4th of july Word Searches

My 4th Grade Family 2025-08-29

24 Items: JoeEliEvanTheoLeiaGabiLilyEmmaNoahJoelKensiAydinMariaDanielHunterMeadowCorbanOliverMelsanaRichardJenesisRehobothJulianneJosephine

Welcome to 4th Grade! 2025-08-29

30 Items: HANSEWANNORAKATELIAMJEDDRYANREYAAXELFINNAFINNBHAZELWYATTEIVINROWANHARLOWSKYLARMISCHALESLIENORMANATHENAHARPERGEORGEANDERSKARSTENMARGAUXPATRICKMADISONCYNTHIACAROLINE

Welcome to 4th Grade! 2025-09-02

30 Items: MYAJORIMILAZANEJACEAVERYJAKOBTYSONJAMESMAYESHAYDADAWSONJORDANAILANICORBINMARLEYAVALYNMELCHIHOMIRASHYLIAHSAMIYAHJENNICAADALYNNCALEIGHPARNEETLILLIANMITCHELLJEREMIAHJEREMIAHBRODERICK

My 4th Grade Class 2025-09-03

21 Items: JaxIanZoeLiamAbelNoahPaulLeahEliasDavidCalebAveryWyattJordanKaylinGloriaWilliamMilaniaVirginiaJuliannaAlessandra

Our 4th grade class 2025-09-05

23 Items: AvaHenryElenaDylanLewisNeronMikeyMateoCaliaMaliaLucasColtonJosiahArrsinMarcusMishelJemrianMalakaiEllisonReichesAusianaKatalenaCristopher

4th Grade Word Search 2025-09-25

22 Items: RJKataiLennyAngelMusabJosueRobertMontayYulizaAsmaulAliyahSayRehAlissonJuanitoBraydenMalcolmNurAmaniHarrisonNorkayasElizabethAnnaleciaMrsJohnston

List 9 - 4th Grade 2025-10-29

20 Items: toilproudroyaltowermoistmouthcrowdavoidouncesproutpowderoysteraccountservantimproveemployedsurroundappearedshoulderappointing

List 13 - 4th Grade 2025-11-06

20 Items: cycleceaseforcefleecerecitebracescitrusadvicesourcerecentceilingconcertglanceddecidedcypressticketssucceedsentencecancelingChristian

Literary Devices 4th Form 2025-11-11

29 Items: PunToneMoodIronyRhymeSimileSatireStanzaImageryParadoxMetaphorAllusionAllegoryOxymoronMetonymyEpiphanyHyperboleEuphemismFlashbackSymbolismSynecdocheRepetitionParallelismAlliterationOnomatopoeiaForeshadowingJuxtapositionPersonificationRhetoricalquestion

List 30 - 4th Grade 2025-11-11

20 Items: wagongivenlemonsirencottonchosengallonraisinburdencaptainpenguincertainbargaincurtainremovedmillionfountainmountaindiscoverymillennium

List 27 - 4th Grade 2025-11-11

20 Items: layervaporhumorlaborsolarmajormotorgloryerrorflavorauthordollarsilverdoctorpropernectarsymbolmirrortractorcalendar

List 31 - 4th Grade 2025-11-11

20 Items: oceansugarnationmotioncottonmissionstationactionssectioncautionsessionlocationvacationmountaindirectionsalvationattentionpermissiondiscussioninstruction

4th Grade Ms. Underwood 2026-01-30

20 Items: ArloLaneColeAnnaEllaSeanPiperRhettSadieTenleeCollinOliviaLandonClaireKeaghanKaliyahJeremiahNaKorianAubreannaAva-Marie

4th Grade 2025-26 2026-02-06

31 Items: MaeAviKaiLeviLilyBeckCadeIslaBearHenryEliseEmiahMasonPiperChloeAddieCalebAveryEthanNoelleBlytheDaiseyOliverTannerJacksonFrankieLincolnVirginiaJuandiegoSebastianAlessandra

4th Grade List 20 2026-02-10

30 Items: seizemarginNevadatriumphprevailcleanseapologyantiqueancientinjuredselflessresourceoriginalgenerousdistressbelievedreluctantsurrenderagreeableaffectionHampshiresurvivingobservingridiculoushistoricalcontradictcamouflagepersuasionimaginationpleasurable

4th Grade List 20? 2026-02-19

31 Items: seizemarginNevadacleanseantiqueinjuredapologyancientprevailtriumphgenerousselflessbelievedoriginaldistressresourceobservingaffectionsurvivingaffectionagreeablesurrenderreluctantridiculoushistoricalpersuasioncamouflagecontradictimaginationpleasurableNewHampshire

4th grade Word Search 2026-02-26

24 Items: RobKaliLucyNoahAlinaDiegoEdwinEthanAdrianAudreyAudreyDamianEvelynIsraelJoshuaSophiaDanielaEzekielGiselleLindsayAnnaleighaChristabelJennabellaMaximiliano

4TH PERIOD MATH CLASS 2026-03-06

23 Items: JUANSUSIOMARBRYANEMILYGIOVERDAMIANNEVAEHMELODYJULIANAVALERIEJULIANBJOCELYNMATTHEWABRAHAMBRANDONMICHAELALMAZANFERNANDOGRECHEALNICHOLASESMERALDACASTELLANOS

Lesson 13- 4th Grade 2026-04-08

20 Items: routappalldependdrearyimpactinvadeoccupyrevealterrortragicfanaticisolatesuspectdejectedinvasiontemporaryisolationfanaticaloccupationdependable

Miss Moon's 4th Grade 2026-04-23

20 Items: NoahKadeAlexDreyaLamyaAngelCasonTalynJacobAveryKimberAshlynZinniaLandonFRichardLandonBAynslieBraxtonMaddisonMissMoon

4th Grade 2025-2026 2026-05-11

29 Items: reyshohopeemmaafsajasedanaatikitylerahrardylankaleaamisiaslanaxcelmerontylenfidiaberthaoliviaaudreyrenatanaliyahdarrellraymondmariannelorrainejayveonachristian

4th Grade 2025-2026 2026-05-12

56 Items: EJMyaIanGwenColtLoraZoeyLukeEvieMarkRoryNoahGinaGabeAidenChloeRylanAidenRobynClarkRileyArielAddieCasonSaylorNevaehHenleyHarleeOliverMillieNorrisCannenHarperApolloZacharyEverleyJupiterBrysonSKennedyMckennaMalachiGraysonGreysonKameronWilliamAdleighGabrielEmmalynBrysonMAntonioMarcellaBrantleyMarianelaAnnaBelleEverleighBrayleigh

4th-5th Word Search 2026-05-19

30 Items: catdoghatsunballbearbirdboatbookcakeduckfishfroggamekitelionmoonstartreeapplepizzarobotsharktigertrainwhalezebraschoolwinterrainbow

2026 Reeves 4th Grade 2026-05-21

69 Items: EliIanSwarKobeDeanJuanEvanLilyRosePaulDarenZarahAmayaByronAleenLucasKhloeJayseExtonCraigDavonVaninLojainMaggieAubreyBrileyKailinSophiaAamiraBaileyThomasJaquezVictorSophiaVivianHudsonJosephSkylarBrytonKamdenRobertHunterIsaiahAdelynGarettAustinDeeganCaydenMarilynA'ZlynnBraydenWarrickLillianBrixtonAlbertoNikolaiMatthewJuniperHarmonyStarlahRebecca...

Our 4th Grade Class 2026-06-02

24 Items: AvaDeaEmmaMyraMilaLinhChaseLaylaAmiyaGustavAmeliaCalvinStellaElianaLennonLilliaElliotSidneyBennettDaShawnElliottMarianneKaminskiCarrington

Our 4th Grade Class 2026-06-04

22 Items: LVJadaEderAbelYahirJasonAlexaAngelaDarlynSorayaMiriamBrendaJulianGarciaIngridAllysonMelanieJenniferSamanthaElisarahiAlessandro

Math Vocabulary Word Search 2024-04-26

100 Items: rise over runa fixed numbera ratio out of 100a six sided figureeight-sided polygona five sided figureone output (y value)a three sided figurethe answer to a problemequal in value or amountthe perimeter of a circlea polygon with four sidesof, relating to statisticsthe slope of a vertical linethe top number of a fractiondistance a number is from zero...

September Word Search 2024-07-19

20 Items: Best man's nameCouple's dog nameGroom's middle nameMonth Marco proposedMaid of honor's nameMonth they first metThe Groom's hometownHoneymoon destinationColor of groom's eyesBride's birthday monthBride's college mascotCouple's favorite storeFirst vacation locationMother of the groom's nameMother of the bride's nameLocation of couple's first date...

Bird Words - ColorBird.org 2024-10-13

26 Items: What a bird flies with.A general word for a baby bird.What a bird pecks and eats with.A person who enjoys birdwatching.A sound that birds make (1 of 4).A sound that birds make (2 of 4).A sound that birds make (3 of 4).A sound that birds make (4 of 4).Birds flap their wings to do this.Some birds use these to grab prey....

North Word Search 2024-10-08

27 Items: Capital of FranceCurrency of ItalyHe discovered zeroPerfume city of IndiaThe cleanest city of IndiaThe Diamond City of GujaratThe longest river in the worldA brand with a tick mark symbolThe largest forest in the worldGates: The founder of MicrosoftThe religious book of ChristiansThe biggest devotee of Lord ShivaThe largest organ in a human body...

Gold Rush July Word Search 2024-07-05

15 Items: dancelevisholidaystadiumgoldrushbarbecuedirectorcaptainspracticefireworksrehearsalcrimppomsteammatesfortyninerscheerleader

Mary I 2025-10-22

17 Items: Mary's governessOne of Mary's godfathersMary died at this palaceMary was born in this monthFirst name of Mary's husbandMary is buried in this abbeyFirst name of Mary's father-in-lawHer first fiancé was this Dauphin of FranceMary's wedding took place in this cathedralThis Thomas rebelled against Mary in early 1554...

7th grade 4th block 2026-05-28

18 Items: liamlanecoralalgercokerowenslyamtinocojamescarverjulianclarkamilliadarrjacksongillbrysoneastersaviongloveroliveroakleydeandreonleychandlerpfaffchandlerpoolejahmiervaughtthomasmurtaughsincerehemingwayelliemaeleonardi

Inflammation & Infection Medical Terms & Abbreviations Word Find 2026-03-18

19 Items: Localized collection of pus.Accumulation of pus in a body cavity.Inflammation of the connective tissues.The condition of heightened blood flow.The inflammation of one or more joints.A type of infection caused by yeast and mold.The inflammation of the myocardium muscles in the heart.A bodily response that induces swelling, redness, and heat....

Muses Word Search 2025-03-28

9 Items: Muse of musicMuse of hymnsMuse of danceMuse of comedyMuse of historyMuse of tragedyMuse of astronomyMuse of epic poetryMuse of love poetry

4th Grade Word Search 2025-09-10

19 Items: AreaRowsMinliDragonValuesEffortColumnsFortuneRespectMr.WestMrs.LeeMs.HillMultiplyKindnessMr.MaddenMr.BoucherMr.AguilarExpectationsResponsibility

4th Grade Word Search 2026-04-21

19 Items: EliFabianAustynAustinAustenMatiasNicoleJaylenManuelBradleyNicolasNataliaJessalynIsabellaNicholasNathanielAlexanderMaximilianoChristopher

splatoon music 2023-08-13

20 Items: OCTLINGS"agent 1"splatfest songsong for shopsdeep cut battlemanta ray/musicianleader of deep cutevil octling artistsquid sisters hit songartist of "tide goes out"artist of "salmon noises""dont get cooked, stay______"octling member of off the hookoctavio versian of tide goes outShoot targets while on a riderailartist of triple dip and clickbait...

Gastritis Word Search 2026-02-24

20 Items: Pain in a jointExcessive thirstLow platelet countInflammation of the skinAbnormally slow breathingCondition of kidney stonesLow white blood cell countAbnormally rapid breathingDisease of the heart muscleDisease or damage of nervesHigh fat levels in the bloodPainful or difficult urinationAbnormally low body temperatureRunny nose from nasal discharge...

The Ten Commandments & The First Commandment 2023-09-20

22 Items: The way God gave us His LawHumanity's fallen conditionInherited from Adam and EveThe Ten Commandments are thisThe First way God uses His LawThe Third way God uses His LawThe Second way God uses His LawAttribute of God by which He is all-knowingAttribute of God by which He is this very wordAttribute of God by which He keeps His promises...

puzzle 2025-02-04

23 Items: HawkPartyPartysystemcrisisCabinetWebsterof 1837SequoyaOsceolaof TearsDemocracyVan BurenTerritoryC. Calhounv. Georgiaconventionsv. MarylandRemoval ActHenry Harrisonof Abominationsrights doctrineof Indian Affairs

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Unit 1 POM- Structure of Matter 2024-08-02

21 Items: A homogenous mixtureThe ability to do workAtoms with the same number of protonsAnything that has mass and takes up spaceTwo or more atoms that are chemically bondedThe substance that the solute is dissolved inThe amount of matter in an object or substanceThis subatomic particle determines the element...

__________The Wordsearcher God of Mythology: Known as the Master of Word Searches 2025-03-01

30 Items: A gorgon with snakes for hair, whose gaze turns people to stone. She is often seen as a symbol of danger and fear.The god of the sea, earthquakes, and horses. He is one of the most powerful gods in Greek mythology and wields a trident....

Highways and Roads 2026-04-13

17 Items: EXIT12EXIT16HWY 306EXIT 15 EASTEXIT 15 WESTHWY 141 EAST OF HWY9HWY 141 WEST OF HWY9HWY 369 EAST OF HWY9HWY 369 WEST OF HWY9HWY 20 EAST OF ATLANTA HWYHWY 53 FROM DAWSON TO HALLHWY 9 SOUTH OF CITY LIMITSHWY 20 WEST IN THE CITY LIMITSHWY 9 NORTH OF THE CITY LIMITSHWY 20 WEST OUT OF THE CITY LIMITSHWY 9 NORTH INSIDE THE CITY LIMITS...

Nurse Practitioner Week 2023! 2023-11-11

18 Items: A1c > 6.4%A disorder of the enthesesBlood pressure above 119/79State of elevated cholesterolWork jointly with others or a teamThe art of displaying kindness and concern for othersA person competent or skilled in a particular activityGive training in or information on a particular subjectDeficiency in the amount of oxygen reaching the tissues...

Japan Word Search 2023-04-10

31 Items: sagefourfivejulyjapanblackaprilfantapastakoreannguyenfishingsamoyedchicagogeorgiawakandabusinesscheyenneajrafaelinfinitichocolateseptemberhalloweenchristmasstitchicalhellokittyvietnamesegrandrapidssanavongxaygrandvalleystmarymagdalen

Key Words Review 2025-12-11

31 Items: MayhotdaysweekyearJuneJulycoldmonthMarchAprilsunnywindySundayMondayFridayAugustcloudyTuesdayJanuaryOctoberweatherrainingsnowingThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

SUMMERTIME! 2026-06-03

31 Items: hotbbqJuneJulygolfboatbeachsunnyrelaxhappysummershortspicnicaugusthikingparadesandalscookoutpartiesflowerscampingvacationlemonadeswimmingbaseballpopsiclefireworksgardeningfestivalsgraduationwatermelon

Percy Jackson TV Show 2026-06-01

23 Items: The monster with snake hair.The Son of Poseidon and main hero.God of the Sea and Percy's father.The name of Percy’s magical sword.Percy’s fiercely protective mother.The food of the gods used for healing.Goddess of Wisdom and Annabeth's mother.A person who is half human and half god.The grumpy god of wine who runs the camp....

Architecture 2022-09-15

25 Items: an opening made in the wallthe lowest part of the buildingtriangular upper part of a walllowermost part of a window framea structure which combined with lintelthe horizontal upper portion of a stepa guard rail to give grasp to the handan isolated vertical load bearing memberwhere two of roofs surface meet together...

CH5 - History of Earth 2022-12-19

18 Items: An animal with a backbone.________________________An animal without a backbone.________________________The age of a rock compared to the ages of other rocks.________________________When entire species of living things die off at the same time.________________________...

Aug 2025-06-27

20 Items: sinwarlifewilllifegracegoodscitiesprayerof Godeternitydoctrinescripturereasoningof heavenof Christconversionof neighborilluminationspirituality

Capital cities of the world 2026-01-06

10 Items: Capital of JapanCapital of ItalyCapital of KoreaCapital of VietnamCapital of AustraliaThe capital of FranceThe capital of Russia is___?Athens is the capital of ___?New Delhi is the capital of___?What is the capital of Singapore?

Chapter 4 Vocab 2025-10-02

15 Items: a row of chemical elementsthe basic building block of mattera subatomic particle that is found in all atomsthe total number of protons and neutrons in an atoma subatomic particle with a positive electric chargea column in the periodic table of the chemical elementsthe quantity of matter contained in an atom of an element...

Key Terms Chapter 19 2023-04-19

18 Items: cavitiessweatingfaintingbad breathwaxy substanceturn white or paleOily, waxy surfaceouter layer of skinarea that feels hardblack necrotic tissueglands that produce sebuminner, thicker layer of skinmain determinant of skin colorincrease of severity or symptomsproper care of skin, hair, teeth, and nailsblood rushing to place of decreased circulation...

tire vocab 2024-11-06

21 Items: describes the tire's compositionindicate the wet traction of a tireamount of weight a single tire can carrywidth of the tire measured in millimetresthe ratio of the height of the tire's sidewallindicate the ability of the tire to withstand heatthe size of the wheel measured from one end to the other...

Matariki- The Maori New Year 2024-06-20

32 Items: newfoodjunejulytreeyearsevenstarsmaorisongslightmusicnightgamessongsfamilynaturepublicfridaywintersistersclusterfriendscultureholidayoutsidematarikipresentsaotearoahandmadeimportantcelebration

Kimya is TWELVE 2025-07-01

30 Items: YMCAGenZJulyHomeAuntLoveSmartNieceBeachKimayaFamilyTwelveNewtonCanadaCaringCabotsSelfieBigelowSephoraIceCreamBirthdaySwimmingEnergeticWaldenPondNewBedfordThoughtfulFriendshipGranddaughterLincoln-EliotMassachusetts

Word Search #1 2026-01-30

32 Items: LilaOrinKaiaLiamOpalEllaJulyDylanAveryAlizaFianaConorWillaRileyAydanAnuragTiannaVioletHarperSylviaVioletPaetynLheerinAriellaEleanorAbigailGraydonTristanEllenoreAlexanderConstanzaBrookston

Ms. Lay's 4th grade 2025-08-04

19 Items: RoryGabeLiamLylaLilyAspenEllieLeelaKyleaTalonFisherElijahWilsonHunterCarmenBarrettPaisleyKennedyBrantley

4th Grade Last Names 2025-08-21

19 Items: sosajonesmunozjayichmillerpierresoarestorresyeagerantunezbarritacerialedeoterodowningeversonherrerajohnsonaugustussandoval

Test 2024-09-26

15 Items: Growth of cities.Group of islands.Half of the Earth.Earth's surface features.Community of living things.Typical weather in a region.Spreading of cultural traits.Large, continuous area of land.Major ecological community type.Moving from one place to another.Narrow strip connecting two lands.Distance north or south of equator....

Civics Test Review 2026-05-13

15 Items: — rejection of a bill— first ten amendments— advisors to the President— highest court in the U.S.— legal member of a country— change to the Constitution— the supreme law of the land-- Last name of 1st President— government where people vote— money paid to the government— leader of the executive branch— war between the North and South...

General Knowledge 2023-09-08

33 Items: A group of islands.The genetic code of life.The study of celestial objects.A ruler, often a king or queen.The study of heredity and genes.The study of ancient life forms.A cloud of gas and dust in space.The variety of life forms on Earth.A cultural revival and rebirth of art.A dramatic change in form or appearance....

Module 16 Vocabulary 2026-04-08

15 Items: The capital of ChinaA thin, beautiful type of potteryA body of unelected government officialsThe capital of China during the Qin dynastyThe capital of China under the Song dynastyA mixture of powders used in guns and explosivesA policy of avoiding contact with other countriesA device that measures the strength of earthquakes...

Medical terminology roots, suffixs and prefixs 2026-05-15

21 Items: slowskinfastpainheartbloodnervejointdiseasestomachdiseasediffucltstudy ofsurgicalexcessivedecreasedinflmationcutting intoGives the basic meaning of a terma group of letteres or a letter before a worda letter or a group of letters at the end of a word

Where I want to go 2023-06-13

16 Items: WatTowerMahalFallsPicchuCanyonof Gizacolosseumof Athensof LibertyOpera Housethe RedeemerBarrier ReefWall of ChinaNational ParkNational Park

Spanish Vocab 2 2022-10-06

33 Items: penmaybookjunejulytodaymarchaprilfolderpencilmondayfridaysundayAugusttuesdayjanuaryoctobernotebooktomorrowthursdaysaturdayfebruarynovemberdecemberclassroomwednesdayseptemberstudent deskstudent (male)sheet of paperteacher (male)student (female)teacher (female)

PE2 2024-09-18

37 Items: pendaymayBookyearweekjunejulymonthtodaymarchaprilfolderPencilmondayfridaysundayaugustStudentStudentTeacherTeachertuesdayJanuaryoctoberNotebooktomorrowthursdaySaturdayFebruarynovemberdecemberClassroomwednesdayseptemberStudent deskSheet of paper

ORANGES EVERYWHERE (4TH) 2026-06-15

12 Items: TREESPLENTYCHANGEORANGESGROWINGWEATHERSCENERYTHOUGHTEXCLAIMFAVORITEINGREDIENTSINTERESTING

Homestuck Characters (+SBaHJ) 2025-04-28

81 Items: JohnDaveRoseJadeJaneDirkRoxyJakeAradiaTavrosSolluxKarkatNepetaKanayaTereziVriskaEquiusGamzeeEridanFeferiLilCalGeromyDadBertCalliopeCalibornSweetBroThe MayorHellaJeffMomLalondeBroStriderSpadeSlickClubsDeuceErisolspriteHeartsBoxcarThe cue ballGrandpaHarleyDiamondsDroogParcel MistressAimlessRenegadeColonelSassacreTavros' ancestorEquius' ancestor...

Birthday party July handsome and Roisin 2023-07-02

35 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosausagechickenballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

38 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosistersausagechickenfiamilybrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

41 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteburgermccoyspotatofamilysisterunlessauntiesausagechickenbrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

JULY 2025 REAL ESTATE WORD SEARCH 2025-07-02

26 Items: HOMEFORTHPARADEBUYERSFAMILYFREEDOMSELLERSFORSALEBEACHESHOTDOGSPICINICUNCLESAMCONTRACTSEASHOREAPPLEPIECORNHOLEBASEBALLFIREWORKSVACATIONSMOUNTAINSCANADADAYWATERMELONCELEBRATIONBARBEQUEGRILLINDEPENDENCEDAYHOMEMADEICECREAM

Celebrate Tropical Fruit Day July 18 2025-07-11

25 Items: AcaiAckeeDuranGuavaMangoBananaLonganLycheePapayaSapoteAcerolaAvocadoCoconutSoursopPlantainRambutanTamarindCarambolaCherimoyaJackfruitPineappleBreadfruitJabuticabaDragonfruitPassionfruit

Matter and Its Interactions 2024-08-27

23 Items: a change downwarda process of becoming largerThe process of becoming a vapor.The amount of space something takes up.Anything that has mass and takes up spaceSusceptible of being dissolved in a liquidThe process where water vapor becomes liquid.A combination of two or more different substances....

IKT 2023-08-10

5 Items: mayjunejulymarchapril

JJ Test 2026-01-27

5 Items: CupJulyShoeEasterTickle

Magnetism and Matter Topic Tree Key words 2025-08-24

25 Items: bar-magnetcuries-lawangle-of-dipdiamagnetismgausss-law-inparamagnetismmagnetic-fieldneutral-pointsferromagnetismelectromagnetsmagnetic-dipolepotential-energyearths-magnetismpermanent-magnetsaxis-of-a-bar-magnetearths-magnetic-axisangle-of-inclinationforce-on-a-bar-magnetuniform-magnetic-fieldtorque-on-a-bar-magnetsolenoid-as-bar-magnet...

jaxon's 4th word search 2025-03-31

19 Items: healtutormediccrumbimagebreathtriplehealthmedicalcomposecrumbleimagineproductbreathetripletrelativetutorialproductioncomposition

4th grade unit 11 2025-10-23

19 Items: shownshortmarchwatchwheatpunishchurchawhilechapterkitchenshelterpitchercatcherwhateveranywherewheneverchocolatesomewhereflashlight

Mr.Chandler's 4th Grade Class 2026-05-27

19 Items: EmryLiamElanRyderCarlyJesseRiverMeyerSofiaAndrewAlexisCelinaGrahamCarsonParkerAbigailLachlanChristianGeorgiana

HISTORICAL FIGURES (VERY COOL 🗣️🔥🔥🔥🔥) 2023-11-24

14 Items: French empireQueen of EgyptKing of FranceEmpress of RussiaQueen of ScotlandKaiser of PrussiaItalian noblewomenA Indian philosopherThe longest processdorEmperor of Maurya DynastyEmperor of the Mongolia empireThe greatest military commanderRole in the political and religiousKnown for creating the largest empires

Inca and Maya Conflict Project 2022-09-20

15 Items: A female deity.Gods of the wild.We walk or dive on.Science of farming.An event of circumstance.A period of a hundred years.All visible future of an area.Person who designs a building.Largest continental mountain range.Widespread occurrence of a disease.The create and ruler of the universe.A condition of having too many people....

Skin Word Search 2024-09-09

20 Items: bruiseproduces keratinred color to skinlack of blood supplyproduct of oil glandprogrammed cell deathfancy word for earwaxpale color to the skinanother word for cuticlethe largest organ of our bodyactive infection of oil glandsusually caused by liver diseasedetermines the color of our hairthis sweat gland offset is puberty...

WORD SEARCH (ADULTS) 2025-01-25

26 Items: AISHARAMADANABDMANAFNABIADAMJABALTHAWRIMAMAHMADBINHANBALOne of the Prophet's favourite fruits.The most authentic compilation of Hadith.The most mentioned Prophet in the Holy Qur'an.One of the beloved daughters of the Prophet s.a.w.The only Companion mentioned by name in the Holy Qur’an.This Companion was the amongst the ten promised paradise....

Integumentary system 2024-09-09

20 Items: skin turns bluefancy word for oilanother word for hairthe A in the ABCD ruleregulates body temperaturearrector pili muscle functionfunction of lamellular granulesproduces the pigment of our skinthe inability to produce melanina part of the integumentary systemthis degree is a full thickness burnlocated at the base of hair follicle...

CCES Wisers Extended 2023-02-22

15 Items: parademinifairfielddemoboardgamesartcontestthewitnesssportsgamesName of your schooltheme for this yeargroup _____ of Todaygroup ____ of TomorrowBarangay of your schoolgroup _____ of Yesterdaybeing celebrated right nowWhat you call the students who goes to your school

Chapter 10-3/5 Vocab 2023-05-17

25 Items: anarchistto fight againstto support publiclya type of dried meatan enclosure for animalsto refuse to allow; to forbida sled pulled by a dog or horseshare of a corporation's profitreplacement for a striking workerto tell about something that happeneda share of ownership in a corporationa shortage, lack, or insufficient supply...

Culture Word Search 2023-11-07

23 Items: - Belief in one God- Belief in many gods- growth to a global or worldwide scale- gender roles that are less restrictive- A restriction on behavior imposed by social custom.- the physical things created by members of a society- Central to a society and it helps to compare societies- the visible imprint of human activity on the landscape...

Geometry Word Search 2025-05-28

30 Items: !opp/hypadj/hypopp/adjequal to/samename of this mathfour-sided polygonthree-sided polygonPrism with two circle basesWhen lines will never intersectArea of all the faces in a 3D shapethe likelihood of an event occurringWhen lines intersect at a 90 degree anglethe Greek letter used to represent an anglea unit of angular measurement (not degrees)...

Foundation Word Search 2022-09-15

25 Items: an opening made in the wallthe lowest part of the buildingtriangular upper part of a walllowermost part of a window framea structure which combined with lintelthe horizontal upper portion of a stepa guard rail to give grasp to the handan isolated vertical load bearing memberwhere two of roofs surface meet together...

Anatomy & Physiology: J / K / Q / U 2026-02-12

20 Items: The savory senseAnalysis of urine to diagnose diseaseIncrease in the number of hormone receptorsBone located on the medial side of the forearmGranulated protein found in the stratum granulosumGeneral sensory perception of movement of the bodyType of scar that has layers raised above the skin surface...

Laura & Monica 2025-04-24

14 Items: Dog's nameCat's NameLaura's hometownFavorite TV showMonica's hometownLaura's go to beerLaura's birth monthMonica's birth monthWhere the couple metFirst vacation togetherBoard game used to proposeThe month they got engagedCouple's favorite kind of foodCouple's dream vacation location

Roisin Niamh Griffin wedding 2023-02-24

31 Items: cakedatesuitkisswinesingfoodringtacojulyphotomusicdrinkdancehappyenjoypizzapeopleflowerinvitefamilyfriendsistersausagebrotherbestmenchickensandwichtoptableseweddingbellweddingdresses

Birthday party mother 2023-03-21

31 Items: boywkdbeercakecokegirljunejulylovewinefantapepsimusicchrissweetmarchaprilpeopledrinksfamilysisterinviteauntiesummerballoonbrothersausagechickenjanuarybirthdayfavourite

Calendar Words 2024-10-22

28 Items: MaydaytwoJuneJulyweekMarchAprilmonthsevenAugusttwelveMondayFridaySundaytwelveJanuaryOctoberweekendTuesdayFebruaryNovemberDecemberThursdaySaturdaySeptemberWednesdayhundred sixty five