4th of july Word Searches

Social Studies 2025-11-10

20 Items: the right to votethe father of Communismbelief in equality of the sexesman who unified Germany in 1871the rights everyone is born withfirst ten amendments to the US Constitutionresources used to create goods and servicesJefferson, 3rd president of the United Statesthe middle class that owns the means of production...

BÚSQUEDA DE PALABRAS 2025-06-20

20 Items: SaularmyDavidGiantStoneFaithJesseSlingArmourIsraelBattleGoliathCourageVictoryChampionof HostsSlingshotof IsraelPhilistineUncircumcised

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

MS13 Ch 8 Vocab 2025-03-14

45 Items: sidesamewallmovievoicemeetingagainstdenyingbusinessfaithfulto returnyou have tountil / evendisappointedabout / overto yell at meyou have donebetween / amongmatters / affairsto leave / to letto hurt / to injurethrowing at him/herto manage / to drivefurthermore / besidesto be able to / powergo (subjunctive form)cinema / movie theater...

Magic Joy 5 2023-11-16

32 Items: busysoupjulyricebeeflatefishcombhairwalkbreadearlysteakfirstaprilfifthdirtymarchaugustalwaysdishesschooloctoberjanuarysciencenoodleschickenchineselibraryexercisedecemberdumplings

long I sound 2024-03-18

32 Items: cryfrydrypietiebikepinesighjulytinytypeideagridvinecrimelightfightrightchildpilotfriedstylerhymeslidesquidweightspiderfreighteighteenneighbourintelligentinsignificant

KATSEYE PD 3 2025-09-25

30 Items: miagemLarajulyManonMegantouchdebutmywayspicek-popdenimmusicstoneSophiagnarlyDanielagameboykatseyeeyekonsyoonchaegabrielameangirlstimelaspeI'mprettycatloversmonsterhighdreamacademytonightImightbeautifulchous

FRANK OCEAN 2025-10-03

26 Items: IVYPINKJUNEJULYOCEANWHITETOKYOJONESBLONDORANGEBLONDECHANELSECRETDEALERAUGUSTCHANNELWEDDINGFIGHTERFRANCISMISSINGENDLESSTalbottBISEXUALPROPHECYRELIGIONNOSTALGIA

Part Of Building 2022-09-15

25 Items: is situated above the ground levelis vertical member of step on stairis horizontal member of step on stairis the vertical component of any structureis an isolated vertical load bearing memberare the main entry and exit point of any houseare the horizontal load bearing member of a buildingis a part of a wall just under an opening like a window....

GOVERNOOP-THE-WORD PUZZLE 2024-09-17

30 Items: Government by many peopleA state having no governmentGovernment by an absolute rulerAn authoritarian type of governmentThis society has no central governmentIn which the government rulers are maleA type of government led by the PresidentIt is usually consist of chambers or housesAn economic system where productions are valued...

Ancient China Vocabulary 2025-02-18

26 Items: to make the sameable to live foreverpassed along from parent to childto improve the quality of somethingto come into possession of somethinga large group of family members and friendsan official who watches others for correct behaviora Chinese philosophy that emphasizes proper behaviora violent action in opposition of a government or law...

Birthday party July handsome and Roisin 2023-07-02

35 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosausagechickenballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

38 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosistersausagechickenfiamilybrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

41 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteburgermccoyspotatofamilysisterunlessauntiesausagechickenbrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

JULY 2025 REAL ESTATE WORD SEARCH 2025-07-02

26 Items: HOMEFORTHPARADEBUYERSFAMILYFREEDOMSELLERSFORSALEBEACHESHOTDOGSPICINICUNCLESAMCONTRACTSEASHOREAPPLEPIECORNHOLEBASEBALLFIREWORKSVACATIONSMOUNTAINSCANADADAYWATERMELONCELEBRATIONBARBEQUEGRILLINDEPENDENCEDAYHOMEMADEICECREAM

Celebrate Tropical Fruit Day July 18 2025-07-11

25 Items: AcaiAckeeDuranGuavaMangoBananaLonganLycheePapayaSapoteAcerolaAvocadoCoconutSoursopPlantainRambutanTamarindCarambolaCherimoyaJackfruitPineappleBreadfruitJabuticabaDragonfruitPassionfruit

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Chapter 2: Fundamentals of Ecology Vocabulary Review Part 2 2025-09-11

25 Items: The ocean water in an ocean basin.An organism’s role in its environment.An energy-storing level in a food chain.The water that covers the deep ocean basins.Organisms that float or drift in the sea’s currents.A symbiotic relationship in which both organisms benefit.The ocean bottom that extends from a depth of 4,000 to 6,000m...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Genshin Impact 2025-06-18

102 Items: ChildeWolf BoyVoid StarMale twinVago MundoFlame-ManeGolden VowFemale twinEons AdriftShining IdolFrozen ArdorBlazing RiffMujina NinjaTrial by FireValley OrchidStage LucindaTurnfire HuntDire BalemoonWindborne BardKreideprinz(e)Plenilune GazeEclipsing StarWise InnocenceCanine WarriorLens of VerityDriving ThunderVigilant YakshaJuvenile Galant...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Services Word Search 2024-11-14

49 Items: – Government agency that promotes tourism.- What is the act of traveling to and from work called?- What is the activity of traveling for pleasure called?– The promotional name for tourism in the west of Ireland.- What is an urban railway system, often underground, called?- What primary activity involves catching fish and other seafood?...

Constellation Word Search 2023-12-18

20 Items: giving off lighta milky band of lightbig bear constellationsmall bear constellationa floating rock in spacesomeone who explores spacerevolving around somethingthe coldest day of the yearthe hottest day of the yearthe study of celestial bodiesa group of stars that form a shapemirroring light that is put on themthe belief system of constellations...

wedding 2024-10-03

26 Items: Our babyOur hometownMake of our carFavorite breweryColor of our eyesFirst family vacationLocation of engagementFavorite getaway stateMonth of our first dateFavorite date night activityFavorite pinot noir wine brandFavorite sneaker brand & styleFavorite sport to watch togetherMain stone on my engagement ringRestaurant we had their first date...

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

Science Word Search 2023-05-16

20 Items: A row on the periodic table.A metal bonding with a nonmetal.Something that can be dissolved.A nonmetal bonding with a nonmetal.Something that can dissolve other things.The number of protons contained in an atom.A subatomic particle with a neutral charge.A subatomic particle with a positive charge.A subatomic particle with a negative charge....

Chemistry, Physics, Energy Concepts 2023-06-01

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Coding 2025-06-18

20 Items: RISKPAYERAUDITSDETAILREVENUETHERAPYTEAMWORKSPECIALTYREPLACEMENTSThrough the skinMIS procedure to treat VCFStandard or degree of excellenceWithout variation or contradictionA pulling force applied to a part of the bodyMIS Procedure with balloon assistance to treat VCFConforming to a set of predefined rules, laws, regs...

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Wave Terms 2025-11-06

21 Items: Unit of frequency.Lowest point of a wave.Highest point of a wave.Material through which a wave travels.The passage of light through an object.Wave changes direction because its speed changes.A wave that requires a medium through which to travel.The number of wavelengths that pass by a point each second....

Bastille day. 2022-11-29

7 Items: dayJuly.freedomlibertyequalityaniversary.enemie du peuple.

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

Unit 10 APES Review 2024-05-02

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

6th Grade Unit 1 Lesson 1 Vocabulary 2025-09-26

23 Items: to the third power.to the second powerthe space inside of a shapeEach flat side of a polyhedronEach straight side of a polygon(of a parallelogram or triangle)a type of polygon that has 4 sidesside of a parallelogram or triangletell you how many factors to multiplya point where two or more edges meet....

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Building Component ANF 2023-02-20

25 Items: rounded stairs edgeswall separating two independent plotlittle room that projects from a roofany level part of a building with a floorthe lowest load-bearing part of a buildingthe horizontal portion of a stair assemblysteel rods that building engineers set in concreteconnect the highest point of intersected roof sides...

Askiathegreat Word Search 2024-10-04

30 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriaspans much of southern Africathe area of modern-day SomaliaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthage...

Polish Verb Chcieć 2025-11-04

24 Items: the form of "chcieć" in present tense for "ja" (I) meaning "I want"the form of "chcieć" in past tense for "on" (he) meaning "he wanted"the form of "chcieć" in present tense for "my" (we) meaning "we want"the form of "chcieć" in past tense for "ona" (she) meaning "she wanted"the form of "chcieć" in future tense for "ja" (I) meaning "I will want"...

Theme A word search 2025-04-01

14 Items: gravity forceair resistancerate of change of velocityforce in a stretched rope/stringquantity described only by magnitudeshape of projectile's path of motionquantity with magnitude and directionstudy of forces and their effect on motionreference system describing an object's motionmeasure of an objects resistance to acceleration...

ICP Vocab 15 2025-03-14

15 Items: A change of one substance to anotherType of matter with a fixed compositionThe same thing as a homogeneous mixtureA substance made up of atoms that are all alikeA mixture that remains constantly and uniformly mixedA mixture in which different materials remain distinctA heterogeneous mixture with particles that never settle...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Griot Word Search 2025-11-17

25 Items: RulerStorytellersInbetweenersCapital cityMeans "people"Group of travelersSole control of tradeImportant trading cityRuled from 1307 to 1332Reported Muslim historyBoat with triangular sailCenter of trade and learningFounder of a line of emperorsFertile grassland, South of SahelDescendants from a common ancestorCulture of Bantu speaking migrants...

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Read Word Search 2025-11-25

28 Items: 3rd person singular to buy3rd person singular to fly1st person singular to read1st person singular to live1st person singular to work1st person singular to swim1st person singular to cook1st person singular to walk3rd person singular to push3rd person singular to rain3rd person singular to snow1st person singular to study...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Stress, Anxiety and Bullying 2023-05-15

25 Items: too muchbe afraid ofslightly angryfeeling of annoyancea feeling of physical tensionworry, unease, or nervousnessa feeling of emotional tensionelapsed time between two eventscausing or likely to cause harmextreme anxiety, sorrow, or painthe condition of being anonymous.responsible for flight, flee, freezemake or become less tense or anxious...

Chemistry, Physics, Energy Concepts 2023-05-30

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

semester review 2024-12-12

25 Items: direct currentshield metal arcalternate currentAmerican welding societypin holes or round voidsresult of trapped oxygendevice used to hold materialsprotective covering for handsstate of being free of dangerdirect current electrode negativedirect current electrode positiveAmerican society of mechanical engineers...

Pathophysiology Word Search 2025-09-07

20 Items: Something you can see or measureHow often a disease causes deathCause behind why a disease startsWhen a disease suddenly gets worseYou are born with it, doesn’t develop overtimeWhen symptoms get better or disappear for a whileShape,Structure, or Appearance of cells or tissuesDiscovery of what disease or condition someone has...

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

Uppingham 2025-12-03

15 Items: OUR SCHOOL NAME (14)OUR HEAD MISTRESS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 6 CREATOR OF MAGASINE (15)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPE (8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

Toa Mata Era 1 2025-08-22

36 Items: the average villagera huge bull-like beasta large wasp-like beasta hero filled with adhdthe great mask of speeda hero filled with angera hero filled with pridethe glacial village of icethe sandy village of stonethe treetop village of aira hero filled with empathythe great mask of strengththe charred village of firea gigantic tiger-like beast...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Ndis Word Search 2025-09-12

22 Items: An example of an NGO health promotion program in AustraliaAn SDG that focuses on access to clean water and sanitationA government initiative that subsidises the cost of medicinesAssistance provided in times of crisis such as natural disastersthe concept that expands people’s choices and improves their lives...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timea balance between different factorsVelocity at a particular instant in timethe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timeA balance between different factorsVelocity at a particular point in timeThe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

Secondary Economic Activities 2024-11-15

25 Items: – MNC stands for.– where rubbish is burnt.– Is an example of a light industry in Cork.– consists of inputs, processes and outputs.Alumina – Example of a heavy steel industry in Shannon.- What primary activity involves catching fish and other seafood?- What is the process of extracting minerals from the earth called?...

Advanced Astrophysics Word Search 2025-07-10

20 Items: The powerful and luminous explosion of a star.The maximum mass a stable white dwarf star can have.A neutron star with an extremely powerful magnetic field.The super-dense remnant of a massive star's supernova explosion.The theoretical point of infinite density at the center of a black hole....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

nvrt 2023-10-18

21 Items: polyppermianjurassicphasmidsflagella"false feet"reef-buildingtapeworm headhermaphroditic_________ ooze“little kidneys”having separate sexes_____________ explosionnematode glandular systemsegments in cestode’s bodyfree-living flatworms (Class)“bell form” cnidarian body planalgal symbionts of coelenteratesanterior chemosensory organ of nematodes...

Birthday month 2023-02-07

32 Items: fryjunejulyyearhometimegoodweekcokemarymarsdavebluemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

THIS IS US 2024-08-28

32 Items: LIVTYGGUEJEANLOVEJULYTANKTYLERJAMESBEEZYANGELBELLAOLIVIAWADERSHUNTERGANNONENERGYWINNIESUNTOMERAELYNNSUNRISEPEBBLESKIRKLANDFEMININEILOVEYOUZACHBRYANEVERLEIGHMASCULINEUNCLEMIKEGOODVIBESDADDYSGIRLBESTFRIEND

Arthur’s Celebration - Sense-Sational 2025-11-14

30 Items: SeeD.W.SodaHearEyesEarsNoseCakeJulyBinkyTouchSmellTasteMouthPartyMovieArthurBusterSensesPiñataTicketsPopcornFingersScienceFrancineBalloonsBirthdayStreamersGrandpa-DaveGrandma-Thora

Uppingham Cairo 2025-12-03

15 Items: Our School Name (14)OUR HEAD MISTRISS (7)HEAD OF UPPER SCHOOL(10)HEAD OF SENOIR SCHOOL(10)6 CREATOR OF MAGASINE (15)WHO IS HEAD OF SCIENCE(10)BUILDING OF LOWER SCHOOL(12)WHO WON THE FIRST HOUSE CUP(9)PAGE 19 CREATOR OF MAGASINE(13)PAGE 22 CREATOR OF MAGASINE (14)WHO WON THE FIRST HOUSE COMPETETION(8)WHEN UPPINGHAM STARTED (NUMBERD ANSWER)(4)...

Cell Cycle and Mitosis 2024-12-15

17 Items: The phase of interphase where DNA replication occursOne of two identical halves of a duplicated chromosomeA structure of DNA and protein that contains genetic informationThe region of a chromosome where sister chromatids are held togetherThe stage of mitosis where chromosomes align in the middle of the cell...

Hidden War Word Search 2025-05-22

20 Items: Confederate GeneralPresident of the UnionThe state of the nationFirst battle of the warThe capital of the UnionFrederick _ _ _ _ _ _ _ _Battle closest to RichmondCapital of the ConfederacyConfederate's trade centerPresident of the ConfederacyThe starting point of the warSlave states loyal to the UnionAbout 4 million people are in this...

Gold Rush July Word Search 2024-07-05

15 Items: dancelevisholidaystadiumgoldrushbarbecuedirectorcaptainspracticefireworksrehearsalcrimppomsteammatesfortyninerscheerleader

Coopershawk Word Search 2024-10-03

26 Items: Our babyOur hometownMake of our carFavorite breweryColor of our eyesFirst family vacationLocation of engagementFavorite getaway stateMonth of our first dateFavorite date night activityMain stone on engagement ringFavorite sneaker brand & styleFavorite sport to watch togetherRestaurant we had their first dateOur birthday signs (Julie’s first)...

Cestodes and Trematodes 2025-02-25

15 Items: Equine tapewormSalmon poisoning fluke in dogsFeline tapeworm with IH of miceIntestinal flukes of dogs and catsCanine schistosome and a blood flukeRuminant tapeworm with IH of grain mitesHyatid disease tapeworms and very zoonoticBroad fish tapeworms with IH of fish and frogCanine taenid with IH host pf rabbits and hares...

Ancient History 2023-07-17

20 Items: 490 BCE Battle of _________.9500 BCE Settled _______ began.2560 BCE Great _______ of Giza.6000 BCE _______ was discovered.200 BCE Paper is invented in China.776 BCE ______ Games first recorded.323 BCE Death of Alexander at _______.508 BCE Democracy introduced at ______.1700 BCE End of _____ Valley Civilization....

Cardiovascular and Lymphatic Systems 2024-12-17

20 Items: transports oxygencontains hemoglobinpumps blood and oxygenfights against infectionThe top chambers of the heartthe lower chambers of the hearta microorganism that causes diseasethe oxygen-carrying protein in bloodvessel that returns blood to the heartclear fluid that fills the spaces around body cells...

Executive Branch 2024-05-07

20 Items: Attacking the opponentWho is the current President?Who heads the executive branch?Using data/statistics to persuadeHaving someone famous support the candidateShowing lots of people supporting the candidateThe power of the President to postpone a sentencethe law What is the main job of the Executive Branch?...

Age of Exploration: Chapters 1 & 2 2024-09-21

24 Items: hourglassnever mappeda chain of islandsa type of fine potteryto prepare for sailingthe sides and bottom of a boata person who buys and sells goodsa plant used to add flavor to foodto discuss the terms of an agreementrelating to the Middle Ages in Europea place where people buy and sell goodsthe reason for taking a specific action...

Dynamic Ecosystems 2025-10-23

20 Items: When a predator hunts and kills preyAnything that restricts the size of a populationProcess of a body of water becoming nutrient richWhen two or more individuals interact with anotherbalance between the different parts of the ecosystemSymbiotic relationship in which both partners benefit...

Fundamentals of Biology 2025-07-28

28 Items: The smallest unit of lifeThe smallest unit of matterThe building block of proteinsA building block of DNA and RNATwo or more atoms joined togetherA group of cells that work together.A package of DNA found in the nucleusA copy of DNA that helps make proteinsThe part of the cell that makes proteinsA substance made of two or more elements...

Budgetdraft Word Search 2023-02-25

25 Items: cooking placeplace to showerbuilding supportunderground roomsafety on the stairthe face of buildingcost data used to designthe width of a rung is calleda loong pasage in the buildingthe height of a rung is calledis the topmost room of a buildingis where the entry of light and ventilationthe lowest part of the base of an architectural column...

Unit 11 APES review 2024-05-01

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

Foundation of American Democracy 2025-10-29

20 Items: LockeCartaSenseof LawBranchBranchBranchCollegeof ParisRepublicContractOrdinanceDemocracyConventionFederalistFederalismSovereigntyand BalancesEnlightenmentof Confederation

Polish Verb Dać 2025-11-04

24 Items: the form of "dać" in past tense for "on" (he) meaning "he gave"the form of "dać" in present tense for "ja" (I) meaning "I give"the form of "dać" in present tense for "my" (we) meaning "we give"the form of "dać" in past tense for "ona" (she) meaning "she gave"the form of "dać" in future tense for "ja" (I) meaning "I will give"...

4th Grade #2 WORDSEARCH 2018-05-09

17 Items: avamyaninanikokatiemariacalebmarleejosephmykaelconnorsaybreekaitlynaddisonphillipkinleighkatherine

WELCOME TO 4TH GRADE! 2025-08-12

17 Items: LIVAVAARYATALABEAUARLOLIBAJADENRILEYCHANCEPEYTONALEXISALYSSASOLOMONMARCETHSAVANNAHBENJAMIN

4th Grade Week 3 2025-08-18

17 Items: sumtaxallydigitpovertypursuedestimateroundingbiographyassembledterritoryremarkabledifferenceparliamentrevolutiontreacherousproclamation

Our 4th Hour Class 2025-08-28

17 Items: LeoJaceKyraGavinRykerOscarIsaacHarlowSlevinNevaehLakotaStellaMelanieEverettRyleighRozelleIzabella

Thermal Energy Word Search 2025-10-30

16 Items: the energy an object has because of movingtransfer of energy by electromagnetic wavesthe energy required to change a solid to a liquidthe temperature at which a solid changes to a liquida material through which thermal energy moves slowlyincrease in the volume of a substance when the temperature is increased...

AP Gov Word Search 2025-12-05

25 Items: The legal right of an individual or entity to bring a lawsuit in court.The party who initiates a lawsuit by filing a complaint against another party, known as the defendant.The process of manipulating the boundaries of electoral districts to favor one political party over another....

English Term 2 Exam Word Search 2025-12-15

16 Items: Loves HermiaTrouble makermarried to LindoFather of HermiaHead is a donkeyQueen of fairiesDaughter of Lindomarried to Suyuanmarried to An meiDaughter of SuyuanDaughter of An meiMarried to Ying Yingdaughter of Ying yingIn love with Lysandervery insecure and needs validationLove potioned to be in love with Helena

Spelling practice English 2023-10-11

19 Items: The _______ of a owlThe _______of a snakeOpposite to many ________A baby horse ____________Rhymes with wish___________Opposite of few____________A shark is ______ (large) a man.The horse is kept in a ___________He can hear the buzz of the _________The kitten is kept in a _____________The puppy is kept in a _______________...

Mont Y8 Statistics 2023-10-10

15 Items: The process of collecting data.Entities that collect different types of data.Selected without a particular order or pattern.A series of questions used in a survey or census.Information collected for the purpose of analysis.Data collected from a selection of a larger group.Data collected from the entire group being studied....

The Good Old Summertime 2024-07-08

33 Items: haygolfheatjulylakesunnydustybeachpicnicrelishaugustmowinghikingboatingfishinghotdogsmustardketchupthundercowboyshippiesparadescampingswimmingcornholebandannabarbecuecarnivalvacationfireworkswatermelonfrontporchcountyfair

Jake and Kaylee part 2 2024-10-01

33 Items: JakeNovaNavyJulyFordlovewifeErmcoColtsDancebridegroomBowmanKayleeEdwardcoupleDonrigoTeacherBennettMikaylaOctoberweddinghusbandmarriedBurgundyNovemberChampagnePowerstripGreenfieldBluefusionElectricianIndianastateGreenfieldcentral

Martin Van Buren 2024-10-11

32 Items: SoilJulyViceBurenDutchPanicPartyAndrewCrisisEstateLawyerMartinPublicUnitedJacksonRetiredSenatorSlaveryDecemberDelegateEconomicGovernorNationalPoliticsCandidateExpansionFinancialPresidentSecretaryDemocraticDepressionKinderhook

Months and days 2025-04-14

33 Items: MayonetwosixtenJuneJulyfourfivenineMarchAprilthreeseveneightAugusteleventwelvetwentythirtyJanuaryOctoberfifteensixteenFebruaryNovemberDecemberthirteenfourteeneighteennineteenSeptemberseventeen

CH1 - Thermal Energy 2022-12-19

15 Items: The expansion of matter when it is heated.________________________The transfer of energy by electromagnetic waves.________________________A state of matter with no definite shape or volume.________________________The rule that energy cannot be created or destroyed.________________________...

Summer 2020-06-16

33 Items: hoticesunswimhikewalkJuneJulypoolplayroadhatsbeachsunnycreamoceanbikesparksrelaxtripsAugustcampingpicnicsglassescookoutsbaseballoutdoorspopsiclevacationbirthdaysflipflopssunscreenthunderstorms

Summer word search 2025-05-29

34 Items: SUNHOTFUNSWIMPOOLSANDSAILBOATPLAYCAMPJULYPARKCAMPBUGSBEACHOCEANGRILLTOWELBERRYPICNICSHORTSAUGUSTOUTDOORFIREFLYEXPLOREHOLIDAYBONFIREVACATIONICECREAMLEMONADEMOSQUITOFLIPFLOPSSUNSCREENWATERMELON