technology Word Searches

Word search 2025-05-23

8 Items: Which warehouse KPI measures the percentage of correct items picked and shipped.Which supply chain model emphasizes responsiveness and flexibility in volatile markets.Which technology enables secure, tamper-proof data sharing across supply chain partners.What forecasting technique uses machine learning to detect patterns and predict future demand....

Chapter 2 - Age of Exploration - myWorld Social Studies 2023-01-26

16 Items: great harma conquerorto travel completely aroundan instrument used in navigationa person who buys and sells goodsa settlement far away from the country that rules ita group of nations or peoples ruled by a single authoritythe process of charting a course for a ship or an aircraftan organized group of people taking a journey for a purpose...

Media Literacy Vocabulary Detective! 2024-06-17

1 Item: internet, plagiarism, authentication, security, phishing, copyright, cyberbully, netiquette, malware, citation, upstander, credibility, encryption, firewall, blockchain

Word search 2025-05-23

8 Items: Which warehouse KPI measures the percentage of correct items picked and shipped.Which supply chain model emphasizes responsiveness and flexibility in volatile markets.Which technology enables secure, tamper-proof data sharing across supply chain partners.What forecasting technique uses machine learning to detect patterns and predict future demand....

School 2026-02-11

189 Items: PenClubDeskExamQuizRuleTestTripBreakChairClassCoachEmailEssayGradeNotesPaperTutorAgendaBinderCampusCourseDebateFolderHealthLaptopLockerMarkerMentorOfficePencilPolicyRecessReportReviewSafetySchoolSeniorAbsenceAlgebraBiologyCollegeDiplomaEnglishFacultyHistoryJanitorJournalLibraryMeetingPlannerProjectReadingRespectScienceStaplerStudentSubjectSuccess...

Innovation, Startups, and Entrepreneurship 2025-04-14

10 Items: Startup : A new business venture, typically a technology-based company.Incubator : A program designed to help new businesses grow and develop.Venture : A risky or daring business undertaking, often involving innovation.Innovation : The introduction of new ideas, products, or methods that create value....

Radiology Wordsearch 2025-03-17

16 Items: Job that requires math skillsExam that is required for radiologistsMost common degree for a CT technologistOrganization that certifies dosimetristsRadiologic technicians work with this equipmentAn organization that certifies MRI technologistsAverage hours a radiologic technician works a weekExpected job growth for radiation physicists (percent)...

SPP 203 WORD SEARCH PUZZLE 2025-02-27

10 Items: The study of human measurements for designing ergonomic spaces. (One word)The study and preservation of historic buildings and cultural sites. (Two words)A specialized service focused on controlling sound within a building. (Two words)A process of studying wind and sun patterns to optimize building design. (Two words)...

Scientific Terms Word Search 2023-05-16

20 Items: the highest point of a waveWhat unit waves are measured inthe way transverse waves travelThe unit frequency is measured inwhat you divide by to find frequencyThe force that draws objects to earththe substance that a wave travels throughThe horizontal lines on the periodic tableThe type of reaction when heat is released...

HYDROPONICS 2025-04-03

20 Items: A method of growing plants without soilA substance added to plants to improve growthThe process of a seed developing into a plantUsing minimal resources to achieve maximum outputSupplying water to plants through artificial meansYoung vegetable greens harvested at an early stageA system where plant roots are misted with nutrients...

Science Word Search 2026-04-10

190 Items: gasTinatomcelldataGoldheatIronLeadmassmassNeontestZincArgonBoroncycleearthforceforceneuroplantRadonsolidspeedXenonanimalBariumCarbonCeriumCesiumCobaltCopperCuriumenergyErbiumethicsHeliumIndiumIodineliquidmotionnewtonNickelOsmiumOxygenprotonRadiumsafetySilverSodiumSulfurtheoryanalyseanatomyArsenicbatterybiologyBismuthBohriumBromineCadmiumCalcium...

MK-Ultra Overview 2025-02-10

1 Item: drug, mind control, ideology, perception, brain, propaganda, government, technology, torture, secret, cia, abuse, project, computer

Acronyms for Medical Coding Governing Organizations 2025-03-15

35 Items: Nurse PractitionerPhysician AssistantOffice for Civil RightsElectronic Health RecordAdvance Beneficiary NoticeCurrent Dental TerminologyEvaluation, and ManagementAmbulatory Surgical CentersOffice of Inspector GeneralAmerican Medical AssociationCertified Professional CoderLocal Coverage DeterminationNational Provider Identifier...

Astronaut Word Search 2025-08-13

50 Items: Space where data is saved.A place to organize files.Connected to the internet.Creating software using code.The display area of a device.Not connected to the internet.A copy of data kept for safety.A portable touchscreen computer.The physical parts of a computer.Software used to access websites.Online storage for files and data....

Medical Marijuana & Chronic Pain 2025-11-25

1 Item: THC, CBD, CHRONIC PAIN, NURSING, EDUCATION, SAFETY, TELEHEALTH, STAFFING, GUIDELINES, DOCUMENTATION, SYMPTOMS, TRAINING, TECHNOLOGY, ASSESSMENT

BSFDE S 70 2025-11-12

20 Items: A global streaming company exampleAdapting a product to fit a local marketA company that operates in multiple countriesThe main technological driver of globalizationA major benefit of globalization for consumersA positive impact of globalization on educationtrade Global business cooperation between regions...

PLATE TECTONICS 2026-01-09

15 Items: What type of plates are found beneath land?What type of plates are found beneath the oceans?What giant landmass existed 250 million years ago?What is the name of the moving pieces of Earth’s crust?What is the soft, molten layer beneath the lithosphere called?What type of boundary occurs when plates slide past each other?...

movie genre 2024-07-19

15 Items: Movies focused on solving a crime or unraveling a puzzle.Movies centered on love stories and romantic relationships.Movies focusing on realistic characters and emotional themes.Movies where characters sing and dance as part of the narrative.Films presenting factual information or documenting real-life events....

FIND WORD 2026-05-20

8 Items: The main source of solar energy. (Sumber utama dari energi surya).Another word for energy or electricity. (Kata lain dari energi atau kekuatan listrik).Solar cells convert sun... into electricity. (Sel surya mengubah ... matahari menjadi listrik).Photovoltaic ... are the small parts inside a solar panel. (Bagian-bagian kecil di dalam panel surya)....

A- Word Search 2023-01-25

26 Items: Kinetic Engineer: A kinetic engineer is an engineer that emphasizes on heat and mass transfer and deals with the process of design.Utility Engineer: A utility engineer is a civil engineer who works for a utility company, such as a water, gas, or electric company....

Ai and Technology Wordsearch 2026-04-05

1 Item: Intelligence (AI), Machine Learning, Deep Learning, Neural Network, Training, Data, Model, Prediction, Algorithm, Pattern, Input, Output, Accuracy, Error, Learning Rate, Feature, Label, Classification, Regression, Clustering, Automation, Chatbot, Language

Invisibleaudience Word Search 2024-10-18

11 Items: VPNincludes our emotional, psychological, and social well-beinga hacking method that uses trial and error to crack passwordsthe pursuit of an intentional and healthy relationship with technologysecurity or authentication credentials that are used to access the Software...

Test 2025-05-12

207 Items: webeitbyatofmytryoldageourhottooperusedayoutrednewsixyetsetn'ttwoveryfillknowcasefindstopareapassbodygirlfundgoodmorerulewiderisklongwhatmainsamefromteamfourroomitempagefilmtrippoorthatnearrichlastoncetreebanktimenonehavethisboardshortlargemoviewhosesouthagentthesecleararguecloseofferstoreamongtrialpriceleastagainleaveunderreadywouldphonesoundserve...

PTE STANDARD ONE 2023-03-30

1 Item: Governance, Interprofessional, interview, hiring, voice, together, ethical, concern, community, health, technology, teammate, peach, pathway, excellence, standards, Nursing, Practice, involvement

word search 2025-09-02

1 Item: - Automation - Robot - Data - Network - Learning - System - Processor - Neural - Analytics - Prediction - Software - Hardware - Model - Task - Recognition - Code - Technology - Machine - Intelligence

Amazon founded 2026-05-08

21 Items: AndyCurrent CEOThe year it was foundedBezos- The founder of AmazonWashington- Where Amazon was foundedElectronic reader developed by AmazonThe original workspace for the companymillion- current monthly Amazon app usersCloud based AI assistant created my AmazonAmazon developed the Kindle, Echo, and AlexaA smart speaker that was developed by Amazon...

Nursing Burnout 2025-04-10

13 Items: Programs that alleviate stress and burnout among nursesQuality technology, ongoing training, supportive leadershipMotivating, identifying areas of improvement, model exemplary behaviorIn order to reduce the administrative burdern contributing to burnout:Supporting leaders, peers, providing feedback, contributing to cohesive environment...

Unconference 2025 2025-08-05

10 Items: Working together with others to achieve a shared objectiveThe ability of an organization to keep its employees over timeThe process of developing new ideas, methods, or products to improve outcomesThe conduct, behavior, and attitude expected of someone in a professional setting...

Medical Marijuana Use for Chronic Pain Management 2025-11-30

10 Items: Which body system is interacted by cannabis to regulate pain?Which plant is used in medical marijuana for chronic pain management?state-level guideline for nurses to follow when administering medical marijuanaa technology that allows for remote follow-up and consistent cannabis monitoring...

word search 2025-09-02

1 Item: Automation Robot Data Network Learning System Processor Neural Analytics Prediction Software Hardware Model Task Recognition Code - Technology Machine Intelligence

word search 2025-09-02

1 Item: - Automation - Robot - Data - Network - Learning - System - Processor - Neural - Analytics - Prediction - Software - Hardware - Model - Task - Recognition - Code - Technology - Machine - Intelligence

Vocab Word Search 2022-09-08

20 Items: to ask a questionthe act of hunting for factsthe size or amount of somethingto work effectively with othersmodel a constructed model of somethingmodel a picture that represents somethinga guess or hypothesis based on observationsa factor in an experiment that affects the outcometools and supplies needed to conduct an experiment...

EDU 200 Chapter 3 Vocabulary 2024-07-01

15 Items: a person's ancestrytechnology that adapts to support students with disabilitiesa rigid, simplistic caricature of a particular group of peopleimmigrants who are fleeing unsafe conditions in their home countriespart of the inclusion process whereas you work with other professionals...

EXERCISE 130326 2026-03-13

15 Items: What group of scholars developed critical theory in the 1920s?Which philosopher helped develop the foundations of critical theory?Which theory challenges systems of power and inequality in communication?Which scholar introduced the concept of the public sphere in communication?...

Wuxi Word Search 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

STATISTICS STRAND WORD SEARCH 2026-04-30

15 Items: The raw information collected for analysis.How often a particular value or event occurs.The value that appears most frequently in a data set.A conclusion reached based on evidence and reasoning.A mark used to record frequency usually in groups of five.The mathematical rules apps use to decide what content to show a user....

Gardner Denver Thomas 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Globalization 2025-08-05

1 Item: Tariff, Economic, united nations, Cultural, Transportation, immigration, import , export, world bank, liberalization, international, business, company, urbanization , communication, trends, Market , supply, technology

GE4 Review wordsearch 2026-05-19

32 Items: A heavy snowstorm.A colorful plant part.The study of the past.To keep something safe.To use old things again.It helps you find places.Earth is our home ______.A long time without rain.Dirty air, water, or land.A sandy place near the sea.A large area full of trees.Sleeping in a tent outdoors.A strong spinning wind storm.Too much water covering land....

TOPIC 8: APPLICATION PORTFOLIO MANAGEMENT 2024-05-08

20 Items: Simplifying the APM process with automated data collection.Identifying and managing IT software applications company-wide.Formulating an EA vision that makes business objectives feasible.Determining which applications do not support business capabilities.Benchmarking to ensure a company is as efficient as its industry peers....

RLSolution Word Search- match the clue to the appropriate reporting channel. Turn in by 3/30/2026 to Jenna! 2026-03-25

24 Items: ‘CATCH ALL’ REPORT LOGHARM RELATED TO A STAFF MEMBERRELATED TO THE PHYSICAL BUILDINGUSED FOR AN ‘ALMOST HAPPENED’ EVENTLIFE EVENT RELATED TO MOTHER & BABYHARM OR ISSUE RELATED TO INTERVENOUSHARMFUL EVENT RELATED TO A MEDICATIONAREA TO REPORT ISSUES IN DELAY OF CAREUSED FOR ANY POTIENTAL NHSN REPORTABLESREPORT FOR ANYTHING RELATED TECHNOLOGY WISE...

Social Work Ethics Word Search 2025-07-02

1 Item: SERVICE SOCIALJUSTICE DIGNITY WORTH RELATIONSHIPS INTEGRITY COMPETENCE CONDUCT ADVOCATE RESPECT VALUE VULNERABILITY WELLBEING PRACTICE TECHNOLOGY CODEOFETHICS SELFDETERMINATION INFORMEDCONSENT CULTURE CONFIDENTIALITY DISCHARGE RESILIENCE

Rise of Civilizations 2025-10-14

1 Item: technology hierarchy specialization rivers silt government trade complexity tools mesopotamia systems society culture agriculture surplus population domesticate monarchy economy neolithic paleolithic bronze age

VOCABULARY UNIT 1 - INTERESTS 2025-02-21

21 Items: SportsGeneral Interests- Physical activities involving skill and competition.- A winter sport involving sliding on snow using skis.- A sport where players roll a ball to knock down pins.- Popular styles of clothing, accessories, or appearance.- Activities or subjects that someone enjoys or finds engaging....

Imperialism Word Search 2026-01-21

20 Items: What local people were forced to work for at low ratesMaterials taken from colonies alongside rubber and oilA major region where 19th-century imperialism took placeThe type of mission used to justify spreading European cultureOne of the primary ways imperialism harmed colonized societies...

Ted Talk Vocabulary 2026-05-13

19 Items: Great in number; many.To look for, search, or try to find something.More and more over time; becoming increasingly common.A group of objects, stories, or data brought together.A feeling of being incredibly interested in something.A particular way of doing something, like a new study method....

Workplace Incivility 2024-11-30

10 Items: an authoritative rule dealing with details or procedure.relating to relationships or communication between people.the person who leads or commands a group, organization, or countrythe action of working with someone to produce or create something.a state of emotional, physical, and mental exhaustion caused by excessive and prolonged stress....

Supply and Its Determinants 2026-06-17

10 Items: A place or system where buyers and sellers trade goods, services, or resources.Individuals or businesses that create and supply goods or services to the market.A non-price or price factor that influences and causes a change in the supply of a good.The graphic representation of the relationship between product price and quantity supplied...

Expand Your Horizons 2026 - Word Search 2026-03-12

15 Items: You are a future LEADER.'CTE' stands for "Career _______ Education."_____________ is considered the "birthplace of [answer to Q1]."60 units will make you eligible to receive an ____________ degree.If you're doing a research project, you may present it at _________.One of the common workshops at the Skyline College "Fab Lab" is _______________....

INDUSTRY 2024-10-26

1 Item: production, supply chain, logistics, engineering, automation, workforce, machinery, quality control, innovation, research, development, construction, technology, safety, standards, sustainability, operations, trade, efficiency, distribution, market, compl

Spatial PhenoSearch! 2023-08-10

10 Items: Proteins that are activated in the same cell.Natural emission of light by biological structures such as tissues.Overlapping excitation and emission wavelengths of two or more fluorescent dyes.Emission filters that capture the peaks and part of fluorophore emission wavelengths....

Breakthrough Inventions and Innovations 2025-04-14

10 Items: MICROSCOPE : An instrument used to view objects too small for the naked eye.3DPRINTER : A machine that creates three-dimensional objects by adding material layer by layer.FUSION : The process of combining two atoms to form a heavier atom, releasing vast amounts of energy....

Cyberbullying Word Search 2024-05-20

12 Items: Pretending to be someone else to deceive, manipulate, or harm them online.Publicly humiliating someone online for their actions, appearance, or beliefs.Repeatedly sending hurtful messages or threats to intimidate or distress someone online.Intentionally leaving someone out of online activities or groups to isolate and hurt them....

Business, Word Search 2023-09-15

1 Item: Financial, Management, Sales, People, Leadership, Interpersonal, interest, Sustainability, governance, innovation, Strategy, growth, Corporate, Venturing, Marketing, Disruption, Technology, Operations, HR, Customer, Development, Digital, Models, Cybersecu

GAME PUZZLE 2024-05-04

1 Item: excited cultural disappointing dental tradition pottery jet yatch helicopter tablet battery storage stressful weight unidentified waste invention technology journalist recognize navigate disaster mansion scared surprised tiring

TEXAS'S COMPLICITY IN GENOCIDE 2025-12-04

27 Items: Popular name for San AntonioFounder of Cornerstone ChurchThe real name of SATX's sister cityFormer mayor who visited Israel in 2017County commissioner who visited Israel in 2025Amount of tax dollars sent from Texas to IsraelFormer mayor who visited occupied Jerusalem in 2011Refunds for energy spending that HOLT Renewables got....

CAREER READINESS WORD SEARCH 2024-08-26

1 Item: ARCHITECTURE, MULTIMEDIA, COMPUTERS, EDUCATION, ENERGY, FINANCE, GOVERNMENT, HEALTH, HOSPITALITY, HUMAN SERVICES, TECHNOLOGY, LAW, PUBLIC SAFETY, MANUFACTURING, MARKETING, ENGINEERING, TRANSPORTATION, HOLLAND CODES, CAREER KEY, OCCUPATION, NAVIANCE, BRIDG

Augmentedreality Word Search 2026-06-30

14 Items: Processing data physically closer to the end user to minimise delay.The time it takes for data to travel from source to destination; delay.Analysing data to identify failing components before they actually break.A physical break in an optical cable that can cause serious network failure....

PROFESSIONS 2025-03-16

1 Item: Architect, Artist, Biologist, Carpenter, Chef, Civil Engineer, Data Analyst, Dentist, Doctor, Electrician, Environmental Scientist, Financial Analyst, Graphic Designer, Historian, Human Resources Manager, Information Technology Specialist, Journalist, Law

IRS Puzzle 2024-12-17

25 Items: M in MIR stands forThesaurus stands for ________A video consists of a sequence ofweb scale discovery services provide?A search system is called a __________ system.the process of removing stop words from a query?Information System Consists of __________ programsimilarity between two vectors by measuring Angle?...

business professionalism 2025-09-18

20 Items: is an expert in their area of work.is a desired result of a person’s effort.using words or sounds to express yourself.writing information to share with somebodyattitude you project with your speed of speechsomething you want to accomplish in the future.something you want to accomplish in the near future....

BBB4M1 Final Review: Unit #2 - Economic Systems, Economic Goals & The Business Cycle and Classifications of Economic Development 2026-06-16

22 Items: The central bank in Canada.When the government uses spending and taxation to help manage the economy.Is the amount of goods and services you can buy with a specific amount of money.The general rise in prices over time, which means your money buys less than before....

Vocabulary 1 2026-06-26

18 Items: hard (v) - to study a lotof (adj) - liking something a lot(n) - a play in a theatre or on television(v) - to tell someone they should do somethingin homework (pv) - to give work to your teacher(n) - a restaurant in an office, factory or schoolup (pv) - when classes finish and the holidays startup (pv) - to start doing a particular activity or job...

Dystopian Fiction Literary Conventions 2026-02-20

15 Items: Prolonged cruel or unjust treatment by those in powerThe act of fighting back or refusing to obey an unfair governmentThe struggle to stay alive in a dangerous or resource-poor environmentThe act of carefully watching someone, usually through cameras or spies.A confined space, like a wall or a dome, that keeps citizens from leaving...

Chapter 15 Vocab 2026-05-13

15 Items: Indian soldiers who served in the British colonial army.The working class in society, especially industrial laborers who earn wages.The right of foreigners to be exempt from the laws of the country in which they are living.The belief that stronger nations or people naturally dominate weaker ones through competition....

Welcome to Family & Consumer Science 2025-04-11

1 Item: career, research, community, culinary, family, technology, nutrition, development, personality, friends, support, emotions, life skills, manage, resources, meal planning, budget, wellness, child care, culture, career, consumer, entrepreneur, housing, inte

Nursing Shortage 2024-04-07

15 Items: What primary focus guides the efforts of nurses in healthcare settings?What term describes the insufficient number of available nurses in healthcare settings?What strategy aims to keep nurses in their current positions within healthcare institutions?What paramount concern guides the actions of nurses and healthcare providers in their duties?...

Socioeconomic Disparity Word Search 2023-11-29

4 Items: What type of disparity refers to the unequal distribution of economic resources and opportunities among different individuals or groups within a society?What is the communication model discussed in the presentation that helps determine the extent of a patient’s understanding of health information and instructions?...

Interactions of Light that matter 2026-04-21

12 Items: the turning back of a wave at a boundary created by matterthe loss of a wave when its energy is transferred to matterthe bending of a wave when it crosses a boundary created by matterThe scientific study of the nature and properties of matter and energy.the movement of a wave through matter without its energy being transferred...

School 2026-02-11

250 Items: GymPenClubDeskExamQuizRuleTestWiFiBreakChairClassCoachEmailEssayGradeLunchNotesNursePaperStaffTutorVideoAgendaBinderCampusCourseDebateFolderLaptopLessonLockerMarkerMentorOfficeParentPencilRecessReportReviewRewardSafetySchoolSeniorSpeechSportsSurveyUpdateAbsenceAlgebraArtRoomBiologyCollegeDiplomaEnglishFacultyHistoryJanitorJournalLibraryMeeting...

Digital Citizenship 2024-09-12

22 Items: Software that damages a device or steals informationInformation that isn’t true, often created to trick peopleA person who uses a fake online persona to gain the trust of someone else.Software designed to gain unauthorized access to and disrupt or damage a computer system...

Exploring the Consequences of Nursing Burnout on Nurse Well-Being and Patient Care 2023-12-02

8 Items: What can raise awareness about the signs of burnout, encouraging early intervention and support?Which kind of empowerment for nurses increases the ability of nurses to confidently mitigate the consequences of burnout?_________ effort is required to encourage a more positive workplace environment and decrease the impacts of nursing burnout....

Academic Word Search 2026-03-08

250 Items: ARTBUSFUNLABTAGBANDBELLBOOKCLUBDATADESKDOOREXAMGLUEHALLIDEALOCKNOTEPLAYQUIZRICETEAMATLASCARDSCHAIRCHESSCLASSDRAMAESSAYFOCUSGAMESGOALSGROUPMEDALMUSICRULESSLIDESTAGESTUDYTRACKTUTORBINDERBURGERCODINGDEBATEEFFORTERASERFRUITSHEALTHLAPTOPLOCKERMARKERNAPKINOFFICEPENCILRECESSREVIEWSAFETYSOCCERSPORTSSTAIRSTABLETTROPHYVIOLINWARMUPADVISORALGEBRAARTROOMBIOLOGY...

Space Word Search 2025-11-01

250 Items: tosuesuntaptaxteatenthetietiptoetootopspinspotstarstaystepstirstopsuchsuitsureswimtailtaketaletalktalltanktapetaskteamtearteentelltendtenttermtesttextthanthatthemthentheythinthisthustimetinytiretonetoolspacespeakspeedspendsplitsportstaffstagestairstakestandstarestartstatestealsteelstickstillstockstonestorestormstorystripstudystuffstylesugarsuper...

Gis Word Search 2025-12-19

1 Item: geospatial mapping cartography spatial coordinates GPS remotesensing data analysis visualization python programming software technology database SQL automation webgis arcgis qgis layers metadata surveying satellite raster vector cloud computing api intern

My Motion and Machine word search. 2025-10-18

16 Items: to put togetherto go up and outa machine that helps lift thingsplane- a machine that moves objectsa simple machine that goes up and outis a movement from one position to another.( The scientist) First Law of Motion states:- is any applied force that moves an object.- are any type of device/technology that makes work...

Review the words 2025 2026-03-16

250 Items: sameramenleavefirstmeterweighIndiaorderthickearlylivesnoodlegoldenflightarrivearoundyou’lldollarmosqueflavorspeechbutterforgetcreatecareerchooseprettytaughtadjustsecondcrispyeasilyreasonshadowcandlelittleweightspringresulteffortwisdomadvicememberfollowshowercouplefinishshoulddesignbottlepublicusefulremovecenterspreadfathertriviasurveyanswerunique...

MWB Word Search 2026-06-01

27 Items: One bottle of Argan oil in each Jar#1 Luxury Haircare Brand in the WorldBarrier Boosting line of skincare productsProfessional quality with affordable pricesAims to make haircare a ritual like skincareQuickly became the #1 selling spf at SephoraProducts mimicking clinical Korean procedures#1 Brand for Heat Styling Products to Reduce Frizz...

EV3 Robotics Vocabulary 2023-05-09

16 Items: to take apart.provide linear mobility for a robot.detects rotational motion on a single axis.any command or group of commands in a program.to build by putting parts together; to build; to create.specific areas for connecting sensors and motors to the EV3.the primary source of physical motion in the Mindstorms EV3system....

word search 2025-09-14

13 Items: a statement or legal documentfalse or inaccurate informationnegative reviews, poor reviews, unfavorable reviews, or bad feedbackdetails that allow someone to get in touch with you or an organizationthe use of technology to harass, threaten, embarrass, or target another person...

US History Eras 2024-12-02

10 Items: 1890s to the 1920s - period of political and social reform1929-1939 - period of economic crisis and government response with New Deal programs1945-1991 - the power struggle between the Soviet Union and the United States after World War II...

Pizza Again Word Search 2025-03-30

21 Items: Where was pizza first invented?What is a white pizza typically made without?What is America's least favorite pizza topping?What unusual pizza topping is popular in Japan?What unusual pizza topping is popular in Sweden?Which country consumes the most pizza per capita?On what continent was the tomato first discovered?...

Week 1 Key Terms Word Search 2023-08-07

15 Items: Electrical cycles per secondGlobal de facto wireless networking standardThe measurement between triads on the displayLong-term storage device that plugs into the motherboardCompact and cheap storage device that can store a lot and are easy to useRoutine that is burned into a flash memory chip located on the motherboard...

Networks 2026-03-25

31 Items: The largest WAN accessible to the public.This is a network that covers a larger geographical area.refers to all of the devices that are connected to the internet.is a set of agreed rules that state how to format, send and receive data.A company that provides Internet access to homes, schools, and businesses....

Biomedical Engineering Word Search 2026-03-23

14 Items: To make better or as good as you canA minimum requirement for how the design must functionA desirable outcome given up to gain another desirable outcomeIn engineering design, some-thing that limits the solution to a problemA series of steps that engineers follow to come up with a solution to a problem...

Chapter 6 Word Search 2024-03-14

10 Items: Designing and producing e-books or printed books using book development software.A group of slides created in a digital presentation software (ex.PowerPoint, Google Slides).using software to produce documents with elaborate control of the form and appearance of individual pages....

Impact Foundation - U3 - Vocabulary 2026-01-22

23 Items: To make something better.To create a picture in your mind.You feel it when something hurts you.It may happen when someone is really sad.Connected to or done through the internet.Able to be changed to another place or position.To change your position from one place to another.To keep something in your hands so it doesn’t fall....

Antropology 2025-12-04

18 Items: – to come together (usually in community)– the study of past peoples and past civilizations.– the study of a person’s individual or familial past– changes that occur as a result of changes in the environment.– beliefs or rituals passed down from one generation to the next– a large population of people organized into a collective society...

RPMS 2024-06-07

25 Items: I DON’T CAREI DON’T LIKEI DON’T BELIEVEADDRESS THE ISSUEI DON’T UNDERSTANDDETERMINE THE TYPE OF ISSUEEMPATHIZE WITH THE PROSPECTDISCOVER THE SOURCE OF THE ISSUEthe prospect’s commitment to join the Navythe prospect’s future plans and life pressureswill have oversight of the National Inspection Team (NIT)....

Word Search Grid: William Shakespeare 2026-05-06

20 Items: The idea that life itself is like a performance trace this metaphorA word he invented that describes sadness or dullness identify itShort poetic forms numbered in triple digits find the term for these poemsA day that marks both his birth celebration and death find the date...

Combating the Opioid Crisis 2026-04-05

33 Items: A medication that blocks opioid effectsInvolving multiple healthcare professionsMoral principles guiding nursing practiceRemote healthcare services using technologyA medication used to reverse opioid overdosesMedications used to treat opioid use disorderSymptoms experienced when stopping opioid useA partial opioid agonist used in OUD treatment...

October Security Summit Wordsearch (Harder) 2023-08-18

20 Items: What term means having permission or approval to access something?What is the unique address used to identify a location on the internet?What term refers to the ability to enter or use a system, service, or area?What term describes a widely accepted or established norm or specification?...

Repaso 3 2026-05-18

38 Items: To assist another personA person who tells the truthThe Spanish word for technologyTo upload files to the internetA portable touchscreen computerTo argue or debate with someoneHelpful guidance or suggestionsThe part of a device you look atTo search or browse the internetTo add power to a device batteryA phone call with video and audio...

The Executive Branch 2025-12-01

21 Items: second-in-command to the presidentthe person in charge of the Executive Branchthis is the number of years for one presidential terma rule or command the president gives out that has the force of lawofficials who represent the United States government in other nationsthe power of the president to cancel a proposed law written by Congress...

"A Revolutionary Era" Word Search 2026-04-19

33 Items: Work or workersThe right to voteBetter, more advancedTo give out or make knownTo keep separate or aloneTo move to another countryA person with extreme ideasAn army of citizen volunteersThe ability to reach or attainPeople who buy and use productsThe feeling of unity as a nationTo step down from a powerful roleTo discuss and find common agreement...

words 2024-10-03

2 Items: audience a psychological state in which a person believes that others are actively watching or listening to the unique string of characters that identifies each computer using the Internet Protocol to communicate over a netwo information an act of logging...

Ethics 2025-11-05

18 Items: An imaginary line that separates me from you.How we define our relationships with clients.Doing what is right even when no one is looking.Our own moral principles that govern our behavior.The last step to setting boundaries is to trust your _________.ATC Company PREA policy has a _____ tolerance for PREA violations....

Computer Vocabulary 2025-08-26

20 Items: The physical parts of a computer.It receives and sends data on computer networks.A computer that provides data to other computers.A type of memory card typically used in digital cameras.Programs that tell a computer what to do and how to do it.It stores data and instructions while the computer is working....

Marketing - Branding Test - Use vocabulary words to complete word search. 2024-03-04

20 Items: gives the brand name, trademark, or logo.products that does not carry a company identity.the physical container or wrapping for a product.using packages to promote social and polital causes.two or more different products or services in one package.A specific type of brand mark, one with human form or characteristics....