incl some with Word Searches

Heart Word Search 2025-11-09

10 Items: – The shape that shows love and care.– A person you like and spend time with.– Something you give to make someone happy.– What you do when you feel happy or loved.– A warm feeling you have for someone special.– Sweet treats often shared on Valentine’s Day.– When you hold someone close to show you care....

Capítulo 4 La Recomendación 2025-10-21

21 Items: eyesnamesincevoicefirstagainpartnerin loveso muchsurprisenervouslymain crushwith you(I)opportunityshe/he winksrecommendationthey/you(F) likeafter, afterwardhe/she/you(F) hadto exchange/tradeto try to do something

Grade 3 phonics - U1-4 2025-11-19

63 Items: gobeecrydieeatflygethaypieputrowsayseaskyspyteatiebeanblowboatclaycoatcrowfrogfromgoatgrayhighleaflikemakeplayplayrainridesailsandsealseedsnowtailtheytoadtreewindwithblackchairdrinkfallsfightfloatgreennightsheepsleepsnailsweettheirtrainyummystrongyellow

SFF 2022 2022-12-28

5 Items: PigskinBattle of 1836Founded in 1883Home of the SpursI prefer this with my soup

Unit 1: Forces & Motion Word Search! 2025-12-01

22 Items: A quantity or aggregate of matter usually of considerable size.Acts between objects at rest, preventing them from starting to move.Is a net force acting on an object that changes its state of motion.The force that resists relative motion between two bodies in contact.Is a force that is opposed by an equal force in the opposite direction....

Living on One Dollar a Day 2023-03-14

10 Items: Bank you can get loans atThe parasite Chris became sick withThe tropical storm that hit GuatemalaCountry the documentary takes place inThe vegetable the students grew to make moneyName of the kid who hung out with Chris and his friends1.1 __________________ people in the world live on one dollar a day....

What’s the gender 2025-07-27

6 Items: HavingShort For We AreThe Baby’s gender6 Letter First NameThe Baby’s last nameMiddle Name with Family Ties

Likes and Dislikes 2024-05-07

51 Items: teadayTeagamecatsdogsfoodfishsodadanceCreamjeansonionsleepwateranimalapplesbananacoffeefamilyflowersalamitiktoktomatoyellowchickenclothesorangessausageyoutubebirthdaycomputerlemonadeto musicpinapplesneakersbreakfastchocolatehamburgerchocolatemotorbikespaghettiactivitiesvegetablesvideogamesTelevisionwatermelonfoodtropolisto the beachstrawberries...

Dog Word Search 2024-08-19

3 Items: an animal that goes woofa small feral animal that rhymes with hata yummy food that is cold and rhymes with dream

Word Search for Lucy 2025-04-05

12 Items: covered in fluffmaking very little noiseto ask God to protect sb/sththe state of not being dangerousin or from a country that is not your ownan underground railway/railroad system in a citythe direction that you look towards to see the sun risethe direction that you look towards to see the sun go down...

School 2024-01-10

20 Items: wheelyou move quicklythe head of a schoolwhere books are keptsomeone who has childto say hello to someonea bag you take to schoola place you park your bikechair with wheel for peoplea large ball you kick a roundto move things with your feeta container you keep water ina bus that takes you to schoolsomething you wear on your head...

Word Search puzzle 2024-12-09

20 Items: You sit on thisFull of pages to readMakes a ringing soundA white drink from cowsShows hours and minutesA round object for gamesWiggly and sweet dessertA tall plant with branchesWhite and fluffy in the skyA round fruit, red or greenA bird that quacks and swimsUsed to carry books or itemsShines bright in the night skyA creature that lives in water...

Helena 2025-07-18

20 Items: The dark daysHumbling Jess DSeasick inducingHelena’s homebodyHelena’s sloppy messHelena’s secret loverThe accused trip copierLovergirl but …… at heartUnleashes chaos with 1 sipHelena’s acting debut & endHelena’s iconic granny shoeMadison’s creative stories outletYear 11 ultimate threat against MadsA fiery character with a heart of gold...

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

Santa Word Search 2025-12-04

20 Items: Another Christmas colorA sweet treat for SantaWhat Santa checks twiceThe man who brings giftsA bright Christmas colorA person made out of snowSomething you give someoneA ribbon tied on a presentWhat makes the tree sparkleSomething you wear to keep warmWhite flakes that fall in winterThe decorated Christmas evergreenSomething you ride on in the snow...

Respectfulness Word Search 2022-11-30

8 Items: is keysees allare two-edgedreject the Lordgo behind another's backall/everything with respectand Greed get you nowhere goodidolize others or yourself, God is the only God

week 3 vocab 2025-09-09

10 Items: to become joinedof the same kind; alikediverse in character or contentexcessive pigmentation of the skinnot existing or not real or present(of a food) containing no fat; with all fat solids removedcause (someone) to believe firmly in the truth of somethingnot conforming with accepted or orthodox standards or beliefs...

Barter Word Search 2023-04-03

6 Items: something someone does for youAn item you trade for another itemit is used as a plastic for banknoteswhen you have very little income or no incometrade between companies in developed countries with equal pricesmade an exact imitation of something valuable or important with the intention to deceive or defraud.

Different Habitats (Biomes) 2025-09-08

6 Items: - A hot and dry environment- An environment with many trees- A home for aquatic species that live underwater- Water covers the soil of this environment for most of the year- A cold environment with limited plant growth due to low temperatures- A hot and humid, species rich environment that gets a lot of rainfall

Vocabulary 5 2024-11-05

14 Items: dizzyclumsyto mournirritablecontinuousto encircleto shrink awayto put up withhard or difficultto wait in a linecapacity for learningdisturbing or frighteningdelicate floating cobwebsto be patient or tolerant

Fall Favorites - From the Library Team 2024-11-22

16 Items: HamPieCookiesStuffingPumpkin PieCanned YamsCranberry SauceWild Rice StuffingCorn Bread PuddingStuffing and GravyGreen Bean CasseroleCorn Bread CasseroleSandwich of LeftoversSweet Potato CasseroleMashed Potatoes and GravySweet Potatoes with Marshmallow

Critical Words! 2023-01-07

21 Items: A missionBold and hardypopular DnD showWhere it all beginsScholarly magic userGoing on an adventure!Master of martial artsPriest of the old faithSurvive by avoiding noticeSpellcaster with inherent magicHoly warrior bound by sacred oathMagical people of otherworldly graceInspiring magician with musical powerWielder of magic derived from a bargain...

Didactic Word Search 2025-10-02

20 Items: plentifula natural skilla temporary stayintended to teachusing very few wordsto publicly ridiculeclear logical convincingable to be touched or felta noisy disturbance or quarrelto ridicule or insult verballyhaving or showing great knowledgea countless or extremely big numberfriendly,good natured,easy to talk to...

Search 000X6 2025-01-03

45 Items: OxCowPigHenRamEweFoxOwlGoatDuckMuleCalfFoalLionBearWolfDeerSheepHorseLlamaGoosesaid:said:TigerZebraRhinoPandaEagleSharkBisonHippoTurkeyDonkeyAlpacaJaguarChickenRoosterChatGPTCheetahGorillaLeopardGiraffeCrocodile20 wild animals that are single wordare 20 wild animals with single-word names:

Young Goodman Browne 2025-11-14

22 Items: urgedwickeddoubtskindlypromiseAllusionamusementreligiousdeterminedmysteriousabominationseriousnessdistinguishednew believersgrayish whitelewd, lustfuluncontrollableclear, apparentrelated to eyes or visionnotice or acknowledgementshining with a reddish glowa method of teaching religious doctrines

Vendors Word Search 2023-09-18

6 Items: a black substance that can be used for heating or cookinga sweet substance, often in the form of white or brown crystalsto cook food, especially meat, without liquid in an oven or over a firepeople who sell things, for example food or newspapers, usually outside on the street...

Small Businesses & Franchises 2025-03-25

2 Items: The fruit with red.The fruit with yellow.

Medical Word Search 2025-12-12

7 Items: THE E in EMT stands for thisplace this fabric bandage on a cutthis wooden stick is used in the mouththe doctor uses this to check your heartwhen you get a shot you are stuck with thisAn EMT drives this emergency type of vehiclePharmacists deal with medication that helps patients feel better. They are called this

Green Group 2024-03-05

20 Items: for that reason; consequentlyvery large in size, quantity, or extentacquire (something) by paying for it; buythe action of helping or doing work for someoneobtain (money) in return for labour or servicesequivalent in value to the sum or item specifiedinterfere with the normal arrangement or functioning of...

Planet Word Search 2025-05-29

15 Items: The star we orbit.The largest planet.The windiest planet.The planet we live on.The closest planet to earth.The thing that orbits earth.The closest planet to the sun.The planet known for having rings.The dwarf planet with 9 hour days.The planet NASA is trying to take us to.The first planet spotted with a telescope....

CAROL'S PUZZLE 2025-11-13

15 Items: Your birthday monthFriend from KentuckyYou wear these to seefriend that plays golffriend that has four dogsYou have this color of hairfriend that has two new kittensYour family lives in this stateThe name of your orange tabby catThe city you live in in New MexicoYou like to do this on Wednesday afternoonsfriend that is taking Art classes in college...

foods and nutrition 2023-03-07

58 Items: frykneadstrainto stir rapidlyheat beforehandbeat into a frothtear or cut into shredsshort for microwave ovencut food into small cubes.the finest level of choppinganimal fats and vegetable oilsfree from dirt marks or stainsmake or become liquefied by heatfried quickly in a little hot fatgenerally defined as 1/16 teaspoon...

Cycle 2 Word list 9 Name ___________________________ 2025-11-05

12 Items: To use irony or to mockThe people who wrote the constitutionA reasonable guess as to what will happenThe attractive force exerted between objectsA deduction from the usual cost of somethingTime can be divided into shorter periods of time all the same lengthA price which something is sold at after its price has been reduced....

Sopa De Letras Admin 2025-10-22

15 Items: Learning shaped by consequences.Levels of authority and chain of command.Analytical tool for semi-structured decisions.Integrates finance, inventory, and production.Learning by pairing a stimulus with a response.Increases behavior by adding a desired outcome.Set rules and defined roles in an organization....

Spelling words 10/6-10/10 2025-10-07

10 Items: friendshiptype of treeheart relatedline of peoplepretender/fakereasy to reach/usea friend (not close)an educated guess/ideaskillful with both handsbroken, not working right

Ethans Spelling Word Search 2023-04-05

35 Items: lukejohnmusclesprintfitnesswarm-upstadiumworkoutathletehandballmuscularolympicsexerciseequipmenttreadmillgymnasiumstopwatchgymnasticsracquetballperspirationcoordinationcalisthenicscross-countryweighttrainingstationarybikea long race or contesthaving to do with the heart and blood vesselsthe power to stand something without giving out...

Amiable Word Search 2023-04-24

22 Items: evilability; potentiala lack or shortageworsening; declineshowy, pretentioushonesty; truthfulnessfriendly; good naturedto explain in greater detailgood, well meaning and kindlyto seek information or advicetrigger; cause, bring to actionsimple, crude, not sophisticateddone with power, force or energynot mobile; remaining in one place...

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

5th grade WM list 2 2025-12-08

25 Items: loyaltyfaithfulto push awayto use up; devourTo eat up hungrilyAble to last; strongsudden and unexpectedcapable of being heardno longer in existencea split, break, breachfall suddenly and steeplyrefuse to accept; grow worserelating to the sense of touchto separate, divide into partsTo cause to turn aside or awaya small valley, usually among trees...

An Word Search 2025-09-19

13 Items: Not clean.To get bigger or taller.The fastest animal on land.A building where people go toTo come to the end of something.A person who writes or speaks news.A long, thin mark or a row of people.What you see like red, blue, or green.A place with grass, trees, and playgrounds.Something you use to paint or clean your teeth....

Zealous Word Search 2023-12-11

10 Items: Having a pleasant odor; fragrantTo criticize severely; find fault withFilled with bitter criticism or maliceLacking poetic beauty; ordinary or dullComplaining in a whining or petulant mannerHaving or showing zeal; fervent or enthusiasticAttractive or appealing in appearance or characterDislike of or prejudice against people from other countries...

"one of us is lying" 2024-05-28

10 Items: Simon's best frienddied from a peanut allergythe cause of Simon's deaththe name of the detention groupcharges the four students are facingexposed for cheating on the chemistry testsaccused of doing steroids to enhance his gameswhat the four kids are required to do after Simon's deathexposed for cheating on her boyfriend Jake with his best friend TJ...

Myasthenia Gravis 2024-06-06

10 Items: preferred symptomatic treatmentdropping eyelids seen in ocular myasthenia gravis______ weakness :primary symptom of myasthenia gravismonoclonal antibody that provides potent alternative therapyinhibition of this enzyme is target for first line treatmentsDisease in which body’s antibodies attack self-cells and -tissues...

4/23 Russian HW: Word Search 2025-04-18

10 Items: the Russian government - __________a Russian 3-stringed instrument - __________novelist who wrote Crime and Punishment - __________red beet soup usually served with sour cream - __________the penal system of the Soviet Union (labor camps) - __________Russian meat dumplings that are often served in broth - __________...

Perfect 12 #4 2025-10-31

10 Items: complete disorderto punish severelyhaving to do with dogs;a dogoutspoke;blunt/informal; unposedbiting, burning, severe; sharp or sarcasticto persuade with false promises and flatteryto criticize or punish for the purpose of correctionone who is intolerant of another's beliefs, opinions, or values...

English 8H Independent Reading Project : Maggie T 2025-12-06

10 Items: Who is Daisy's best friend?Who is the producer of The Six?Who is the male lead of The Six?Who is the female lead of The Six?Who does Graham fall in love with?Where does Simone go to pursue music?What was Billy and Daisy's first big hit?Where does Daisy go after her fight with Billy?What is the name of Billy and Camilla's daughter?...

Places in Wales the begin with Llan 2025-11-11

9 Items: wellsllanellillandudnollandysulllandeilollandoveryllanfyllinllanfairfechanllanfaircareinion

Where's Waldo? Word Search 2025-11-09

10 Items: casebaitbaitbaitjunk and suchyou want a piece?recyclable and reusablepresenting the class ofwith all the other onesneed something of yours for this

Fabing Wedding Celebration 2024-10-10

46 Items: Trevor's long time friend who lives in MontanaTom coaches football with Trevor for the BalersCasey's aunt and the best travel agent out thereCasey's oldest niece who just bought a motorcycleCasey's mom who officiated Trevor and Casey's weddingCasey's cousin who owns more DVDs and VHS than anyone!...

Feelings Fiesta 2025-04-21

5 Items: Happy: Feeling joy or a big smile in your heart.Scared: Feeling frightened, like you want to hide.Sad: Feeling unhappy, maybe with a tear in your eye.Angry: Feeling mad, like you want to stomp or shout.Surprised: Feeling amazed, with wide eyes and an open mouth.

Susie 31.12.2024 2024-12-31

60 Items: asattootwowaswhowhyyesagearethistowntreeverywaitwantweekwellwerewhatwhenwillwithwordworkyearyourawaybabybackthinkthirdthreetruckwaterwherewhilewhitealonetwelveyellowacrossactionalmostansweranyoneappeararriveautumntuesdayaddressalreadybecausethursdaytogetheranythingwednesdaywonderfulafternoonunderstand

Dive Word Search 2022-11-16

6 Items: -Torn- Fly high- Mountain top- Cracking sound- A strong rush if wind- To go deep into water with force and softness

BSN FTFC Word Search 2024-02-27

20 Items: BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's ______________________________________________.The ____________________________ is responsible to approve the BSN Fair Treatment for Financial Consumers (FTFC) Policy....

At Your Service Commitments Word Search 2022-06-01

10 Items: Make every AT&T customer an AT&T _____Go the extra mile to create "wow" momentsBuild confidence and _____ with customersDo the work so your customers won't have toBe yourself and be honest with our customersAsk _____ questions to understand customer needsAsk thoughtful questions to understand customer needs...

Renaissance Word Quest 2025-02-23

10 Items: A French song.A gradual increase in speed or tempo.A gradual decrease in speed or tempo.The period of music between 1400-1600.An instrument like a small U-shaped harp.When two or more independent melodies coincide.The most influential invention of the Renaissance.A string instrument with a long neck and angled tuning pegs....

Sunny Word Search 2022-12-03

9 Items: let's fly a kite. it's ....I'm freezing. it's too coldyour teacher's favortie weatherwhen it's snowy, we make a ....when the weather is wet and hotwe see .... right after it rainsit's .... today. don't forget your umbrellawhen the sun is in the sky the weather is...let's have some cold food and drinks it's too ....

Mythology and Legends 2025-04-14

10 Items: PHOENIX : A magical bird that is reborn from its ashes.GIANT : A huge mythical being much larger than a human.HERO : A brave person admired for courage and noble deeds.TREASURE : Valuable items like gold, jewels, or hidden riches.DRAGON : A large, magical creature that can often fly and breathe fire....

Chem Word Search 2025-05-22

10 Items: deals with compounds containing oxygena list of metals arranged in order of their reactivitythe result of reactants combining and undergoing a changean insoluble solid that forms when two solutions are mixeda mixture where water is the solvent to create a uniform mixtureabsorbs heat from their surroundings, making the surroundings feel cooler...

Sight Words for Avalee 2025-10-29

96 Items: aImegoonitsoamuporismytodoatheofweinbybutourgetwhoflywasoneforhadshetooyouseehowareouthasandbigyescanrannottwothehisheranyalldideatnowfindsomeoncecomejumptheylookknowwhatgoodwalkcalllongveryhereoverhavesaidlikedownmanyplaygiverideawayliveshowyourmorewanteverytherefunnyneveragainwritefirstcouldthesewheretheirwouldunderlittle

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Chemistry Word Search 2024-03-18

20 Items: least dense lipoproteinmost abundant serum proteinequation for calculating LDlthe four fat soluble vitaminsbest indicator of iron storagemineral maintained by vitamin Dorgan producing and secreting TSHhormone elevated in Cushing's syndromeresponsible for binding free hemoglobinenzyme utilized in glucose measurements...

All About Helena 2025-07-18

20 Items: The dark daysHumbling Jess DSeasick inducingHelena’s homebodyHelena’s sloppy messHelena’s secret loverThe accused trip copierLovergirl but …… at heartUnleashes chaos with 1 sipHelena’s acting debut & endHelena’s iconic granny shoeMadison’s creative stories outletYear 11 ultimate threat against MadsA fiery character with a heart of gold...

sports 2025-09-03

20 Items: – Losing a game.– A short, fast run.– A sports contest or game.– A series of competitions.– A person who plays sports.– Breaking a rule in a game.– The total points in a game.– Practice to improve skills.– The winner of a competition.– Enforces the rules in a game.– Physical health and strength.– A point scored in many sports....

Vocab Workshop Level E Unit 1 2025-10-07

20 Items: not combed, untidyto say again, repeateasily bent, felxibleto position or arrangeto make larger, increasestern, unyielding, gloomywealthy, luxurious, amplecautiously, with great carecourage in facing difficultiesa hint, indirect suggestion, cluean external appearance, cover, masknot easily moved, dull, unresponsive...

FSE 116-Mod. 2 2025-08-28

10 Items: What term generally implies being related by blood to the deceased?How is the right to disposition described in terms of its shareability?What entity grants the power to take possession and control of a dead body for disposition?What is the term for the process of arranging for the handling and final placement of a dead body?...

3.03 vocabulary 2022-11-29

12 Items: Polite behavior; good mannersLoyalty to a particular businessFocused on customer needs and wantsAll the activities a business engages in to interact with its customersThe values and ideals that an organization encourages among its employeesThe people (i.e., employees) who work cooperatively together to achieve business goals...

Mosaic Word Search 2025-08-16

11 Items: A princeA princessCrystacularHome, to youLove is callingA place of firstsWhen the sun hitsMountainous AdventureSoft term of endearmentA word, beautifully spokenThree wizards, crowned with weed

Poseidon and Sea Creatures 2025-10-28

29 Items: Sea goddess and wife of PoseidonCity contested by Poseidon and Athenathreed-proned staff/weapon of PosiedonGod of the sea, earthquakes, and horsesCyclops son of Poseidon; blinded by OdysseusCity whose walls were built by Poseidon and ApolloTitaness and wife of Oceanus; mother of the Oceanids.sided against Zeus and turned into a monstrous whirlpool....

Revision,Living and non-living things to fungi and bacteria(Jackey) 2025-03-27

22 Items: Fish are_____-blooded.There are_____ in yogurts.The process of classifyingFish breathe through_____.The process of pollinating.Fungi: Mushroom,_____ and yeastThe classify things by their_____._____ are the only mammal that can fly.WOW stands for: _____,oxygen and warmth.There are only 4 groups of living things....

Potter Word Search 2025-09-02

6 Items: atOut of order"Is that true!?!"Rodent-hunting catPatronize a store (2 words)An artist with clay on a wheel

23 2025-08-17

15 Items: Rules bikers live by.Serious loyalty pledge.Ink showing club loyalty.Process of proving loyalty.Common outlaw biker symbol.Seasonal ride to welcome warmer weatherTribute ride held to honor a fallen riderYearly organized motorcycle ride or eventGroup ride organized to raise funds for a causeHigh-speed motorcycle competition on a paved track...

Sopa De Letras Admin 2025-10-22

15 Items: Learning shaped by consequences.Levels of authority and chain of command.Analytical tool for semi-structured decisions.Integrates finance, inventory, and production.Learning by pairing a stimulus with a response.Increases behavior by adding a desired outcome.Set rules and defined roles in an organization....

SAT Quack 7 2025-06-29

20 Items: ejecta lineaward or honordisregard for dangeroffensive; disgustingto gradually decreasehaving no room or spaceto one side; crooked; awryunquestionable; actual; trueexcessively decorated; elaborateat the same time; simultaneouslya harsh sound; harsh, disturbing noiseto obstruct or interfere with; to delayword for word; using exactly the same words...

Africa 2025-11-18

25 Items: King of AksumEmpire after MaliThe largest desertEast African kingdomSwahili trading cityLand ruled by a kingLand next to the seaHot and very dry landMineral used for tradeReligion Aksum followedGroup traveling togetherBuying and selling goodsWater spot in the desertA big West African empireShiny metal people wantedCity with big stone walls...

Complete & Balance Diet 2022-09-14

5 Items: have ABCDEKstarts with MFor strong bonesBasic component for musclesCritical for cats for vision & heart

Personal Relationships (Lessons 3 & 4) 2024-10-17

30 Items: To shameA teacherLike an uncle.Childish; immatureAbout to die or endA rebirth; a renewalA family inheritance.Support; encouragementMarriage to two mates.Dominated by one's wife.Marriage to a single matePossessed at birth; inbornChildlike; unsophisticatedHaving to do with the family.Emerging; coming into existencePertaining to brothers; brotherly...

Pastel Word Search 2025-09-15

5 Items: Frog-to-be?Lightly coloredSound like a duckBiology of chemistryCooking herb with a girl's name

ww4 u16 2024-09-23

15 Items: a flowershabby and worn outto cut off branchesheavily built; thicksetto strongly dislike or hateto put out as a fire or lighta place where fruit trees growa large branch or limb of a treeoften seen or experienced; knownwell-suiting, fitted, appropriatehappy with what one has, satisfiedto gain or get by making an effort...

Monthly Challenge S 2023-05-19

100 Items: safesamesandsaveseemsellsendshipshoeshopshowsicksidesignsingsizeskinslowsnowsocksomesongsoonstarstaystepstopsuchsureswimscaresevenshakeshallshapesharesharksheepshirtshortshoutsinceskillsleepsmallsmellsmilesnacksnakesorrysoundspacespeakspendsportstandstartstickstillstompstonestorestorystudysweetswingswishschoolscreamsecondsecretshouldsimplesister...

Baseball 2025-09-14

20 Items: Another term for a baseball fieldLegendary slugger nicknamed “The Bambino”Historic ballpark home to the Boston Red SoxTeam with the most World Series championshipsSeattle team that signed Ichiro Suzuki in 2001St. Louis team with 11 World Series championshipsBroke Babe Ruth’s all-time home run record in 1974...

Variable: Word Search 2025-10-09

25 Items: of 1TermsEquationEvaluateInequalityan Equationan EquationThe number multiplied by a variablewith the same variable and exponent.A number by itself — it doesn’t change.TermA number that doesn’t change (no variable).all operations and combine like terms to make itequation where the variable’s highest power is 1....

Vezot Ha’Bracha 2025-10-11

23 Items: Be StrongWho buried Moses?The city where Rahab lived?After Moses death, who led Israel?This tribe received the first blessing.Total gathered in the upper room (about)?This tribe inherited land East of the Jordan.City where Yeshua told his disciples to wait?Name of the Mount from which Yeshua ascended?...

Animals 2024-09-15

12 Items: cathippoKing Kongfastest catMan's best friendfancy tailed birdKing of the junglelong necked animalAnimal with a trunkanimal shape of puzzleStriped horse-like animalanimal that doesn't change its spots

Jherson - Verbs Day 1--8 2023-10-04

40 Items: I l_______ my daughter.Do you ________ French?What time do they a_______?I r_______ what you told me.I l_______ hot dogs from IKEA.We will b_______ work at 8:00am.Do you want to c_______ with us?Can I ______p you find something?That doesn't a_______ my question.Did you m_______ anybody new today?If I ____t too much, I will get fat....

Manners to Go-Positive Words that begin with the letter A 2016-05-20

22 Items: agreeactionactiveadmireamazingangelicapproveawesomeadorableacceptedaffluentaptitudeacclaimedadventureagreeableappealingabsolutelyaccomplishattractiveachievementaffirmativeaccomplishment

Week 2 - Implement the nursing process for persons with mental illness 2025-03-08

24 Items: RoleSelfFearGuiltSocialLimitsPlayingSupportControlSettingTeachingTriggersPlanningContractsBehaviorsAttentionDiagnosisBehavioralAssessmentEvaluationTherapeuticEnvironmentStimulationFrustration

PLAY wordsearch QUIETLY for words that begin with P and Q 2025-09-03

53 Items: PanPitPathPassParkPonyPullPaveParkPrayPassPlayPunyPinkPalePoorQuizQuitPartyPlatePhonePasteProvePressProudPuffyQuestQuietQuoteQuillQuailQuickQuackQueenParrotPulleyPreachPonderPolitePrettyQuenchPatternPresentPenguinPerfectPatientPainfulQuarterQuibbleQuicklyQuestionQuantityQuotable

Create your ideal setlist with the first 8 songs you see 2025-12-04

27 Items: IfIRunGrowHomeOhNoJulyAloneShameJosieAdoreCoverLetGoCologneAspirinCryBabyLavenderComeBackHurricaneIfIdKnownToBeAloneHoldingOnBrownEyesUpAtNightBreatheOutWannaBeYouLoveInTheDarkSaturdayMourning

Summer week 2 spellings 2025-05-16

20 Items: happybrightbrightto dieshiningglowingvery hotanimatedvery goodcarefullyassistantlonelinessvery happypleasantly warmnot of this worldpowerfully pleasingwith a shining surfacevery impressive or beautiful.warmly and pleasantly cheerfulbright light surrounding an object

Cannoli Word Search 2025-11-04

10 Items: TamaleOnigiriNovemberEmpanada"Food with ____.Spicy Sichuan wonton ______.A classic, creamy Italian dessert.The popular American holiday later this month.The main ingredient in the dough wrapping No. 8.Chicken pot __, salted caramel dark chocolate pecan __.

Classroom 2024-11-03

11 Items: An instrument for writing with ink.Something you sit on in a classroom.A period of teaching or instruction.A person who attends school to learn.An exam to evaluate students' knowledge.Assignments students do outside of class.A small item used to remove pencil marks.A collection of pages with information or stories....

Robin Hood 2025-05-27

12 Items: – Where Robin Hood hides.– Robin Hood’s true love.– Robin’s classic outfit.– Robin's favourite weapon.– What Robin Hood fights for.– A cheerful monk in the gang.– The villain who chases Robin.– The rulers some rebels fought.– The hero who gives to the poor.– What the Merry Men were seen as.– Who Robin Hood might be based on....

An inquiry into what motivates people to commit crime 2025-09-04

8 Items: 63-83% of people who get ....... are aged 21-25People can be influenced by friends, family and the .......Inflation takes away the ........ for people to buy things.Some people are ....... to become involved in criminal activity.If kids are raised in bad situations it ......... the risk of them committing a crime....

Lab Final Review - Word Search 2022-11-29

20 Items: Type of data that is numeric.The ______ Exchange Ratio (RER).The first phase of VO2 kinetics.The study of the speed of a response.MAP is _______ during dynamic exercise.Release of this hormone lowers blood glucose.COPD is an example of an ________ lung disease.We measure systolic and ______ blood pressures....

The Goose Girl Pgs. 14-19 2023-08-09

10 Items: You are the true ______.What is the horse's name?I saw some very ______ things.Whose hat blows off in the wind?Who did they throw into the sea?Who watches the princess all day?Who does the real princess marry?Where did the king listen through?Where does Falada sing to the wind?Who does the princess tell her story to?

valentines day 2023-01-16

16 Items: The French word for love.The Italian word for love.This Greek goddess is associated with roses and love.Watch these movies with your sweetie on a special day.The holiday has roots in this Middle Ages Roman festival.The most popular flower to give and receive on Valentine's Day.This Roman god of love is often used as a symbol for Valentine's Day....

Debut 2025-10-28

11 Items: Our SongTim McGrawCold As YouThe OutsideMary's SongStay BeautifulPicture To BurnShould've Said NoA Place in This WorldTeardrops On My GuitarTied Together (With a Smile)

Special Word Search 2024-06-24

98 Items: boxdottopyouareletnoteachsomeeyestallstargrayjumpsingfellmosthungeasyshopgrewnamedeepharddoesminecaresuretaketimenosesshortroughsongssillyguessluciastoolheardvoicetriedpainttrustaboutheartwoodenpeoplecarvedgoldenprettylittlestayedinsidearoundwalkednarrowtiptoestrongreallyshouldmatterslowlyhopingothersremindgroundspecialvillagechippedexplainoutside...

FTFC Word Search 2024-02-08

20 Items: The __________ is responsible to approve the BSN FTFC Policy.BSN Treat Customer Fairly Charter (TCF) can be found in the Bank's __________.The Bank must handle financial consumer complaints __________, fairly and effectively.The Bank must ensure that financial consumers are provided with fair terms in ___________ with the financial consumers....