health and wellness Word Searches

Gabe and Marissa 10 year anniversary 2024-06-28

19 Items: gabeelmololoamahkatobeachdecademarissachicagograciosagonzalezemilianoillinoisactivismrogersparkphilippinesanniversaryhumanrightslakemichigan

Elements and Principles of Art 2022-11-27

13 Items: lineformshapecolorvaluespacetexturebalancevarietypatternmovementemphasisproportion

EK2 Units 5 and 6 2023-04-13

13 Items: teaeggarmlegricecolaheadfacejuicepeachelbowcookiehamburger

Mama and the Doctor’s Wife 2023-09-21

13 Items: venscopevistachamoisbustledmundanescantlingbrusquelyintricategallantlyharrumphedobligationsalterations

Learning Preferences and Coaching Styles 2023-09-26

13 Items: visualreadingwritingsurveysauditoryinterviewsautocraticdemocratickinestheticinventoriesobservationlaissez-faireself-assessment

Daniel and the Lions Den 2024-08-05

13 Items: dengodkinglionsdanieldariusdecreebabylonkingdomloyaltyworshipjealousyconspirators

Arboles y Jardineria (Trees and Gardening) 2023-02-25

18 Items: bojhayaramoramabahíabancobrotefrijolabedulrenciacortezabrócoliarbustorepollopimientomariposacampanulremolacha

Rachel and Jeff are Getting Married! 2023-03-30

18 Items: dpthomelovebridegroomringstravelfamilyniecesweddingbruiserdancingcousinsteacherpandemiclaughterhoneymoonstrawberryplace

ICT "Visual Basic and Flowchart(Algorithm) 2014-08-10

20 Items: OOPOLErunformframelabelprocessprojectprocessterminalassemblyiterationselectionbillgateszuckerbergpseudocodesequentialprogrammingvisualbasicvisualbasic

Winningest NFL Coaches and their Teams 2020-11-19

18 Items: DonShulaPaulBrownChuckNollTomLandryTomCoughlinNewYorkJetsBillParcelsGeorgeHalasMikeShanahanChicagoBearsDenverBroncosNewYorkGiantsDallasCowboysBillBelichickMiamiDolphinsClevlandBrownsNewEnglandPatriotsPittsburghSteelers

Los verbos presentes define and conjugate 2023-01-26

18 Items: jugarmirarestarpasartocarhablarcantarviajarbailarayudarllevarmontarcocinarcomprarvisitarescucharestudiarpracticar

Viajes y turismo (Travel and Tourism) 2023-02-26

18 Items: guíamapaplayahotelviajemuseocomidaparquecochesdestinoturismocrucerocampingaventurapasaporteexcursiónmonumentoaeropuerto

EK2 Units 5 and 6 2023-04-13

13 Items: teaeggarmlegricecolaheadfacejuicepeachelbowcookiehamburger

Grammar and Virtue Word Search 2023-06-26

13 Items: nounverbadverbpronounjusticeprudenceadjectivefortitudetemperanceconjunctionprepositionmagnanimityinterjection

FREE TIME: RELAXATION AND LEISURE 2023-12-05

13 Items: gooffchoresdabblerfruitfulrewardingfulldiaryshopaholicbehookedongetuptosththerapeuticlockoneselfawaykeenparticipantbigfanofanythingculture

Nicky and Lissie Word Search 2024-03-08

13 Items: lovepromsillylithycupidtulipskissesforeverflowersromancechildhoodlovebirdssweethearts

Spanish First Vocab list 2024-09-05

38 Items: onetwozerofourfiveHellothreepleasenothingSee youy/menosLikewisesir, Mr.Good byedelightedthank youmiss, Missmadam, Mrs.(very) wellokay, so-soGood morningGood eveningHow are you?See you laterGood afternoonYou're welcome. . .My name isSee you tomorrowWhat time is it?It's one o'clockWhat's happening?And you? (formal)thirty, half-pastWhat is your name?...

trs 5b w17 pt2 2022-06-15

10 Items: adj. Foods from milk.n. e.g. Van Gogh, Da Vinci.n. What and how much you eat.food n. Tasty but unhealthy food.adj. Not having too much anything.v. Get rid of something. Put in the trash.adj. Adjective for food cooked by a flame.n. What you eat three times a day. Not a snack.adj. How you feel when something is horrible or yucky....

trs225b bt4wk15pt1 2022-07-07

10 Items: n.A gentle wind.adv.How a crab walks.n. e.g. Taiwan, UK, USA, France, Japan.n.A part of a plant that is underground.n.The tall, thin, central part of a plant.n.A colourful part of a plant that attracts bees.n.Something inside fruit that can grow into a new plant.n.The ground. Plants take water and nutrients from this....

SOL 7: The Virginia State Government 2023-12-04

10 Items: The government’s written planThe highest court in our stateTo make a change in the ConstitutionThings that ONLY state governments can doThe state’s leader of the executive branchThe state’s leader of the legislative branchA system where the branches of government monitor eachotherThings that BOTH the state governments and U.S government can do...

Mellifluous Word Search 2023-12-11

10 Items: Active or occurring at nightPleasingly smooth and musical to hearUnable to be attacked, questioned, or defeatedExtremely idealistic; unrealistic and impracticalAble to recover quickly from difficult conditionsShowing strong feeling; forceful, passionate, or intenseHaving or showing a feeling of vague or regretful longing...

9325 The 10 Bridesmaids 2024-03-06

10 Items: A young woman.The man getting married.Being ready ahead of time.Lacking good sense or judgment.Having or showing good judgment.To stay awake and pay attention.A way to describe the place where God rules.Devices that give light, oil lamps to see in the dark.A liquid used for fuel used for the lamps to burn and give light....

Matter 2023-09-22

10 Items: - A material is drawn into a wireThe changing of a solid to a gas, dry iceChange in state of matter from a gas to a solidNo definate shape or volume, atoms have highest energyThe reason we have aluminum foil, gold jewelry, and coinsDefinate shape and definate volume, atoms have very little energy...

Respectfulness Word Search 2022-11-30

8 Items: is keysees allare two-edgedreject the Lordgo behind another's backall/everything with respectand Greed get you nowhere goodidolize others or yourself, God is the only God

computer 2024-07-19

10 Items: A set of rules or steps followed to solve a problem or perform a task.Software intended to damage or disable computers and computer systems.A set of rules governing the format of data sent over a network or the internet.The process of converting information into a code to prevent unauthorized access....

Human system-Brandon 2024-06-22

5 Items: includes your heartincludes your skullit has your musclescontains digestive juicesincludes your lungs and nose

Cat Word Search 2024-01-18

62 Items: ifcatfatliecutandaddsubyoutheyouthemyaevazaclionuglyrudereadit'stinalilynategwenadamandytheodinazebrahippomeanycolorchrisdraketylerarielharryalicemegankittybillymilkysyndyanitastacyhoneystupidtimtinnikkiebarbiebrinnykristydonniecassiedillonjustinawesomemellonyanthonyelephantstarhighMan's best friend

U6 Homeostasis 1 Wordsearch 2022-11-15

21 Items: increase the speed of enzymesmolecule that an enzyme acts uponable to dissolve in other substancesThe energy needed to start a reactionsmaller pieces of something larger, that make it upa state of balance of the internal conditions of an organismenzymes are specific to the molecules in which they work upon...

Vocab word 4 2023-02-16

15 Items: marked by luxury or pleasureproducing the desired outcomea release of emotional tensionrelating to laughter; laughableto overwhelm; to fill beyond capacitydestructive to both sides in a conflict.of, resembling, or relating to twilight.to regard with respect, awe, or adorationpraise and honor received for an achievement....

planets 2023-11-23

20 Items: parismessitokyoaccentneymarmodriccricketcheeroispyramidskangaroosred and whitekevin debrunedragon festivapizza icecreamronaldos home townsafari most animalswhere lego was madewhere the king livessunniest place in worldwhere most cars are made

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Citizenship Vocabulary Word Search 2023-09-14

9 Items: Rule by the people _________________________An agreement between two or more people or governments _________________________The group of people within the government that makes the laws _________________________The idea that you are born with certain rights that can not be taken away _________________________...

Business Studies 1.5.3 & 1.5.4 2024-05-12

10 Items: a good whose demand drops when people's incomes risea good whose demand rises when people's incomes riseThe number of people willing to work but out of work and seeking workFit for ________ The goods and services should be fit for the reason they are supplied for,...

Business Studies 1.5.3 & 1.5.4 2024-05-12

10 Items: a good whose demand drops when people's incomes risea good whose demand rises when people's incomes riseThe number of people willing to work but out of work and seeking workFit for ________ The goods and services should be fit for the reason they are supplied for,...

LK 2024-04-09

15 Items: (Rebirth)(Snake-like)(Short Story)(Skillful Act)(Social Rules)(Afternoon Nap)(Group of Stars)(Sad and Pensive)(Business Starter)(Related to Cooking)(Sentimental Longing)(Exaggerated Cartoon)(Colorful Patterned Toy)(Harsh Discordant Sounds)(Highest Point in an Ancient City)

Jaisoif Word Search 2024-04-28

15 Items: a teaa sodaand youThank youa lemonadeit is trueI am thirstyI would likeI invite youa tomatojuiceA grape juiceAn apple juiceplease (formal)an orange juiceAre you thirsty

The Three Bears 2024-05-20

9 Items: middle size: ______a room where a person cooks: ______feeling that you want to eat: ______Baby Bear is unhappy because his chair is ______.The three bears go into the kitchen to eat ______.Papa Bear is ______ because someone ate some of his food.The first food is too hot and the ______ food is too cold....

Versailles Word Search 2023-08-10

15 Items: January 30, 1933: Adolf Hitler assumes this position in Germany.June 28, 1919: This treaty is signed, officially ending World War I.September 1, 1923: This natural disaster devastates Tokyo and Yokohama.March 4, 1933: This man becomes the 32nd President of the United States.1934-1939: This environmental disaster intensifies in the American Midwest....

Drama Word Search 2023-10-19

12 Items: a play written or adapted for television.a list of all the characters in the play.the perspective from which a story is toldFeeling or atmosphere that a writer creates for the readera dramatic work intended for performance by actors on a stagedescriptions of setting, characters, or actions (usually in italics)....

Internet Word Hunt 2024-05-12

12 Items: This is the most visited website as of nowOn average, internet users spend 6.5 _____ online each dayThe government used an internet system in order to share ___________The first operational computer network developed by the Department of DefenseThis application allowed users to easily connect to websites and browse the internet...

Café vocab 2024-04-28

15 Items: a teaa sodaand youThank youa lemonadeit is trueI am thirstyI would likeI invite youa tomatojuiceA grape juiceAn apple juiceplease (formal)an orange juiceAre you thirsty

langley 2022-06-08

12 Items: friends3rd _______espanol timeexersize timecomputer timeplay play playlets experimentpaint and createcalm time breathe resttime to check out bookslets learn about composersms laurenzi mr becker mr gilchrist

Our Pets 2024-07-09

8 Items: eats bugssits prettydainty lil thangorange and sturdyloves blueberriesloves gatorade bottlesruler of the countertopsone of these is not like the other

Meeting Wordsearch for my Food Drop Off Hero 2022-10-05

21 Items: What we swipedThings to comeWhere we were bornWhere we both liveWhat I am with youSomething you work onCity you were born inWhat I am in right nowSomething we both loveLives super close to mePlague I currently haveThe chance we connectedPlatform that connected usHow we have been communicatingWhat you were wearing yesterday...

Spanish Vocab 2022-09-14

39 Items: OneTwoSixZeroFourFiveHelloThreeSevenpleaseNothingSee youLikewisesir, Mr.Good byedelightedthank youMy name ismiss, Missmadam, Mrs.(very) wellOkay, so-soGood morningGood eveningHow are you?See you laterGood afternoonSee you tomorrowWhat time is it?It's one o'clockWhat's happening?And you? (formal)thirty, half-pastWhat is your name?Pleased to meet you...

TED 2022-11-14

20 Items: The creator of airThe only trees leftHe was that someoneProvide us with airIts not always goodThe creator of thneedThe “WOMAN” Ted lovesThe protector of treesDan and Rose’ son _____The billboard says____________A powerful and dangerous thingThe only thing you will ever needThe animal that watched Ted is a ____what factory’s have brought to the air...

Chapter 4 Word Search 2023-05-12

20 Items: Fail to care for properlyFree from outside controlFailure to take proper careLack of respect of courtesyMaking false spoken statementsUsing finances inappropriatelyBeing worthy of honor or respectUnacceptable or improper behaviorKeeping something secret or privateActs which do not suit one's statusMoral principles that govern conduct...

GRE Vocab List 4 2024-02-27

29 Items: childishhardshipa beginnerdull and slowcausing tearsextreme povertyphysical beautycowardly, cravensocially awkwardeasily understoodlearned; scholarlycontaining warningscarcity, a lack ofboldness, arroganceinsubstantial/ dullwork which imitatesinclined to fightingharmful or unfriendlydiligent, hard-workinglessen the severity ofappearing true or real...

Endocrine System 2022-08-04

20 Items: also know as alpha cellThyroid gland secretes itparathyroid gland targetsparathyroid gland producesThyroid gland also make thisanother name for insulin cellsanother hormone found in thymushyposecretion of growth hormonepromotes sodium & water retentionthis hormone is for tissue growthantagonist of the parathyroid gland...

Fluid and Pressure Word Search 2013-05-24

13 Items: GasMassFluidSolidShapeLiquidVolumeMatterDensityBernouliBuoyancyPressureViscosity

REVIEW - UNITS 1 AND 2 2021-04-14

13 Items: DOORDESKBOOKBALLDOLLBIKEBOARDCHAIRROBOTWINDOWPENCILERASERCOMPUTER

Chapter 2 Multiplying and Dividing 2022-12-09

13 Items: ofpertimesfactordivisorproductdividendquotientrepeatingmultiplierreciprocalterminatingmultiplicand

MOSES AND THE BURNING BUSH 2023-05-25

13 Items: Igodmosesafraiddesertsandalscuriousshepherdmounthorebhidhisfaceholygroundburningbushflamesoffire

Vitamin B and Vitamin C 2017-04-24

13 Items: haireyesmeateggsfishliveranemiapoultryalmondsspinachdiabeticsantioxidantabetalipoproteinemia

Ancestors and Homelands Word Search 2024-06-18

13 Items: catodavidellenelizahenryraineymorrismahalafayettevirginiahenriettajeffersonmississippi

living things and their envrionment 2024-09-05

13 Items: osmosisvacuolewiltingisotonicdiffusionhypotoniccrenationturgidityhypertonichaemolysisplasmolysischloroplastcellmembrane

Rainforest Retreat, Holiday Park and Backpackers 2015-04-23

18 Items: sixtenthreemadeupretreatensuitetreehutsfourteeneighteenthirteenmonsoonbartwentyfourbackpackersholidayparkshorthaired46cronstreetvendingmachinesmonsoonrestaurant

Conjugations of ALLER and INFINITIVE VERBS 2022-05-02

19 Items: vavasvaisvontêtreallezalleravoirallerjouerfaireallonsmangergagnerécoutervoyagerregarderapprendretravailler

Clammy Word Search 2023-05-15

15 Items: confusing or perplexingbroad and sturdily builthesitate, stammer, waverin a profoundly wise mannerhopeless; bare; dreary; dismaldifficult or impossible to understandunwilling or unable to believe somethingunpleasantly damp and sticky or slimy to touchin a manner marked by extreme care or delicacybuy or obtain (an object or asset) for oneself...

Simera Gudeta 6th grade 2024-05-21

15 Items: a planet with 365 daysgas turning into liquidliquid turning into gasthe closest planet to the suna planet with supersonic windsa movement of shaking in the worlda big planet with a giant red stormthe coldest planet in the solar systemthe hottest planet in the solar systema planet that had a thicker atmosphere...

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Idolatry Word Search 2024-04-26

24 Items: pythonidolatrysummonedstagnantabsurditytrumpetingpenetratedcagulatingsympatheticincandescentperiodicallyhyperventilatedwidely or loudly.to a solid or semisolid state.no activity; dull and sluggish.showing, or expressing sympathylight as a result of being heated.in forcing a way into or through (a thing)....

Cheap Word Search 2023-07-15

11 Items: It is the opposite of friendly.It is the opposite of 'generous'.My neighbor talks a lot. He is ...It is the opposite of 'dependent'.He is not fat and not thin. He is ...My father is not funny. He is very ...A belt, a tie, scarf, etc. are called ...I don't like shy people. I prefer ... ones.A kind of jewelry you wear around your neck....

Authentic Documents Services And Counterfeit Bank Notes 2022-07-09

5 Items: +44 7459 530545ID..... "@Jameskind65"Me ID..... Jameskind65.Address.... jameskinds65@gmail.comare a Team of IT Experts specialized in the production of authentic Documents and Counterfeit bank notes. We work with government officials, professors and professional hackers from China, US, Russia, Taiwan etc. All these documents are registered into th

CQ Word Search 2023-05-04

14 Items: The rate of energy consumption.Short for modulator/demodulator.A conversation between two radio amateurs.The metric prefix for 106, or times 1,000,000.A connection made to the earth for electrical safetyThe metric prefix for 10--6, or divide by 1,000,000.A machine that can convert keystrokes into electrical impulses...

M3 Unit 1-3 vocabulary 2023-09-01

11 Items: the ovule becomes this partmany food chains linked togetherthe ovary of a flower becomes thismethod of identifying an unknown organismtype of process where humans control traitspollen moving from the anther to the stigmathe passing of features from parents to offspringtype of process where the environment controls traits...

Suffixes Week 2 2024-05-09

11 Items: A single feather feels _____ .Ms. Stapleton's humor is _____ .Please be ______ and be honest with me.That is made out of glass, so it is _____ .Mrs. Kleeman's _____ is her love for her students.TV used to be _____ , it was only black and white.Studying your spelling words is _____ for the test.Ms. Firman says that "_____ is coffee in all forms."...

Versailles Word Search 2023-08-10

15 Items: January 30, 1933: Adolf Hitler assumes this position in Germany.June 28, 1919: This treaty is signed, officially ending World War I.September 1, 1923: This natural disaster devastates Tokyo and Yokohama.March 4, 1933: This man becomes the 32nd President of the United States.1934-1939: This environmental disaster intensifies in the American Midwest....

Word Search test 2022-12-06

11 Items: game makerwebbed feetno sided shapeman's bestfriendelectrifying gunmechanical stairsamerican currencyedge of a mountainplural form of leaftransparent object on your housedangerous to both computers and humans

MS-PS4-1 and 2 - Waves 2021-05-08

18 Items: PeakWaveHertzMeterSoundLightCrestJoulesMediumTroughVelocityAmplitudeFrequencyTranverseMechanicalWavelengthLongitudinalElectromagnetic

Conjugations of ALLER and INFINITIVE VERBS 2022-05-02

19 Items: vavasvaisvontêtreallezalleravoirallerjouerfaireallonsmangergagnerécoutervoyagerregarderapprendretravailler

(Phonics) Starter Unit and Unit 1 2023-03-20

18 Items: bedcatdaddogfatgetmadmatpetredsadtedwetbigfishnamebirdsmall

Fluid and Pressure Word Search 2013-05-24

13 Items: GasMassFluidSolidShapeLiquidVolumeMatterDensityBernouliBuoyancyPressureViscosity

Enzymes, Lock and Key theory 2021-02-25

13 Items: sitelockkey.activeenzymeprocesspadlockcomplexproductsreusablesubstrateunchangedbiological

Saint Patrick Search and Find 2022-11-01

13 Items: saintbishopescapeirelandslaverypatrickcatholicstpatrickmarchxviiconversionmissionarygreatbritancanonization

Sow and Reap Word Search 2023-01-24

13 Items: suneatsoilfoodbeesseedswaterherbsfruitgardenflowerscommunityvegetables

Summer foods and drinks II 2023-04-29

15 Items: teaicerollpoketacossaladsaladpizzacakesmojitochickencevichelime piemargaritabruschetta

THE HARE AND THE TORTOISE 2023-04-17

13 Items: hareslowshellfunnysillyfieldstickssteadyloudlyworriedspeciallightninginteresting

Fundations Unit 10 and 11 2020-05-04

13 Items: anyhownowoutournonmanydownaboutotherfriendanothernothing

Vitamin B and Vitamin C 2017-04-24

13 Items: haireyesmeateggsfishliveranemiapoultryalmondsspinachdiabeticsantioxidantabetalipoproteinemia

Frog and Toad Word Search 2019-07-13

13 Items: FrogToadbirdsseedsdreamgardenCookiesfriendsflowersbraverytogethersleepingwillpower

Ate and Ation words 2021-05-20

9 Items: CreateTranslateDuplicateLiterationExplorationInvestigateManipulationConsiderationRecommendation

Shapes 2D and 3D 2022-12-12

9 Items: cubecuboidspherecirclesquarecylindertrianglerectanglesemicicrle

Input and Output Devices 2022-12-31

9 Items: mousemonitorheadsetspeakerprinterscannerkeyboardearphonesmicrophone

Catholic Prayers and Practices 2023-01-02

12 Items: RosaryretreatdoxologyblessingHail MarybenedictiongenuflectionsacramentalsLord's PrayercontemplationSign of the Crossfastingabstinence

'oi' and Common Words 2023-03-13

9 Items: boilcoinjoinsomethenlastspoiltheirtoilet

que and gue words 2024-07-31

9 Items: vagueleaguetonguecliqueuniqueplaquefatigueantiquecritique

Lifeguard Behaviour 2023-10-29

10 Items: alertwhistlevigilantscanningenforcingpreventionBy wearing your lifeguard pinny you arethere should be NO this while lifeguardingTo be rescue ready you need to have this itemThis contains gloves, mask and small first aid items

family and home 1 2022-12-01

10 Items: wifeauntfloorfatherhusbandgrandmarelativesdining roomde baño bathroomde dormir bedroom

Digraphs and Bossy R 2023-06-22

9 Items: furchopfishshipthingirlmothcorkshark

Fire Trucks and More! 2023-09-27

10 Items: hoseblazesirenchiefenginelightshydrantstationdalmationextinguish

Review U6 and U7 2021-06-22

9 Items: postfrogssnakesmuseumofficerabbitsturtlestheaterhospital

short and long e 2024-03-18

9 Items: bestneckteamheadwheelcreepbeachcleanstreet

unit 10 2024-05-01

17 Items: breaks up meteorsaborbs UV radiationcontains ozone shielddebated by scientistsall weather events occur herephases of warm and cool climatethickest layer of the atmospheresurfaces that reflect insolationlong term pattern of temperatureinclude water vapor, methane,CFCs, etc.short term temperature and precipitation...

WW4 U12 2024-07-08

17 Items: to ask forgreat angervery, very angryto take the place ofto set or keep apartto grasp or hold tightlypower or knowledge; skillcomplete joy or happinessa return to a normal statea movement of the arm or handto like better; to choose firstto touch in a tender or loving wayfriendly; good natured and pleasantto persuade or urge in a gentle way...

ERIKSON'S STAGES 2023-03-08

8 Items: Trust vs. MistrustInitiative vs. GuiltIntimacy vs. IsolationIndustry vs. InferiorityEgo integrity vs. DespairIdentity vs. Role confusionGenerativity vs. StagnationAutonomy vs. Shame and doubt

Vocab 2023-01-17

10 Items: oddnewrealusualHabitnormalsuperiorridiculousa case or an example that does not follow a rule or conventionunusual and exciting because of being from another part of the world

Malicious Software - CAT 2023-07-24

17 Items: Type of unwanted softwareUse of software without purchasing itA large network of compromised computerslegitimate software that monitors your online activitycriminal activities involving computers and the internetGathering information about a person in a position of powerdistribution of a story that is not true on social media sites...

VET 246 Ultrasound 2022-12-19

25 Items: Fine detailing probeBlue away, red towardsBright, produces echoesWhat traps air on a pt?There are 256 shades of___?What is in the transducers?Time motion mode (2d scale)Strength of returning echoesDark, produces few or no echoesDetermines what gray scale is usedSimilar to convex but a lot smallerMost commonly used probe in small animal...

July words search 2023-06-29

31 Items: determinedan umbrellajuly in frenchjuly in Spanishcounterclockwiseastonish or shockecstatically happya confused mixturevery loving or loyalextremely impressivecurious or inquiringspend time aimlessly; idleto look amorously or wantonlygreatly dismayed or horrifiedgreatly surprised or astonishedcompletely confused; very puzzled...