plate tectonics Word Searches

Huge Thanksgiving Word Search 2026-05-31

100 Items: piecupfuncornchefforkbarncozymazefeastgravyrollsciderfloattableplatespoonacornwagonapplewheatgourdcrispscarfbootsmaplegamesmusicdanceturkeyautumnfamilycaringsmilesparaderecipebakingdinnersuppernapkincandleleavessquashforestmeadownaturejacketnutmegcookiebasketpicnicpuzzlecraftsseasonharvestpumpkinfriendssharingkitchenhayrideorchardsweaterbonfire...

Around My House 2026-08-07

100 Items: BedCupFanMopPanPenPotRugBookBowlCoatCombDeskDoorForkHookIronKeysKnobLampOvenSinkSoapTileVentAtticBenchBroomBrushChairClockCouchDryerFloorFrameGlassKnifeLightPaperPhotoPlatePurseSheetShelfShoesSocksSpoonTableTowelTrashCandleCarpetClosetDrawerHangerMirrorOutletPantryPillowRemoteShowerSpongeStairsTeapotToiletVacuumWasherWindowBathtubBedroomBlanket...

HOUSE 2024-11-12

100 Items: bedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashcandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindowbathtubbedroomblanket...

Turkey Word Search 2025-11-04

100 Items: DipFryHamPieTeaEggBakeBeefBoilCakeChefCornDishForkMealMenuOvenPeasRackSoupTrayWineYamsZestBeansBreadChipsCreamCrustFeastHoneyKnifeLunchPecanPlatePunchRoastRollsSaladSauceSnackSpoonSteakSugarSyrupTableTacosCandyApplesButterCheeseCoffeeDinnerDishesDrinksGarlicmuffinNapkinNibbleNutmegOlivesPantryRecipeSalmonShrimpTurkeyCookieBrownieCarrotsDessert...

Thanksgiving 2025-11-16

100 Items: EatNapPieBakeCornDishFarmFastFoodGoodHomeHopeLoveMealNutsOvenSideAcornAppleBeansBreadBrownCheerCiderFeastGourdGravyGreenHonorLoyalMaizeMercyPartyPeacePecanPlateQuietRoastRollsShareSpiceSweetTableAutumnBasketBountyButterChurchColonyDinnerDonateFamilyFellowFlavorFriendGatherGivingGobbleHealthHumbleLessonMemoryNativeOrangeParadePeoplePrayerRecipe...

HOUSEHOLD ITEMS 2026-04-03

101 Items: PanPotCupRugBedMopFanFaxOvenBowlForkSofaLampDeskSinkSoapIronDoorWallRoofMixerRangeStovePlateKnifeSpoonGlassTableCouchRadioShelfModemPhoneSheetDuvetTowelScaleAlarmDryerBroomFloorPorchFridgeJuicerKettleNapkinRemoteStereoCarpetBlindsRouterTabletPillowHangerMirrorShowerToiletFaucetShaverLotionHamperVanityWasherVacuumBucketHeaterWindowStairsGarage...

Wayaye 2025-12-04

11 Items: Liv's manBen's favourite ciderWhat is Hoz's first name?What street does Cryer live on?Price in £ of a drink on TuesdayName of girls uni WhatsApp groupName of strip club next to SwingersName of fish shack on Tynemouth BeachBest bar on Osborne Road - contentiousInstrument Joel plays (afters circa 2018)Object Brown threw at the wall of the boys house

Mat 2024-08-01

51 Items: mughameggjamfoodforkmilkmeatfishcrabpearsoupplateknifespoonglasscreamfloursugaronionsaladapplesaucecheesebutterspicespotatocarrotgarlictomatobananaorangecoffeesausagemustardketchupcabbageberriespancakesourmilkcucumbermushroomporridgeblueberryraspberrysandwitchvegetablesstrawberrycrisp breadbell pepperlingonberry

Portal + Portal Mods 2025-11-03

50 Items: MelGooRickCakeChellAEGISGradyAtlasApplePanelRadioGLaDOSTurretVirgilEmiliaP-BodyButtonPortalsRattmanApertureWheatleyStirlingCarolineBorealisFact CoreAnger CoreSpace CorePortal GunCohesiongelFaith PlateIncineratorCave JohnsonTest ChamberStorage CubeMorality CoreRepulsion GelFrankenturretCuriosity CoreCompanion CubePropulsion GelDiversity Vent...

Alex's Impossible word search 2026-05-29

107 Items: Funusabedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventcrazyatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashmonkeyafricacandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindow...

Monomer & Polymer Ch:11 2025-03-19

14 Items: MMAA nail file or bufferWhat is always coming but never arrives?Used to start the chain reaction that leads to curingHow many grains I'd sand are on the file per square inchWhat never asks a question but gets answered all the time?MMA creates the hardest and _____________ nail enhancement.When artificial products lift up or pull away from the nail...

TEST 2026-06-13

20 Items: passion,enthusiasmmember of the armyrandom ticket drawdo again , say againslightly wet and dampriches,plenty of moneycomputer typing devicephotocopy of a documentsearch for something,huntperson suffering or harmedsoap bubbles while washingsewing or stitching materialplate placed under a tea cupshort coat worn over clothes...

Earth and Space Science 2025-05-30

10 Items: A large, slow-moving mass of ice formed from compacted snow.Any form of water falling from clouds—rain, snow, sleet, or hail.The layers of gases surrounding Earth that support life and weather.Molten rock beneath Earth's surface that can form lava when erupted.An imaginary line around which Earth rotates, causing day and night....

Dean Vaughn Lesson 8 2025-02-07

19 Items: an ovaryquiet;calmnail bitingray;beam, spokepertaining to edemapertaining to the airany patch or flat areaspam of a finger or toepertaining to the lungsby the action of salivaexcision of a nerve rootpertaining to an alveolusto eat/eating, swallowinginflammation of the ependymathe act or process of calminginflammation of the wall of an organ...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

42 2025-08-17

15 Items: Motorcycle fuel.Decay on old bikes.Joining metal partsThin decorative paintPopular metal lighter.Place for fixing bikes.Tool for making tattoosCommon biker accessory.Custom bike build space.Sound device to alert others on the roadRear light that signals when brakes are appliedFrame component shielding the engine from damage...

Food unit 4 2026-02-09

51 Items: rizbolsacfritsainpuischipspâtestasseverrelaveractifrepasenfincitronviandetomatecoupersécherservirétalergarderstresspaquetcarottefromagepoissonbonbonslégumesajoutercouteauchoisirpositifrecetted’abordensuitemélangeréplucherassiettecuillèreen formeserviettedélicieuxbouteillefourchettealimentationthat ensuitefaire bouillirmatières grasses...

Find the Approved Abbrevation 2025-07-29

41 Items: GAVECALLEDSUBMITACCOUNTADDRESSADVISEDBALANCEE-ZPASSINVOICEPAYMENTPRIVATEVEHICLECUSTOMERREQUESTEDSTATEMENTVISA CARDCOMMERCIALSUPERVISORAPPLICATIONLOW BALANCEMASTER CARDNEXT OF KINNON-CONTACTTRANSPONDERINSUFFICIENTOUT OF STATEPAY BY PLATEREGISTRATIONDISCOVER CARDREPLENISHMENTBILL OF LADINGDELETE/DELETEDUPDATE/UPDATEDAMERICAN EXPRESSEXPLAIN/EXPLAINED...

S1 U5B Vocab 2026-04-30

43 Items: manoldmugnowtalllonghairsaltforkbillwomanyoungblacksugarspoonknifeplateblondepeppernapkinwaiterto wantdessertbrunettewaitressto bringdeliciousmain dishglass/cupred-headedto be warmto be coldrich/tastygray-hairedgood-lookingto be sleepyto ask/orderI would likeshort(length)other/anothershort(stature)traigo I bringI need/I'm missing

8th Deltaversary Word Search 2026-06-04

10 Items: A food from our classic line meal.Most recent degree obtained by an LSThe location of our first line trip.Number of LS's pursuing a MD or PhD.A shoe size is shared by multiple LS'sNumber of linesisters with no brothers.Three LS's have birthdays in this month.State where we spent our 5th Deltaversary.What orgs license plate was one of the line cars?...

pasatiempos 2025-10-01

13 Items: A ball is usually involved.Goggles help you with this.You close your eyes and rest.A controller is in your hands.You sit on the couch and watch.Headphones are perfect for this.You turn pages when you do this.You race your friends doing this.You need a plate and fork for this.You use the oven or stove to do this....

Rock Cycle Vocab 2026-03-31

11 Items: Breaking down of rock.Carrying away fragments of rockSmall pieces of broken-down rockRock formed from cooled magma or lava.Molten rock from beneath or above ground.The depositing/settling of rocks in layersRock transformed by extreme heat and pressure.Rock made from pressed-together sediment layers....

Plate Word Search 2026-03-03

1 Item: Plate

Jamestown Colonial America Vocabulary 2025-03-24

15 Items: The leader of a colonyA gun with a long barrelA person who made new shoesA large farm that grew cropsKnee-length pants worn by men.A craftsman who worked with iron.The ship that carried the PilgrimsA legal document issued by the kingA wooden plate used for serving food.A person who ground corn into cornmealThe first permanent English settlement...

Spelling Bee Level 1 2026-05-11

122 Items: skywokbangbarnchindatadawndinefairfateforkgoatgolfholyleftlimemailmeatmintmoodpainpartpathPeruplotpuckracerarerashrealreapsalescarshoeskimsnowsoilsolosongsumoswagtacttailteamtidetoneunitvasevinevoltwaitwashweakwildwirewormyelpyogazestblackbroadcabinchesscreekdancefleetfrontinletjellylemonmatchminceorbitpaintpartyplatepointpowerproveroyalrulersalad...

BLACKWOOD WORD KEY 2026-07-27

124 Items: godfaturnbediceredatehorngrewhallpondlookorbshillgrowgreydeafhiderackdeadbatsbledtombsouldarkseemhipsmaskacidmoonteardoorlatestundayshairhurtbellpinkbeammistbluebabybroodwrathhousedropstowerstoodwearyclingtokenhangstreesalonehookscreepotherblackcapeswhitecountfrownpantstrickdrainleaptaskewspicefeverneversyrupplatebloomsorrytreatpeelswrenchthrone...

Nail Disorders 2025-12-09

28 Items: nail biting (a compulsive habit)a bacterial infection that causes green nail.a minor injury when blood pools under the nailbrown or black discoloration in the nail plate.infection of the tissue folds around the nails.folded nail. A nail plate that is highly curved.nail disease that affects people with psoriasis....

Monsoon Word Search 2026-04-21

10 Items: The capital of IndiaA major river in IndiaBody of water south of IndiaHot, dry desert in northwest IndiaAreas where many people live (cities)Total number of people living in a placeAreas where people live in the countrysideThe largest continent where India is locatedA seasonal wind system that changes direction during the year...

21 2025-08-17

15 Items: Main public roadRoad Highway freedom.66 Historic U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vest...

21 2025-08-17

15 Items: Highway freedom.Main public roadHistoric U.S. highwayOldest motorcycle rally in U.S.Identification label or license plateFamous motorcycle rally in South Dakota.Formal process of becoming a full club memberSmall notepad or cushion, depending on contextLarge emblem worn on the back of a biker's vestEvent where new members receive their club patch...

minecraft 2026-04-19

140 Items: beecatfoxcowpigbowoakiceeyemappiefrogwolfgoatirongoldcoaldirtsandclaysnowleadcakebeefstewmilkblazeghastcamelhorsellamasheeplapisswordanvilchesttorchleverplatebirchgrasstotempearlclockbreadapplehoneyzombiewitherevokerhoglinpiglindonkeyquartzshieldsmokerbarrelhopperbeaconpistonbuttonsprucejungleacaciacherrycoarsepodzolgravelelytrasaddlecookiepotato...

minecraft 2026-04-08

140 Items: beecatfoxcowpigbowoakiceeyemappiefrogwolfgoatirongoldcoaldirtsandclaysnowleadcakebeefstewmilkblazeghastcamelhorsellamasheeplapisswordanvilchesttorchleverplatebirchgrasstotempearlclockbreadapplehoneyzombiewitherevokerhoglinpiglindonkeyquartzshieldsmokerbarrelhopperbeaconpistonbuttonsprucejungleacaciacherrycoarsepodzolgravelelytrasaddlecookiepotato...

BEARING CAPACITY 2025-09-29

12 Items: Weight / volumeThe force applied to the soil.The downward movement of a structure.The type of material supporting a structureThe level of water below the ground surfaceA factor related to water content in the soil.A property that resists deformation or failure.The structure that transfers the load to the soil....

Snow Terms 2026-01-08

12 Items: Of or having 6 sidesA small plane of an ice crystalThe outer edge of an ice crystalA flat, hexagon shaped, ice crystalwater in its gas form (gaseous state).The state of the air around something.Frozen water with a symmetrical structure.water that falls from the sky, in some form.A tiny bit of matter (dust, pollen, ash, etc)....

Y5O 2026-05-04

2 Items: necklace purse sell basket cookies spoon wallet potatonoodles snack sandals pretty plate pitcher carton yogurt straw cheese butter buy glasses fridge belt sneakers

Vocab Practice 3 Gabriel Tams 2024-10-08

43 Items: cuptipbowlforkcashtableplateknifespoonglasslunchmoneydrinksnapkindinnerTo eatTo addTo payTo sitTo cookTo sendTo drinkTo greetTo servechef/cooketiquettebreakfastTo behavesilverwarebill/checkTo receiveTo reservecredit cardgood mannersTo recommendTo have lunchTo have dinnerwaiter, waitressdate/appointmentTo have breakfastaccommodate/arrange...

year 9 week 5 2025-10-31

20 Items: The very hot centre of the Earth. Starting with a C. (4)The thin outer layer of the Earth. Starting with a C. (5)Fine particles from a volcanic eruption. Starting with an A. (3)The system that breaks down food for energy. Starting with a D. (9)Hot liquid rock that flows out of a volcano. Starting with an L. (4)...

5B List 2025-11-23

56 Items: manoldcupnowtalllonghairgrayeyesrichsaltforkbillmenuwomanyoungbrownblacksugarspoonknifeplateglassotherblondepeppernapkinwaiterI needto wantdessertI bringto orderwaitressto bringyoung manblue eyesto be hotdeliciousmain dishred-hairedbrown eyesgreen eyesto be coldyoung womanfor dessertshort~heightshort~lengthgood-lookingto be sleepyI would like...

Seinfeld 2026-07-15

20 Items: Jerry's mailman nemesis.Jerry's neurotic best friend.Jerry's closest female friend.George's excuse after swimming.The male bra Kramer tried to invent.Jerry's eccentric next-door neighbor.Frank Costanza's alternative holiday.The Christmas card error Elaine made.The diner where the gang always meets.The embarrassing shirt Jerry wore on TV....

Good luck buddy :] 2026-03-26

145 Items: :]KeyJarUrnUFOKegFishKiteTackSafeHookPuckPailMoonySunnyAlarmVoidyQuillQuiltWagonStampAnvilGavelPlatePlankGaugeCiderCageyVinylScrewKazooOrganYo-YoEaselRadarRanchDrillBanjoLanceStarryJanvexDominoShrimpFossilGirderCursorOutletBuzzerTurtleHurdleLocketCobwebAbacusKlaxonShovelScytheNapkinEmblemRacket13JOHVZXeropixZIPFileToolboxTorpedoCowbellRicotta...

Bone Words and Definitions 2025-11-06

10 Items: Process of bone formation.Cavities in bone matrix that house osteocytes.Compact bone making up most of the bone's length.Small needllelike pieces of bone that make up spongy bone.Flat plate of hyaline cartilage seen in young, growing bone.Concentric circles of lacunae situated around the central canal....

Caça-Palavras da Gabi 2025-04-21

160 Items: umdogcatcowpigbedpenbagkeycarcuponetwosixtenuvadezbirdfishduckfroglionbeardoorlampbookbikepearlimekiwiplumfourfiveninegatovacapatosapoleãoursomesacamamaçãpêralimakiwicocodoistrêsseisseteoitonoveonzedozehorsesheeptigerzebrasnakemousetablechairphoneclockspoonplateapplegrapepeachlemonmelonmangothreeseveneightpeixeporcotigrezebracobraportalápislivro...

PORTAL 2025-05-02

27 Items: an AIThe blue oneTurret OperaSpace? SPACE!the orange oneYummy, but fakefirst name DougBasically paintA mute test subjecta cube with a heartAlso known as an ASHPDAlso known as GLAaDOS.Portal's credits song.a bumbling British corea robot that shoots youAperture's Rival company.Thermal Discouragement Beamsa massive Turret with a crown...

Puzzle 5: Kitchen Tools 2026-08-17

1 Item: FORK, KNIFE, PLATE, BOWL, WHISK, GLASS, OVEN, PAN, POT, BLENDER

HCTRA 2025-09-05

1 Item: County Toll Road, Transponder, Inactivate, Reactivate, Team Strivers, Interoperable, Support team, Lead queue, License plate, Payment plan, Collections, Invoice, Partial plate correction, DMV mismatch, Suspicious activity, Prevented, Toll adjustment , Dis

Vocabulary Lesson 7 2022-11-08

11 Items: The coasts are _____ with fish.I _____ mushrooms and can't stand them!His/her rights must not be _____d upon.If you chew gum in Singapore, it is an _____.After robbing a bank, the criminal _____ed to Canada.It's common to have a long set of data before _____ing a trend.The _____ texture of sandpaper smoothes the surface of the wood....

HCTRA 2025-09-05

1 Item: County Toll Road, Transponder, Inactivate, Reactivate, Team Strivers, Interoperable, Support team, Lead queue, License plate, Payment plan, Collections, Invoice, Partial plate correction, DMV mismatch, Suspicious activity, Prevented, Toll adjustment , Dis

HCTRA 2025-09-05

1 Item: County Toll Road, Transponder, Inactivate, Reactivate, Team Strivers, Interoperable, Support team, Lead queue, License plate, Payment plan, Collections, Invoice, Partial plate correction, DMV mismatch, Suspicious activity, Prevented, Toll adjustment , Dis

HCTRA 2025-09-05

1 Item: County Toll Road, Transponder, Inactivate, Reactivate, Team Strivers, Interoperable, Support team, Lead queue, License plate, Payment plan, Collections, Invoice, Partial plate correction, DMV mismatch, Suspicious activity, Prevented, Toll adjustment , Dis

KITCHEN 2025-10-18

1 Item: – PLATE – KNIFE – CUP – BOWL – FORK – OVEN – STOVE – SALT – PAN – DISH – SUGAR

Origins and Insertions of the Neck, Face, and Respiration Muscles 2025-09-25

23 Items: Origin: Temporal fossa. Insertion: Coronoid processOrigin: Spinous process C2. Insertion: Transverse process C1Origin: Transverse process C1. Insertion: Inferior nuchal lineOrigin: Spinous process C2. Insertion: Lateral inferior nuchal lineOrigin: Posterior tubercle C1 Insertion: Medial Inferior nuchal line...

The Skeletal System 2024-10-15

60 Items: armribnotneckhandnosebonefootnoseulnajointwristskullelbowfeverankletibiaabovefibulasacrumhumerusagainstbetweenhumpbackstraightcartilagesofteningthigh boneboth sidesmany, muchdeficiencyextremitiesfoot; childto the lefttumor; massto the rightwithin, intounder, belowinflammationcrooked, bentchange; beyondtogether, withsolid structuresurgical repair...

Dinnerware 2025-10-25

1 Item: Spoon Knife Napkin Plate Bowl Cup Glass Saucer Tablecloth, Salt Pepper Straw

The Empty Cookie Jar 2026-06-19

1 Item: JAR, KITCHEN, MILK, BREAD, APPLE, SPOON, FORK, PLATE, CUP, TABLE, OVEN, FOOD, SNACK

The Patio Puzzle 2026-06-19

1 Item: TABLE, CHAIR, FLOWER, PLANT, STONE, PATH, GRILL, CUP, PLATE, GLASS, UMBRELLA, LIGHT, DOOR

ED Sub-Chief Complaints 2024-03-22

13 Items: "I woke up and my rims are gone""The train flew off the tracks!""My husband threw a plate at the wall""Somebody rear-ended me and then took off""My ex-girlfriend won't give me back my phone""There's two kids throwing rocks off the overpass""I'm calling to report a dead deer on the shoulder""The homeless man downtown refuses to put pants on"...

The Dining Room Clue 2026-06-19

1 Item: CHAIR, PLATE, CUP, FORK, KNIFE, SPOON, NAPKIN, FOOD, GLASS, DINNER, ROOM, MEAL, FAMILY

Dinnerware 2025-10-25

1 Item: Spoon, Knife, Napkin, Plate, Bowl, Cup, Glass, Saucer, Table Cloth, Salt, Pepper, Straw

The Empty Kitchen 2026-06-19

1 Item: SPOON, FORK, PLATE, CUP, FRIDGE, OVEN, TABLE, CHAIR, FOOD, MILK, BREAD, APPLE, PANTRY

aless food 2024-04-23

1 Item: Salmon rio pyramids rice fries pancake music spotify chalk chocolate beabadoobee swing fruit plate cat

aless food 2024-04-23

1 Item: Salmon rio pyramids rice fries pancake music spotify chalk chocolate beabadoobee swing fruit plate cat

Restaurant 2025-06-17

20 Items: – The cup used for drinks.– A tool used to cut food.– A tool used to eat food.– A person who makes the food.– The main cook in the kitchen.– The room where food is cooked.– The flat dish where food is served.– Where customers sit and eat their food.– A tool used for eating soup or dessert.– A list of food and drinks you can order....

My 2026-01-04

196 Items: CarBusBedPenBagBoxCupTeaIceSunSkyDogCatCowPigArtRunCrySadRedBigHotNewOldBadFunPearPlumLimeBikeBoatShipRoadHomeRoomDoorLampBookForkFoodRiceMilkSaltCakeSnowRainMoonStarWindLakeSandRockTreeLeafParkBirdFishGoatLionBearFrogDeerMathSongGamePlayWalkJumpSwimReadDrawMakeHelpCalmBabyNameBluePinkFastSlowColdGoodEasyHardAppleGrapeMangoPeachLemonMelonBerryTrain...

EARTHQUAKE 2026-04-14

20 Items: – Another word for an earthquake.– The size or energy release of the quake.– The sudden upward movement of the ground.– Smaller quakes that follow the main event.– When one tectonic plate slides under another.– The breaking or tearing of the Earth's crust.– A long, narrow crack or opening in the ground....

sentance battle 2026-04-28

190 Items: agosoinonattoheitweanmanboypenbagboxcupbedkeyeggdogcatcoweatrunsayseebighotsadbadnewolddaynowonetwofewallandtoonowbutyoushethegirlbabydoorbooklamphomeparkcityshoproadroomricemeatfishmilkcakesoupbirdfishlionduckbearcomewalktalklookfindmaketakegiveplayworkreadopentallfastslowcoldgoodeasyhardlatemorelessmanysomenoneideaweakalsothenfromwithovernextthey...

Poster, Word Search 2022-11-14

1 Item: picture, drawers, salad, pizza, chicken, noodles, art, math, English, music, flower, flag, plum, plate, blanket, blue

minecraft blocks 2021-12-08

129 Items: logbedtnticegatesanddoorwoolslabloomstonewallsgrassglassbrickchestanvilsignsplanksleavesfencesgravelstairsladderbamboohopperpistoncactusbeaconbarrelsmokerbasaltcarpetbannerpodzolfurnacelanternseaweedgranitespawnerpumpkindioritebedrockhaybaledropperend-rodobsidiangold-oreiron-oreamethystconcreteobservercaludroniron-barcoal-orejuke-boxbee-hive...

Science Word Search 2025-02-07

100 Items: pHDNALabAtomGeneCellLensWaveDataAcidBaseBiomeVirusPlateOceanForceSpeedLightSolarEnergyProtonFossilEnzymeOpticsFusionTheorySampleAtomicBiologyPhysicsQuantumGravityNeutronSpeciesMicrobeProteinNucleusGeologyVolcanoWeatherClimateKineticCircuitCurrentVoltageFissionReagentSolventIsotopeMoleculeElectronOrganismBacteriaRibosomeTectonicVelocityFriction...

Mountains, Maps and Landforms.... 2022-12-13

1 Item: Physical, Elevation, Relief, Topographic, Contour Lines, Plate Boundary, Dome, Folded, Block, Mountain, Plateau, Butte, Trench, Volcanoes

SKIENTIFIK 2026-05-13

12 Items: The rate at which velocity changes over time.The speed of an object in a specific direction.The spinning of a planet on its axis (defines a "day").One complete orbit of a planet around the sun (defines a "year").A force that opposes motion between two surfaces that are touching.The curved path of a celestial object around a star, planet, or moon....

Skin Disorders 2025-11-03

23 Items: A mark on the skinDistended/dilated blood vesselsKeratin filled cysts around the eyesLarge blister containing watery fluidBrown or flesh colored skin outgrowthChronic inflammation of sebaceous glandsA sore produced by scratching or scrapingCongenital absence of melanin in the bodyThin dry or oily plate of epidermal flaking...

asdf 2024-09-11

32 Items: D=m/vRock that forms as magma coolsRock that forms from heat and pressurebuilding Process of creating mountainsboundary Where two tectonic plates meet.Most sedimentary rocks form in layers known as ________.The process that turns any rock into magma by adding heat.Occurs when sediments settle on the ground or a body of water...

LA stanner 2025-03-12

37 Items: timechangeor bentdisappearenvironmentteam. Proudreluctantlyor intensityinto nothing,”is erratic andcrouched on thesuch a temper is- A showy gesturea grand flourish.- Liable to sudden- Capable of being- To become less in- Become like one's- Go away, scatter,- Shut out from view- Admit or acknowledge, oftenlater, one of the men conceded that...

Family and Friends 4 Word Search 2025-09-30

1 Item: waitress, uniform, menu, customer, bottle of water, cup of coffee, glass of milk, bowl of soup, plate of salad

LA stanner 2025-03-12

37 Items: timechangeor bentdisappearenvironmentteam. Proudreluctantlyor intensityinto nothing,”is erratic andcrouched on thesuch a temper is- A showy gesturea grand flourish.- Liable to sudden- Capable of being- To become less in- Become like one's- Go away, scatter,- Shut out from view- Admit or acknowledge, oftenlater, one of the men conceded that...

Evaporation Word Search 2025-01-23

25 Items: How many maine plate tectonic locations are there?Which part of the water cyle does gas turn to liquid?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

Our Dynamic Earth-Key words 2026-08-30

1 Item: Continental drift, Crust, Molten, Semi-Molten, Magma, Mantle, Convection Currents, Core, Constructive, Destructive, Oceanic Plates, Continental Plates, Subduction, Conservative, Plate Boundary

Cat Word Search 2026-06-08

103 Items: catfoxpinkbluegoldpinelilyrosehillcavepondswanwolfbeardrumharpsongtunenotewindrainsnowmistdawndusknoonstarmoonapplerivercloudstonechairplanttigerbreadsmiledreamlightmusicbeachtablemousegrassflamesheeppearlbrickfrostwhalebroomdancegrapeclockfruitrobinhorsesharkgreenwhiteblackbrownpaperrulerspoonplateglassknifeonionmangopeachlemonberrycedarmapledaisy...

Thanksgiving Word Search 2024-11-20

1 Item: potatoes, corn, ham, sweet potatoes, cranberry, gravy, giving thanks, thankful, family, green beans, turkey, apple, pumpkin pie, carrots, stuffing, napkin, plate, feast, Thanksgiving, butter

Coating Vocab 1 2025-06-17

10 Items: License Plate Number.The method of joining two pieces of material to form a continuous web.The release material that protects the adhesive layer and keeps it from sticking to itself.The process of switching a production line or machine from running one product to a different product....

TOILET PAPER 2024-10-30

237 Items: AILAIRAPEAPPAPTAREARTATEEAREATEELERAETAIRELAPLEELEILETLIELIPLITLOPLOTOAROATOILOPTPALPARPATPEAPEPPETPIEPITPOPPOTPRORAPRATREPRIPROTTARTATTEATEETIETILTIPTOETOPTOTAEROALITALOEALTOATOPEARLIOTALAIRLATELEAPLEERLEPTLIARLITELOREORALPAIRPALEPAREPARTPEALPEARPEATPEELPEEPPEERPERPPIERPILEPIPEPLATPLEAPLIEPLOPPLOTPOETPOLEPOPEPOREPRATPREPPROPRAILRALERATEREALREAP...

Bluey - Everything! 2025-08-30

246 Items: BagBobBusFunHatJoyKeyMapNapPatRedRunSunTagToyTwoZooBallBarkBookCafeCocoEmmyFidoFishGameHideHomeIndyJackJudoJumpLilaLoveLudoMoonNanaParkPlayPoolRainRoomRopeSeekShopStarTinyTreeTubeWandWorkAlfieBeachBeansBellaBingoBlueyBrushBuddyBunnyChloeClockConesCrownDollyDressDrinkGnomeHoneyHotelHumorKindyLaughLogieLuckyLunchMissyMoneyMusicPlatePoppyRustySeven...

Year 9 Earth & Space 2025-11-26

1 Item: soil mantle core crust volcano lava magma eruption tectonic plates plate boundary earthquake fault seismic waves atmosphere hydrosphere biosphere lithosphere atmosphere erosion sedimentation weathering atmosphere biosphere hydrosphere lithosphere

Apple Word Search 2025-10-30

250 Items: figeggpieoiltearumiceskyseacatdogcowpigratfoxbatantbeedaysunpenartrunflybuscarbedbagboxcuppearplumlimekiwidatecornpeasriceoatsmilkmeatfishporkbeeflambsaltcakesoupherbsodawinebeerfirewindrainsnowrocklaketreeleafrootseedbirdfishgoatwolfbearlionfrogwormsoulmoonstartimeyearweektalemythbookpagewordsongdrumbandstepmovewalkjumpfallswimdiverideroadpathbike...

250 random words 2026-05-05

250 Items: GoUpPenBedCupKeyBagBoxHatSunSkySeaDogCatCowPigBeeAntBugDayEyeEarArmLegToeManBoyRunSitEatEggTeaBuySeeUseBadBigHotNewOldSadRedFarLowBookDoorForkLampSoapShoeSockCoatDeskWallRoofRoomSinkOvenBowlMoonStarRainSnowWindTreeLeafDirtRockSandLakeHillParkRoadPathFarmBirdFishFireDarkFallHeadFaceNoseHandFootBackHairSkinBabyGirlNameWalkJumpSingKnowWantGiveTakeHelp...

Overview Of Graphic Communications 2023-08-23

1 Item: Artwork, Binding, Book Printing, Commercial Printing, Computer-to-plate (CTP),Content management systems (CMS), Continuous tone copy , Copy, Editing, e-pubs, Electrostatic Printing, Financial printing, Finishing, Flexography, Forms printing, Image Assembl

Homes 2026-05-04

1 Item: carpet, curtains, lamp, television, bookshelf, pillow, fireplace, picture, clock, vase, plant, fridge, oven, microwave, sink, dishwasher, plate, cup, knife, fork, door, window, floor, stairs, roof, garden, garage, basement, balcony, fence, shower, table,

Puzzle 2025-02-03

1 Item: SleepingBag, Backpack, Lantern, Flashlight, Compass, Map, Matches, Lighter, Stove, Fuel, Pot, Pan, Cup, Plate, Utensil, Rope, Knife, Axe, Hammer, Peg, Tarp, Binoculars, FirstAid, Whistle, BugSpray, Sunscreen, Canteen, Cooler, Chair, Table, Boots, Socks, J

Unit Vocabulary Puzzle 2025-09-20

1 Item: bathroom, bedroom, invite, arrival, yet, add, biscuit, borrow, plan, treasure, hunt, lift, until, movie, dead, note, community, rubbish, almost, journey, pull, familiar, joke, several, nod, writer, text, describe, wherever, matter, perhaps, plate, freshly

Kikclball 2026-04-14

1 Item: pitcher, kicker, catcher, baseman, outfield, infield, base, home plate, foul line, fair ball, foul ball, fly ball, ground ball, bunt, run, score, inning, out, safe, tag, force out, double play, lineup, team, referee, sideline, backstop, strike, play

Building Components 2023-02-20

25 Items: a lowest part of basea top that covering of a buildingto guide water flow from the roofa protection from the rays of the sunthe bottom horizontal member of a walla very tall building with many storiesthe part of a wheel or tire that makes contacta triangular portion of a wall between the edgesprovide the structure's stability from the ground...

Kicklball 2026-04-14

1 Item: pitcher, kicker, catcher, baseman, outfield, infield, base, home plate, foul line, fair ball, foul ball, fly ball, ground ball, bunt, run, score, inning, out, safe, tag, force out, double play, lineup, team, referee, sideline, backstop, strike, play

Dusting Word Search 2025-02-25

1 Item: forward down careful wand nose elbow family cottage behind coffee candy glass white bags collection nails hair enough frame airplane almost trouble foot bears plate bounce whale announce candle sale store something why calm hill paper closet wrong rupture

Word Search Homework 2025-02-25

1 Item: forward down careful wand nose elbow family cottage behind coffee candy glass white bags collection nails hair enough frame airplane almost trouble foot bears plate bounce whale announce candle sale store something why calm hill paper closet wrong rupture

Rocks and Minerals Word Search SWHS INVITATIONAL 2025 2025-12-03

20 Items: Which mineral is a common mafic silicate found in basalt and gabbro with two cleavages near 90°?Which fine-grained extrusive igneous rock has felsic composition, often showing porphyritic texture?Which mineral is extremely soft (hardness 1), feels soapy, and forms from metamorphism of ultramafic rocks?...

Coating Vocabulary 2025-06-17

28 Items: License Plate Number.A flaw or imperfection in a product.Cutting a wide web into narrower rolls.Material that is discarded during production.Bonding two or more layers of material together.Periods when equipment is operating and productive.Applying a liquid or semi-liquid material to a substrate's surface....

Angulation Word Search 2026-05-31

41 Items: X-ray at center of beam.Common type of phosphor.Cutting across or through.Between two adjacent surfacesFilm designed for use in cassettes.Contains extraoral film during exposure.Intersecting at or forming a right angle.Intraoral technique of exposing dental images.Colored side of the film that faces the tongue....

Marine Science Word Search 2025-01-15

25 Items: South American, Canadian, PacificWhat is the main way that surface currents form?What is the term for measuring the acidity of a liquid?What is the name of a tidal current that leaves the land?What is the process of converting liquid water into vapor water?plain What is the flat ocean floor that covers 50% of the ocean?...

Med Term - Skeletal 2026-08-18

43 Items: Softening of cartilageFreely movable joint; synovial jointCylindrical midsection of a long boneImmovable joints; tibia and fibula, skullInflammation of structures made of cartilageFine inner lining of a bone’s medullary cavitySurgical reconstruction or replacement of a jointMultiaxial joint with the most motion; shoulder, hip...

Volcano Hunters 2026-04-24

50 Items: The thin outer shell of the Earth.The point where two plates collide.A physical force exerted on an objectThe point where two plates move apart.The edge where two tectonic plates meetA measure of how explosive a material isthe point where two plates slide past each otherRocks that are formed as a result of magma cooling...