tectonic plates Word Searches

Alligator Word Search 2025-11-24

69 Items: BagbedFankeymoprugbookDeskforkIronJarsLampmugsovenpenspotspanssinksoapTapewirebroomgloverluertowelcandlechairsfridgeKettlebasketmirrorneedlepillowplatessheetsspoonsVacuumYogurtballoonblanketGlassesHairtiehangersjewelrylaundryNapkinsnoodlesplungerQuarterstaplertoastercomputercupboardenvelopeheadbandMattressScissorsfryingpanfurnituremicrowave...

CH4 - Plate Tectonics 2022-12-19

14 Items: Stress that squeezes rock until it folds or breaks.________________________A force that acts on rock to change its shape or volume.________________________A plate boundary where two plates move toward each other.________________________A plate boundary where two plates move away from each other.________________________...

Photosynthesis Word Search 2025-03-23

20 Items: A large, slow-moving mass of iceA dry region with little rainfallThe layer of gases surrounding EarthEarth’s spinning movement on its axisThe second layer of Earth’s atmosphereThe path a planet follows around the sunA mountain that erupts with lava and gasesA piece of land nearly surrounded by waterRain, snow, sleet, or hail falling from clouds...

year 9 week 5 2025-10-31

20 Items: The very hot centre of the Earth. Starting with a C. (4)The thin outer layer of the Earth. Starting with a C. (5)Fine particles from a volcanic eruption. Starting with an A. (3)The system that breaks down food for energy. Starting with a D. (9)Hot liquid rock that flows out of a volcano. Starting with an L. (4)...

Current Events 2025-03-02

88 Items: techISISgunsfirefakenewsBoldPlanGoesSnowtrumpnorthkoreaeventgangsspacemailscourttrumphamasvegasnormaStormSouthVideoViralPlatehealthtravelbostonisraelleakedtiktokrightsballotelninohelmutmerkeldengueWinterNativeIphonemissilecurrentfashiontourismClitonediscordlebanonmyanmarsupremelibertyjusticeunitaryfederalbaghdadmiramarProjectRestoreTouristdisaster...

Metamorphicrocks Word Search 2024-04-09

11 Items: lack plates or stripesbands, sheets or platesform by the precipitation of mineralsform by the compaction of rock fragmentsform by accumulation of animal or plant debrishave large grains and cools for millions of yearshave small to medium grains and cools for thousands of yearshave invisible or microscopic grains and cools for seconds to months...

Chapter 16 2025-02-19

66 Items: cnspnsansenttbiamddtrsheathacuitymyopiaplatessynapsediseasediseasediseasediseasevertigoeardrummeningescerebrumpuncturedementiaheadachemigrainesciaticadeliriumcataractglaucomatinnitusbrainstemsclerosisheadachesneuralgiaconfusionhyperopiatonometryimpactioncerebellumparaplegiameningitisangiogramsmyelogramspresbyopiadetachmenteye chartssympathetic...

100 Words Search  2016-04-29

87 Items: eurobelieironyfaireusurpabjureacumengametegauchehubrisjejunekowtowmoietyplasmaquasarvortexwinnowyeomanequinoxfatuousimpeachkineticlaissezlexiconmitosisoxidizepolymervacuouswroughtabrogatechurlishenervateepiphanyfecklesshegemonynihilismnotarizeparabolaparadigmsanguinetaxonomytectonicbellicosechicanerydeciduousdiffidentexpurgatefacetiousfiduciary...

Dishwasher 2025-01-06

10 Items: Thoughts or conceptsAn assistant or helperSanta’s speedy reindeertopmost part of the bodyCleans with water and soapUnwanted plants in a gardenChops or shapes with a bladePossessing knowledge or insightA comment meant for the audiencePlates, bowls, and other table items

Thanksgiving 2025-10-10

86 Items: HamPieRestFoodOvenMilkSnowColdMealMeatHomeFullTastyBeansSleepCreamSugarJuiceGamesJokesHappyBreadGravyRoastRollsSauceFeastFamilyTurkeyMoviesTravelParadeNapkinDishesPlatesLeavesApplesPrayerAutumnDinnerSquashEatingCorncobOrangesCookingHolidayKitchenPopcornCookiesFriendsGibletsHarvestTogetherStuffingFootballPotatoesThankfulPilgrimsShoppingCrockpot...

November Week 2 Wordsearch 2023-11-13

100 Items: elmorbjoyzenarcdeworbpearogrerunetombyarnzealapexfluxpeacholivebakerdaisyfencethymemossyriverpuppydwarfelderfablequestpuzzlecaringthronelivelyawakencanopycanopyfloraldrowsyutopiaelixircobblerglimmerrelaxedthicketjasminejupiterbrambleincensepegasusphoenixsnoringuraniumostrichreverieethicaltoiletrysapphirebarbaricaromatictectonictreasuremarigold...

For Us, Living essentials 2025-05-14

98 Items: BedcarmopTeahomefoodpotspanssofaSoapFansragscombmugscoattapepensgluewaterstovebowlstablebroombrushRazorPhoneBroomknifebowlswhiskladleForksShoesleashPlatesbedingvacuumSafetyvacuumspoonsKettlePantrycoffeegloveshammerTreatspettagCollarpetbedsheltershampoodrawersComfortheatersCookingspatulaGlassesToasterBlenderpetFoodHarnesspetToysDishsoapbodywash...

November Mega Word Search 2023-11-13

100 Items: elmorbjoyzenarcdewpearwolfogrerunetombyarnzealapexfluxgourdpeacholivebakerdaisythymemossyriverdwarffablequestspainpuzzlesquashcaringcobblethronelivelyawakenbotanylustercanopyfloraldrowsyutopiaeldgerelixirglimmerrelaxedthicketjasminejupiterpioneerbrambleincensepegasusphoenixsnoringuraniumostrichreverieethicaltoiletrysapphirearomatictectonictreasure...

Aesthetic Word Search 2025-11-04

91 Items: funyumcakecozyglamhostmealsingslaytalkvibeviewwinewinkzestzoneblissboozechillcomfycrowddancedecoreventfeastfunnygamesjokeslaughmusicpartyphotoserveshareshotssmilestyletablethemetoasttreattrendvibesbaddiebrunchcheersdinnerdishesdrinksenergyfoodiegathergossipinvitemimosamomentoutfitplatesselfiesnackssocialvideoswarmthcandlesdessertflannelfriends...

lang word  2016-04-29

97 Items: EUROBELIEFAIREIRONYUSURPABJUREACUMENGAMETEGAUCHEHUBRISJEJUNEKOWTOWMOIETYQUASARVORTEXWINNOWYEOMANEQUINOXFATUOUSIMPEACHKINETICLAISSEZLEXICONMITOSISPOLYMERVACUOUSWROUGHTABROGATECHURLISHENERVATEEPIPHANYFECKLESSHEGEMONYNIHILISMNOTARIZEPARABOLAPARADIGMSANGUINETAXONOMYTECTONICUNCTUOUSVEHEMENTZIGGURATBELLICOSECHICANERYDECIDUOUSDIFFIDENTEXPURGATEFACETIOUS...

Journey to the Sun 2025-10-21

12 Items: RadiateTo protect youCircling the EarthA type of magnetismA material to make platesSomething to do with the sunUsed to find out informationThe material that makes diamondsSomething that never happened beforeThe distance between the sides of a circleSomething that generates a lot of lightningWhat you use when you are in trouble to signal

Journey to the Sun 2025-10-21

12 Items: RadiateTo protect youCircling the EarthA type of magnetismA material to make platesSomething to do with the sunUsed to find out informationThe material that makes diamondsSomething that never happened beforeThe distance between the sides of a circleSomething that generates a lot of lightningWhat you use when you are in trouble to signal

Year 9 Earth & Space 2025-11-26

1 Item: soil mantle core crust volcano lava magma eruption tectonic plates plate boundary earthquake fault seismic waves atmosphere hydrosphere biosphere lithosphere atmosphere erosion sedimentation weathering atmosphere biosphere hydrosphere lithosphere

road trips 2025-04-21

101 Items: cargasiowaohioutahtriprainfuelidahomainetexasstateroadshillsparkshoteltollsmusicradiosunnystormwindytreesalaskahawaiikansasnevadaoregandesertforestplainsplatestravelmilagesnackshikingbreaksalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingmidwesttornadocanyonsbordersdrivinglicensecampingpackingluggageweathertraffichighwayarkansas...

Sopa de Letras 2025-12-05

29 Items: a handthe mapsthe testthe housethe handsthe classthe nightthe unclethe waterthe moneythe gradethe fatherssome platessome prieststhe umbrellasome pencilssome potatoesthe happinessmy son-in-lawthe can openersome bathroomsthe uncertaintysome afternoonsthe capital citythe fraternal twinthe pencil sharpeneryour daughter-in-lawthe series (singular)...

Topography Word Search 2025-01-11

36 Items: The atmospheric layer above the troposphereA ring-shaped coral reef encircling a lagoonGround or soil that remains frozen year-roundA piece of land completely surrounded by waterA chain or group of islands clustered togetherA vast, treeless grassland in semi-arid regionsA fertile spot in a desert fed by water sources...

Word Search #1 2025-07-03

13 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?Where do you store your food?Where is the best place to be?What holds your plates and cups?What takes you from point A, to point B?...

Lab Week 2024 2024-03-14

99 Items: tersvflucapcbccmpbmpsdsecwfaxdrawstatcliatesttubesquestnordxstateswabscobascovidfodenmasksbadgeloginemailstainordersneedleslidessmearsplatessysmexdoctorglovesadd-onlabelsimmunesurveysafetychartsscrubslabcorporchardpantherfreezerultiprogoggleslabtechrotatorreportsbindersmanualssterilestoragesend-outschedulediasorincurrierslab-weeklab-coatyarmouth...

Hvacr 203 special refrigeration applications 2025-06-05

6 Items: Carbon dioxide.A phase change solution in cold platesA salt water solution corrosive made of sodium chloride.Changing from a solid to a vapor without the liquid state.Cold temperature and high air velocity across a food product.solidified and compressed carbon dioxide. experiences sublimation at -109 Fahrenheit.

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

Handicraft Word Search 2025-10-24

12 Items: a farmeran animaldishes made with claya large piece of clothan excellent example to copyskills shown in particular craftto turn something with your hand to remove itthe activity of making attractive objects by handa type of earth used to make things such as potterytraditional and typical of the ordinary people of a country...

Things starting with A 2 2025-06-06

7 Items: Capitol of greece.Creature covered in armoured platesJob ______ form. Scariest thing in the world.Disease that makes you start coughing when you get hot.Person who pretends to be someone else in movies, TV shows, etc.Big, big, big desire. Example: 'He wanted to stop global warming.'....

Wanted Word Search 2023-04-05

109 Items: aicadhitemdttydpycprfunemateamhelpfirecalmetsbBACKsnowrepotowsswatsofisococoldsquadvoicefallsalarmchiefcourtwantedfelonyplateschairsscreendeputyordersshiftsphonesrescueanialitrunkssignalstormsstrokepatrolenginetankerARRESTlightssirensnercomseecomjudgesradioslicensebenefitweekendsheriffaddresscallerschokingmissingVEHICLEweaponsfriendsstarcomheaters...

Open House Word Search 2025-07-01

16 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?What's the Agent's last name?Where do you store your food?Where is the best place to be?What's the Agent's first name?What holds your plates and cups?...

Comp Sci 2 Unit 1 Earth Structures (Lesson 4) 2025-09-24

10 Items: Dating, A method of determining the actual age of a rock, fossil, or geologic event in years, often using radioactive decay.Dating, A technique for determining the age of materials by measuring the amount of a radioactive isotope and its decay products....

T-Rex Word Search 2025-02-11

10 Items: A giant, long-necked herbivorous dinosaurA large predatory dinosaur, similar to T. rexA small but fast predator that hunted in packsA heavily armored dinosaur with a clubbed tailA herbivorous dinosaur with three horns on its headA flying reptile that lived during the age of dinosaursA herbivorous dinosaur with large bony plates along its back...

Hurricane Word Search 2025-02-11

10 Items: The sound produced by lightning during a stormA severe snowstorm with strong winds and low visibilityA large, powerful storm with strong winds and heavy rainA visible mass of condensed water vapor in the atmosphereA sudden shaking of the ground caused by tectonic movementsA flash of light caused by an electrical discharge in the atmosphere...

6th Grade Colton's Word Search (Good Luck) 2024-05-15

15 Items: The hottest planet7th planet from the sunLava that forms underwaterThe planet that we live onThe closest planet to the sunThe planet with jewelry (rings)The furthest planet from the sunAll the continents brought togetherThe largest planet in the solar SystemThe theory that says that continents move.The water brought into the earth from plants...

Jack's kitchen 2025-12-01

1 Item: red, yellow, Jack, plates, bowl,towels, blue,

Europe & Russia Vocabulary 2025-11-05

27 Items: – To adjust to new conditions or environments.Strong pride and loyalty to one’s nation or ethnic group.Fear or dislike of people from other countries or cultures.– To change something in the environment to meet human needs.Rate – The percentage of a population that can read and write.To rely on the environment or a resource to survive or function....

Disposables 2025-12-09

30 Items: General eating toolsUsed to carry take-outFast-growing eco plantCovers that fit on cupsWorn to protect clothingDisposable head coveringItems used to serve foodRecyclable clear plasticGeneral food storage itemDisposable table coveringHeat-resistant bioplasticFlat disposable dinnerwareDeep disposable dinnerwareUsed for hot or cold drinks...

Table Items and Restaurant Uniforms 2024-12-03

19 Items: a decorative platea tie typically worn by a chefa utensil used for cutting foodthe cloth you use to wipe your mouththe cloth you use to cover the tablea drinking container made from glassa utensil used for eating liquid fooda shallow dish on which a cup is placeda round deep dish used for food or liquidsmall, thin sticks used as eating utensils...

Atom Word Search 2025-02-09

20 Items: The smallest unit of matterA group of atoms bonded togetherThe amount of mass in a given volumeThe process of liquid turning into gasThe force that pulls objects toward EarthRelating to the movement of Earth's crustThe bouncing back of light from a surfaceThe speed and direction of a moving objectThe process of gas turning back into liquid...

Earth and Space Science 2025-05-30

10 Items: A large, slow-moving mass of ice formed from compacted snow.Any form of water falling from clouds—rain, snow, sleet, or hail.The layers of gases surrounding Earth that support life and weather.Molten rock beneath Earth's surface that can form lava when erupted.An imaginary line around which Earth rotates, causing day and night....

Science Word Search 2025-02-07

100 Items: pHDNALabAtomGeneCellLensWaveDataAcidBaseBiomeVirusPlateOceanForceSpeedLightSolarEnergyProtonFossilEnzymeOpticsFusionTheorySampleAtomicBiologyPhysicsQuantumGravityNeutronSpeciesMicrobeProteinNucleusGeologyVolcanoWeatherClimateKineticCircuitCurrentVoltageFissionReagentSolventIsotopeMoleculeElectronOrganismBacteriaRibosomeTectonicVelocityFriction...

1. Word Search 2025-05-12

100 Items: eurobelieironyusurpabjureacumengametegauchehubrisjejunekowtowmoietyplasmaquasarvortexwinnowyeomanequinoxfatuousimpeachkineticlexiconmitosisoxidizepolymervacuouswroughtabrogatechurlishenervateepiphanyfecklesshegemonynihilismnotarizeparabolaparadigmsanguinetaxonomytectonicunctuousvehementbellicosechicanerydeciduousdiffidentexpurgatefacetiousfiduciary...

asdf 2024-09-11

32 Items: D=m/vRock that forms as magma coolsRock that forms from heat and pressurebuilding Process of creating mountainsboundary Where two tectonic plates meet.Most sedimentary rocks form in layers known as ________.The process that turns any rock into magma by adding heat.Occurs when sediments settle on the ground or a body of water...

Earth and Space Science 2025-04-14

10 Items: GLACIER : A large, slow-moving mass of ice formed from compacted snow.AXIS : An imaginary line around which Earth rotates, causing day and night.MAGMA : Molten rock beneath Earth's surface that can form lava when erupted.ORBIT : The curved path of a planet or satellite around another celestial body....

Restaurant 2025-06-17

20 Items: – The cup used for drinks.– A tool used to cut food.– A tool used to eat food.– A person who makes the food.– The main cook in the kitchen.– The room where food is cooked.– The flat dish where food is served.– Where customers sit and eat their food.– A tool used for eating soup or dessert.– A list of food and drinks you can order....

Tracksuit Word Search 2024-11-21

11 Items: A subject that includes algebra, geometry, and calculus.Garments worn to cover your feet and ankles, often in pairs.A large piece of cloth or fabric that covers part of the floor.A sweatshirt with a hood, often worn for casual or sporty looks.A sweatshirt with a hood, often worn for casual or sporty looks....

bones 2024-05-21

15 Items: the jaw or jawbone.any bone of the wrist.protect your internal organsThe area of the body below the abdomen.located in the central part of the chest.the skeleton of a person's or animal's head.lower limb extending from the hip to the kneeouter of two bones of the lower leg or hind limbone of the three bones that make up the hip bone...

December Safety 2024 2024-12-11

15 Items: Acronym for ground fault circuit interrupters.. Repair or replace _____ equipment immediatelyLabel all circuit breakers and ____ boxes clearly.Do not use outlets or cords that have exposed ______.Indoor ______ should not be used outdoors and vice versa.Do not block access to panels and _____ breakers or fuse boxes...

Marine Science Word Search 2025-01-15

25 Items: South American, Canadian, PacificWhat is the main way that surface currents form?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

Diwali word search 2025-10-20

11 Items: I am a synonym to the festival of of lights. (Hindi)I’m a tiny sun in a clay bowl, sipping oil to keep my glow. (Hindi)Bells and blooms at sunrise door—hands together, hearts adore. (Hindi)I crack, I pop, I paint the sky. Cover your ears when I fly. (English)laddu, barfi, gulab jamun, ras malai etc. A treat for everyone. (Hindi)...

Very_Hungry Word Search 2024-07-09

25 Items: Tasting very goodCut off all the hairYour brothers and sistersChanged into something newTo push air out of your mouthTo say yes to an idea or planTo hit something with your footFeeling a strong need to eat foodFlat dishes used for serving foodWith each other, in the same placeTo make something separate into pieces...

Igneous Word Search 2025-12-08

24 Items: What are visible rock layers called?What common mineral is found in sand?What is the outermost layer of the Earth?What landform erupts lava, ash, and gases?What process moves weathered rock and soil?What layer of the Earth is beneath the crust?What is the center layer of the Earth called?What word describes waves created by earthquakes?...

General Knowledge 2023-09-08

33 Items: A group of islands.The genetic code of life.The study of celestial objects.A ruler, often a king or queen.The study of heredity and genes.The study of ancient life forms.A cloud of gas and dust in space.The variety of life forms on Earth.A cultural revival and rebirth of art.A dramatic change in form or appearance....

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

osteichthyes 2025-04-30

23 Items: anemones.activities.fertilization.class of fish characterized by bony skeletons.Fish that migrate from freshwater to the ocean to spawn.Organs used by bony fish for extracting oxygen from water.An air-filled sac in many bony fish that helps control buoyancy.The tail fin, the main source of propulsion for forward movement....

Unit 9 APES Review 2024-05-01

20 Items: Remove fly ash using high volume platesOne of these is equivalent to 1000 wattsComb through pollutants with other substancesThe nuclear process of breaking the bonds in an atomOne of these is equivalent to 1 million watts or 1000 kwNumber of half lives it takes for radioactive material to decay...

New Year's Resolutions 2023-12-14

1 Item: Auld Lang Syne, Smash plates, Dress in Dots, Lucky grapes, Wear white, open doors and windows, carry empty suitcase, burn scarecrow, polar bear plunge, make some noise, fireworks, drop whipped cream, Times Square ball drop, light sparklers, midnight kiss,

Vocabulary Review: Units 6 & 7 2025-11-15

22 Items: a score of zero in sportsa machine that makes a room warma long stick used in golf to hit the balla cold cupboard that keeps food and drinks fresha machine that moves air to make a room feel coolera small machine that heats and browns slices of breada machine that washes plates, glasses, and cutlery for you...

Vocabulary Review: Units 6 & 7 2025-11-15

22 Items: a score of zero in sportsa machine that makes a room warma long stick used in golf to hit the balla cold cupboard that keeps food and drinks fresha machine that moves air to make a room feel coolera small machine that heats and browns slices of breada machine that washes plates, glasses, and cutlery for you...

Environment Word Search 2025-12-10

39 Items: a small, narrow rivera net made by a spiderthe land next to the seanot harming the environmentcompletely broken or damagedthe colorful parts of a flowerthe height of the sea’s surfacea very large body of salt waterthe layers of air around the Earththe soft covering on a bird’s bodythe thick hair on an animal’s body...

Evaporation Word Search 2025-01-23

25 Items: How many maine plate tectonic locations are there?Which part of the water cyle does gas turn to liquid?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

Marine Science 2 Word Search 2024-11-18

42 Items: To dry out.Slow sinking.A forest of mangrove trees.Being out of air and submerged.Water of intermediate salinity.A gas-filled bladder in seaweeds.Animals that burrow in the substrate.A current that is generated by tides.Being out of water and exposed to air.The intensity of the impact of a wave.A fleshy plant that accumulates water....