024-06-17

20 Items: oxenspeedcatchrolledfingerexceptelevenitselfstolenbuttonorphanbargaincertainopinioncompassequatorcouldn'tlatitudeabsolutelongitude

L12 Word Search - 4th Grade 2024-07-07

20 Items: goalslidecoachshownblownbrassswingsbecameviolinpasturelecturemixturemoisturepunctureadventuresculptureconductorliteraturepercussioninstruments

Mrs. Winston's Fantastic 4th Graders 2024-08-07

21 Items: LucaJackWillCadeAsherBellaCalebTitusParkerTenleeCollinHannahKenzieHarperGraysonBradleyJacksonNeylandWilliamSavannaCaroline

Mrs. Welch's 4th Grade Class 2024-08-09

28 Items: IsaRyanDejaFinnJannaMicahFelixKensiTavinBryceSarahRyderChloeEmeryHarlowAlisonHunterPeytonKhylanGabrielKinsleePrestonJasreenCharlieAnnaliseBenjaminEmilianaCharliegh

Mr. Daniel's 4th Grade Class 2024-08-11

28 Items: LilyKaliKobyBryceRileyPeytonMeliahJustinJasiahSheilyColterMorganDallasJaydenTaylorZacheusCedrickJasmineJohonnaCameronBhushanRichardCharisseMarcelloChristianBenny-RayElizabethSebastian

Ms. Wylie's 4th Grade Class 2024-08-12

24 Items: GiaJaceLucyDemiLucaAriaCaliJaxonLoganWylieArooshElijahLandonLandryEverlyNathanDraganCatelynMagathiBraydenVictoriaHridhaanPriyankaVaishnavi

Miss Donsbough's 4th Grade Class 2024-08-12

26 Items: IvyLeoLiamWillLeviRoseKateCoraGrayEthanElenaEllieAminaCarsonConnorJosephLawsonMilanaSophiaDeniseMakenaSophieKennedyKendallDanieleFletcher

Our 4th Grade Class Family 2024-08-20

33 Items: MiaJackOonaAlexAriaLillyJamesJesseMasonDylanEthanColinSioneOliviaAadenBOliverPhilipAidenDGeorgeAshtonAidenLAndrewZacharyAudrinaElliottJoaquinCassidySavannahGraziellaAlejandroSebastianBSebastianSAlessandra

Day 1 in 4th grade 2024-08-23

30 Items: BellExpoTeelChairTimerVinylMusicRecessPencilmarkerEraserLeaderTeacherStudentCrayonsTimbersBackpackScissorsLunchbagPaintingMarinersClassroomGluestickCafeteriaHaverkostplaygroundHighlighterSaintHelensFourthGradeRecordPlayer

Mrs. Lackas' Awesome 4th Graders! 2024-08-30

25 Items: CJAyahOwenElanWillLiamSurajMaddyLucasArnavOscarJuliaMicahHenrySamiraSophieAyeshaBrooksElianaSophiaShravyaMariamaDivyanshMichelleGabriella

Mrs. Kerber's 4th Grade Class 2024-08-31

23 Items: EmmaJadaSageBethTylerCalebJaxonParkerHarperDanielDakotaKalynnHunterAdalynAislynJosephCalvinJamisonYulianaBrilynnKennedySullivanNickolas

4th Grade Spelling Bee Words 2024-11-14

50 Items: murkyquillpatiowagonsmocktingedodgymotionterrorbraidscastlewrenchindeedstifledimpleharboruproarseveresuperbgrovesharvestcostumegerbilsvillagebrothermistakereunionballoonpromiseexactlytwinklesnickerstumblenaturalbanditsoutcomeghostlybiologycaptivejumblednaughtycrittersnonsensechampionconvincespeckledWednesdaychildhoodstreamershopscotch

Who's who in 4th grade! 2025-01-14

52 Items: beejohnwillwolfalexemmaarlojunelolanaomijosietrippcourthelencalebrowansimongracepippaalicebryanrykerelliekrebssesinameliewintonmatteobrookszakzakdrukmodeclancamdendaphnemorgantruittmurraywilderisabelhuntermillerconnorwilsonkeelercoopermaxwellfrancesbarclaywilliamwaverleymeredithmontgomery

4th grade Vocabulary Unit 7 2025-03-08

25 Items: damflowpipepondwellhosepumpdrainflushplantbanksfloodhumidvaporsteamfaucetbucketcanalsdroughtirrigatebacteriareservoirpracticalrespectedadvertising

1st and 4th Grade Leaders 2025-03-19

45 Items: MiaIanRushEvanKingAbbyEllaRyanMicahAbnelKarliTarynJasonZakaiCohenTy'ellRichieBrycenJaydenAhnestJustinLawsonJaydenSawyerChanyaThomasJordanJalaehKanylaElijahRaelynnNataleeJa'SiahCamilleErlindaTristanAddisonMadisonOpheliaJanelleMarceloPenelopeCharlestynChristopherChristopher

4th Grade Year 2024-2025 2025-06-02

24 Items: LeoAlmaalanHazelNaomiDanaeJosueDanielMailenBraianMoisesGothamCamilamanuelIsraelJulianHNatalieJulianRAnthonyGianninaJenniferIsabellaVictoriaMrsSolorio

Spelling List #4 - 4th Grade 2025-06-10

20 Items: diecryslyshyspymindpiessighkitefilewipelinetimeclimbpridealiketwiceflightinsideminding

Spelling List #5 - 4th Grade 2025-06-10

20 Items: owntowwoeboltmostmoldflowknowmowsmolesolewokegoalfoamlowerstonestovechosestolegroan

4th/5th Explorer Club Kids 2025-06-26

68 Items: ZoeKruMiaGwenGabeEzraSnowEmmaIzzyAddyTamiBevaEllaEvanLeviLilyMaxxOwenBeauJacobAidenMeeyaAveryAidynRowanNolanSullyEthanHenrySilasFionaOzzieWillaAkselAidenAsherJennyLandonDakotaEastonIsayahCarterCaydenSophiaParkerAmeliaBrennaOliverLilithHaydenTybaltJulianHarperKillianCadenceCharleyMerrittEverettTristanBrixtenScarlettFletcherHumphreyVivienneBrooklyn...

Mrs. Kelly's 4th Grade Class 2025-07-31

29 Items: CodyIslaRubyKnoxAryaAryaMylesRileyTeddyAidenClaraFritzKrishCalebBrookeNithyaEmiliaJoshuaOtavioThomasJohnnyRaphaelEleanorNicolasAbigailEllisonAngelinaChidubemMaximiliano

Ms. Range's 4th Grade Class 2025-08-01

28 Items: AvaEmmaJudeIvanNoraMarcoMateoAaribDarshDalisJasonEthanMosesJadenAditiJameyAaronMateoSophiaSummerBaileeVictorAnthonyBraydenRanveerDanielleRayshaunChibuikem

Mrs. Ruiz's 4th Grade Class 2025-08-05

29 Items: MiaEliArloAriaKadynMateoAidenAveryJacobRyderSophiaCamilaKiyomiJosiahXimenaSawyerOliviaJaidenJaimeeSergioAudrinaVicenteCeciliaFrankieRobertoDurrellGianlucaEmilianoAlessandra

Mrs. Morse's 4th Grade Class 2025-08-05

24 Items: AbeKaseNoriLukeOwenEdonLaneCaseRiverKaleyRykerPaytenSuttonTenleyArcherGracenEverlyKayleeHudsonKaylynnDeseraeArieanaAdrieanaBrinsley

Miss Spano's 4th Grade Class! 2025-08-05

21 Items: IvyAxlRubyAnnaPabloLaynaLennySammyEllieTylerVioletSaniyaPorterKaidenLilyanaDelVyonDanielaIsabellaBrooklynEmariousMarlaysia

Mrs. Libby's 4th Grade Class 2025-08-06

30 Items: AvaMiaAnnaWadeDylanChrisRonjaChaseLenoxLibbyColtonKinleyAudreyColtonTaylorConnorAutumnHudsonElyjahCarterAnsleyRaelynnMarissaRaelynnJacksonPheonixBentleeStraneyMichelleMakayala

Mrs. Wellman's 4th Grade Class! 2025-08-06

34 Items: EveAvaLeviLiamJudyNoahDaneSkyeRyanWyattEthanDaisyWyattPoppyVinnySimonWilderBaylorPorterLandonHaileyGiannaAdrianGiannaLexxsiJustusGraysonArielleBlakelyLynetteMadelynnHarrisonJulietteValentina

Ms. Hernandez's AMAZING 4th Graders!!! 2025-08-08

30 Items: LuaIvyTatiJoseIvanEmmaKyeaDaisyDavidKenanJamieJemmaYerikJorgeAndreaIsmaelJosiahAdrianShailaAviannaLarissaKillianGenesisVanessaIsabelleSterlingMuhammadArJonnaeFernandoSabastian