health and wellness Word Searches

DECMAIL FROM FIGUERS TO WORD 2022-07-13

23 Items: 1.40.61.671.26.517.120.105.0235.705155.520.02399.999tenthes14tenthssixtenthesone POINT TWOpoint FIVE ONEpoint ONE TWOpoint ZERO FIVEPOINT ZERO TWO THREEpoint ZERO TWO THREEhundred fifty-five and five tenthsnine hundred ninety-nine thousandths

Popular 2000s shows 2023-02-04

23 Items: guyBadgirlpiecehousenarutoball zavatartitansOfficepokemonmontananaturalDiariesso ravensimpsonsPossiblesquarepantsodd parentsBang Theorylittle liarsI Met Your Mothersuite life of zac and cody

Sight Words A1 2023-08-17

50 Items: aioftoinisitheonasatbeorbyweandoiftheandyouwasforarehisonehadbutnotallcanuseshehowthatwiththeythishavefromwhatwerewhenyoursaideachwordstherewhichtheir

Puppy Love 2023-06-05

10 Items: Shiro became ______.Shiro began to _____ often.Marilyn was Shiro's ______.Shiro _____ for about two miles.Shiro was very wet, and he was _____.A dog was _____ in front of the house.People were ______ when they heard about Shiro.Then the Nakamuras moved to Aka, a smaller _____.Shiro ____ Marilyn very much and wanted to be with her....

Look who's play first base 2024-04-26

16 Items: (a strong bond)(made a loud noise)(a certain body type)(a aircraft in space)( a very fast motion)a desire to do something(an urge to do something)(taking part in a activity)( getting up after sleeping)(placed in a non obvious place(an area with some sort a hills)(something going around a planet)(someone/something that went into water)...

W Words 2023-04-28

10 Items: thin and weakextreme angercareful, cautiousTo bring about or inflictphysically and mentally fatiguedTo quarrel in a noisy or angry wayto roll about in a lazy, clumsy, or helpless wayto draw back suddenly, as though in pain or fearAn intentional, knowing relinquishment of a legal right....

Wedding Word Search 2024-04-18

10 Items: Symbols of never ending lovePerson of the Bride's bridal partyThe annual celebration of marriagePerson of the Groom's wedding partyFlowers arranged for the Bride to holdPromises made between the Bride and GroomTraditional dessert of wedding receptionsVacation the married couple take post weddingThe celebration of love between the Bride and Groom...

Julie and Maritza 2022-01-21

9 Items: 19752021JulieOchoaSportsSoccerMaritzaAlbrightBasketball

Cats and Dogs 2022-10-13

9 Items: catliontigercorigesphynxcougerPersiandevonrexamiricancurl

JACOB AND ESAU 2022-12-28

9 Items: wombheelwildstewhairyhunterrebekahfamishedbirthright

design and technology 2023-04-16

9 Items: cadcamDesignthinkinginnovationcreativityexperienceprototypingdevelopment

Ethics and Compliance 2024-07-01

9 Items: kycethicsspeak-upantitrustintegritycomplianceethisphereantibriberywhistleblowing

Ella and Lucy 2024-08-13

9 Items: CaringLovingEmpathyHonestySharingRespectKindnessGenerousFriendship

English word search (key words) 2023-01-29

9 Items: a perfect societyan injustice filled societyan unresoned and unfair judgmentsomething that is harsh cruel and brutala physical force intended to hurt someonea system where people are ranked by statusa dissagreement between two or more peoplea group of people that controll the countrycomparing two things side by side creating a type of comparison

Jobs and Careers Word Search 2015-03-30

19 Items: ACTORPILOTAUTHORBANKERDOCTORFARMERTAILORWRITERAVIATORBUILDERDENTISTSOLDIERDIRECTORMECHANICMUSICIANREVIEWERBIOLOGISTSECRETARYJOURNALIST

Two stuntwomen and a stuntman 2022-11-06

20 Items: intoartstoughextramajorawardstuntskillhomessportydoubleviewerinjuredclothingeasy-goinghigh heelscompetitivesword-fighttrampoliningteacher (Physical Education)

Tools and Products for Haurcutting 2023-04-25

19 Items: capecombsrazormirrorshearstowelsalcoholbrushesclipperflatironblowdryerneckstripcarvingcombspraybottletrimmeredgerhandsanitizerthinningshearssectioningclipswetdisinfectant

Month days and Week days 2023-04-26

19 Items: mayjunejulymarchaprilaugustsundaymondayfridayjanuaryoctobertuesdayfebruarynovemberdecemberthursdaysaturdayseptemberwednesday

4.5 Soft c and g 2023-05-25

19 Items: agedicemicewagegymsyourroadcentspricegiantpagespeacepounceplacedofficechangesmessagegiraffepeaceful

The Mouse and the Boy 2017-08-21

19 Items: oiltoyjoyboynowsipboilsoilbluetherewheremousehousecrownbrownclownsniffsmileblouse

Thanks from Kayla and Sophie 2016-05-23

19 Items: ThanksSuperbRadjobNicejobGoodjobCooljobThankyouIloveyouFantasticExcellentAwesomejobAwesomeworkMagnificentTipofthehatYou'rewelcomeWearegratefulWearethankfulIappreciateyouWonderfulpeople

Kynedi's word search 2024-02-01

10 Items: fool or cheat (someone).totally bewilder or perplex.abundant in supply or quantity.disappear suddenly and completely.take hold of suddenly and forcibly.having a sharply strong taste or smell.exclude (someone) from a society or group.easily persuaded to believe something; credulous.contrary to reason or common sense; utterly absurd or ridiculous....

Vocabulary Troy 2023-04-13

20 Items: If you aren’t ready to buy.costs that change each month.costs that remain the same each month.cost that is paid for something of value.an expense that happens only occasionally.partial payment made at the time of the purchase.the organization of all of your expenses based on your income....

CRM Word Search 2024-03-27

28 Items: _______ to caseFont for all notesProvider _______ SearchCategory Area:__________Case Summary: ___________Customer Relationship ManagementPhone System used to answer callsWhere you enter in provided referral infoBlank fields will display with a red what?Website to find a dentist (no domain included)Category Sub Area: _____N/A_____ (spelled out)...

Epidemiology - Topic 1 2023-01-27

7 Items: W__ gets the disease?W____ does the occur?H__ is the condition contracted and spread?W___ do people or animals get the condition?Key elements in epidemiology? P_____P____T___environment, Agent and Host are the component in epidemiology t_______Why we need to use "epidemiology's one word questions"? To come out with c______m______

APES- unit 7 2024-04-19

10 Items: beneficial for the forestplanting trees and crops togetherlarge shafts dug deep into the grounda blend of surface and subterranen miningland degradation severe enough that land becomes desertWhen the urban area expands outward into the rural surrondingsThe process of restoring the land to a natural state after mining is done...

Wolfishly Word Search 2024-04-26

10 Items: Crying which is usually loudloud noise which is quick and sudden.when you find something disgustinga class of people usually in the higher classes or famous.to chew on something for an extended period of timean outlined figure of someone.(Usually in the dark)....

Human Dignity & Human Rights 2024-01-23

7 Items: is the worth (value) each individual has for being humaninvolves reverence, ________, and protection towards each personour worth was originally based on merits, _______, or achievementsa privilege or freedom all individuals have for the fact of being humanour worth comes from the fact of being created in the image and likeness of _____...

SunSync Elite Light-Reactive Lenses 2023-05-16

10 Items: SunSync Elite lenses are darker ________Another name for Light-Reactive lenses is _____________SunSync Elite is backed by a one-year, 100% ____________ guaranteeSunSync Elite delivers groundbreaking fade-back and __________ speedSunSync Elite Light-Reactive lenses change from dark to clear in _______...

Night Vocabulary & Spelling Word Search 2023-02-24

25 Items: (v.) recall the past(adj.) the quality of being holy(adj.) offering little or no hope(v.) cancel officially; revoke; repeal(n.) open resistance; a hostile exchange(n.) an absence of emotion or enthusiasm(v.) have and exercise; to be able to use(adj.) known widely and usually unfavorably(adj.) conspicuous in position or importance...

The Tempest 2023-05-24

40 Items: severelyWatchfulnessAlonso's son (9)Alonso's daughterImpossible to harmA drunken butler (8)Alonso's brother (9)Caliban's mother (7)the act of forgivingMessenger of Juno (4)Queen of the gods (4)Prospero's brother (7)Author's last name (11)Caliban to Prospero (5)Prospero's daughter (7)Displace and substitutethe name of the play (10)...

Imperialism: Word Search 2023-10-30

10 Items: the quality of or state of being self-governingan extreme nationalism marked by aggressive foreign policya section of a country where a foreign nation enjoys special rights and powersthe idea that the United States and Latin American nations should work together...

Canada's Provinces and Territories 2015-10-17

13 Items: YukonQuebecAlbertaOntarioNunavutManitobaNovaScotiaSaskatchewanNewBrunswickNewfoundlandBritishColumbiaPrinceEdwardIslandNorthwestTerritories

Clothes and Foot wear 2020-11-16

14 Items: topcropvestneckbootsdressskirtbootsshoesjacketblousetightsturtlesweater

Renewable and Nonrenewable Resources 2021-03-22

13 Items: coalbiomassrenewablepetroleumhydropowerwindenergynaturalgasfossilfuelssolarenergyconservationnonrenewablenuclearenergygeothermalenergy

MOVIE AND TV SHOWS 2021-09-03

14 Items: DRAMAHORRORCOMEDYCOMEDYMUSICALANIMATEDTALKSHOWTHRILLERROMANTICGAMESHOWSOAPOPERADOCUMENTARYREALITYSHOWSCIENCEFICTION

Reflexive and reciprocal pronouns 2021-04-26

13 Items: myselfitselfobjectpronounhimselfherselfoneselfsubjectyourselfsentencereflexivereciprocalthemselves

Long ago and now 2023-10-09

13 Items: sewtowntellfirewashmakelearnbegingamesthingslightschoresphones

Heart Attack and Angina 2024-02-28

13 Items: painheartchestanginaarterydenialnauseaobesitysmokingfatiguesweatingheartburnnitroglycerin

Heart Attack and Angina 2024-03-01

13 Items: emspainheartanginadenialnauseaobesityfatiguesmokingsweatingarteriesblockagenitroglycerin

My toys and room 2024-04-14

13 Items: tvbedcarballdeskbikedollkiteboatteddytraintablechair

Lauren and Carter's Wedding 2024-06-10

13 Items: lovebridegroomreesecarterlaurensurachfamilyaugustweddingfriendsmarriagecelebration

Colon Cancer Awareness Month! 2024-03-05

10 Items: 1 in __ people who get colorectal cancer have a family history1 in 5 colorectal cancer cases are now in people ____(under or over?) age 55How many genes on Myriad's MyRisk panel are associated with a risk for colorectal cancer? (Hint: Refer to the gene table)...

The Characters of Christmas 2022-12-11

10 Items: He is said to be the youngest member of Santa's reindeer team with a red glowing nose.The world’s best-known Christmas gift-bringer figure whose sleigh is pulled by a team of reindeer.Magical, dwarf-like creatures with pointed ears. They are Santa Claus’s helpers at the North Pole where they make toys in Santa’s workshop....

Heath and safety  2020-09-24

9 Items: washmaskDiethandsHeathHygieneSanitizedistanceLearning

Stores and Barbecue 2020-11-09

9 Items: forkspoonbakeryknivesgrocerybookstorenewsstandpaperplatesplasticcups

Mulan and Merida 2021-09-03

9 Items: RedBlue19982012MulanBlackMeridaRidingArchery

fruits and Vegetables 2021-11-18

9 Items: applecarrotbananagrapespotatotomatoorangecabbagebroccoli

Sounds and letters 2022-09-17

9 Items: planesunnybeachsummerholidaywaitingcartoonairportsunglasses

Cats and Dogs 2022-10-13

9 Items: catliontigercorigesphynxcougerPersiandevonrexamiricancurl

'f' and 'o' 2023-03-13

9 Items: forfanfitfurjobdogtopfoxfeet

Environments and Survival 2023-04-20

9 Items: preyhabitatpredatororganismsurvivalearthdayadaptationbiomimicryenvironment

qu and x 2023-05-15

9 Items: boxfoxmaxtaxsixquizquitqueenquick

Phases and Eclipses 2018-10-27

11 Items: MoonPhaseSolarUmbraLunarEarthShadowEclipseEclipseEclipsePenunmbra

Apps and Gadgets 2023-11-13

9 Items: iconwebcamrouterheadsetadapterflashdrivetouchscreencostumizableinterchangeable

The mouse and the motorcycle  2013-05-23

19 Items: ishedogmomdadboymattmicemouseralphkeithotherthingssettingmountainadventureapartmentmotorcyclemrsgridley

Legal, Moral, and Ethical Standards 2014-04-21

19 Items: LawTortScopeEthicsAgencyLiableMoralsConsentInformedPracticeStandardLicensureNegligencePrivilegedReciprocityRegistrationCertificationCommunicationConfidentiality

vowel teams -oe and -ee 2023-10-02

19 Items: doefoetoeseemoebeedeeddeepfeetseekmeetfeedkeepteenfreedeerseedheelfeel

Jobs and Places of Work 2016-09-08

19 Items: nursedoctorwaiterlawyerathometeacherstudentinashopwaitresspolicemaninaschoolinanofficeinafactoryinthestreetinahospitalshopassistantadministratorfactoryworkerinarestaurant

Causes and consequences of urbanisation 2024-07-16

20 Items: pushpullslumruralurbantokyodelhisocialnewyorkmegacityeconomiccommunitypopulationpopulationurbansprawlurbangrowthurbanisationenvironmentalnaturalincreaseinternalmigration

Aboriginal Connections, Trade and Networks 2024-08-19

19 Items: SpearCanoeOchreTradeStoneFlintTotemRoutesShieldNetworkMessageWoomeraMiddensKinshipDillybagCoolamonCeremonyFirestickSonglines

Monster Market 2024-05-05

50 Items: mybysadshyfatandbutpetcrylieflyspywhyskymeanthinbalduglynicelongcutehighbitelikeangryfunnyhappynoisyquietscarydirtyhairycurlyshortlightnightmightwritefightprettysmellyfrightflightbrightnaughtymonsterfriendlyhandsomestraightunfriendly

Common Word (50 Words) 2024-06-10

50 Items: iaofiftoonupinbyitasdoorisatanbehewehowbutforcanhisarenotthewashadandyouoneallwithhaveeachwhenwillyourfromthisweresaidtheywhatthattheretheiraboutwhich

ESSENTIAL NUTRIENTS FOR THE BODY 2014-12-14

75 Items: yamscornfatsoilseggsmilkmeatnutsfishpeasironcrabplumsugarflourbrownwhiteliverbonesteethbeansenergystarchcerealfruitsbutterhealthgrowthfruitsapplesorangerepairbananacheeseiodineonionsgarlicsardneavocadococonutcarrotspumpkinproteintissueschickenpeanutsmineralcalciumraisinsshrimpspotatoeoysterscaloriespotatoeseggplantvitaminsstrengthdiseasessoybeans...

Tricky Word Wall Words 2024-04-26

50 Items: bebydoheismemynoofsotoweallareandcowhowoneshetwothewhowaswhydownfromhavehereoncesomesaidsaystheywordwerewhenwhatcouldcoachtheretheirtodaywouldwherewhichshouldbecausepicturetomorrowstagecoach

Freedom Crossing pages 51-99 2024-02-20

16 Items: proofsimplyto stroll alonga small argumentleaves of a plantto turn or look awayclumsy; lacking skillconfused and surprisedsuffering from bad luckto go at a slow, easy paceboldly rude or disrespectfulto move around in an impatient wayfreedom from the demands of work or dutya state of great confusion or disturbance...

MOUNT BEULAH MB CHURCH 2024-05-07

36 Items: DRwmuAVEHALLLINEUNITHILLSCHOIRWIVESSTUDYBOARDPANTYBOARDCHORUSSCHOOLADULTSclerksWORKERSdeaconsACADEMYMINISTRYoutreachTO GLORYministrytrusteescommitteedeaconessministersDEPARTMENTLH BELL SRLADY GRACIEorientationTRANING UNIONBEULAH TERRACEB SHIELDS MANORREV DR EG SHIELDS SR

Frequently Misspelled Words 2019-05-20

50 Items: ToAndOffOurTooTwoFromGirlGiveHearHereKnewKnowManySaidThenTheyVeryWentWereWhenWithAboutAgainAskedEveryFirstGoingLearnMoneyTheirThereThirdTriedUntilWhereAlwaysAroundBeforeFamilyFriendLittlePeoplePrettySchoolThingsanotherBecauseReceiveThought

random words 2024-04-24

49 Items: sunredlabsparkdogscatsjobshaireyesnosebluepinkcampwordsclassteamschoirdancephonemusicfieldshowspizzabirdshourshandsmouthgreenwhiteblackschoolgroupstalentcloudsmoviessisterchurchfriendsanimalsprinterparentscountrybrotherteachersemotionssoftballenjoymentand rightvolleyball

Expressions, idioms, and modals 2022-11-23

10 Items: revivecolossalregeneratethat's lifetake a riskstorage lifefortunate lifenot in the leastmiserable, hard lifeall occupationes and statuses

Prepositions: place and movement 2016-09-09

13 Items: inonupoverintodownunderbehindnexttobetweentowardsoppositeinfrontof

April and Her Family 2014-03-25

13 Items: flowcookcubetooltooknooknoonfumeloomflowermowingmoonbeammountain

Madeline and her Friends 2024-07-08

13 Items: nonaluluannechloepepitonicoleyvettejaninesimonesylviemoniquemadelinedanielle

The Little Mermaid pgs. 75-81 2023-10-13

12 Items: We are the ______ of the air.What do the sisters give to the mermaid?What did the mermaid try so hard to earn?Who do her sisters tell the mermaid to kill?Who do the daughters of the air give life to?Where did the mermaid throw the knife through?What did the mermaid kiss when she leaned down?What did the prince and his bride feel around them?...

Chapter 6 - A New Nation - myWorld Social Studies 2023-01-26

24 Items: a lawto approvea representativea change or improvementto refuse to approve somethingthe duties related to being a citizenthe first plan for government of the United Statesthe principle that the law applies to everyone, equallya person who opposed the passage of the U.S. Constitutionthe branch of government that makes laws; the U.S. Congress...

مصطلحات 2024-02-01

11 Items: ToolsHistoryCollectionsdigitizationAnalysis SoftwareManagement SystemsVisualization ToolsLibraries and ArchivesScraping and Crawling ToolsPlatforms for Academic Research(Geographic Information Systems) Mapping Software

Acids and Bases 2015-12-16

11 Items: PHPHPHBaseAcidIonsscalepaperNeutralPositiveNegeative

austin and henry 2017-04-18

9 Items: fieldjukeshotdogsafetysweatsfootballgoalposttouchdowninterception

ROCKS AND MINERALS 2020-09-10

9 Items: MAGMAFOSSILIGNEOUSVOLCANOCRYSTALGEOLOGYMINERALSSEDIMENTARYMETAMORPHIC

DC and Marvel 2021-03-25

9 Items: wasprobinBatmanantmanvisoinIronmanhawkeyewolverineblackpanther

Toiletries and Equipment 2021-06-04

9 Items: combsoaptoweltissueshampooscissorstoothpastetoothbrushNailclipper

Programs and Databases 2022-11-08

9 Items: copyloginenterprogramtrainingdatabaseoutdatedusernamepassword

Shawn and Dan 2023-03-11

9 Items: tallthinnursedinnershowerdoctormorninghospitalbreakfast

design and technology 2023-04-16

9 Items: cadcamDesignthinkinginnovationcreativityexperienceprototypingdevelopment

design and technology 2023-04-16

9 Items: cadcamDesignthinkinginnovationcreativityexperienceprototypingdevelopment

Equations and Inequalities 2014-08-06

9 Items: inverseequaltoequationlessthaninequalitygreaterthanlessthanorequaltoequivalentequationgreaterthanorequalto

Greetings and Goodbyes 2017-10-02

9 Items: holaadiósasíasíestoymalcómoestásestoybienbuenosdíasbuenastardesbuenasnoches

PRAYER AND FASTING 2024-05-17

9 Items: prayercrisishealingfastingpurposedominionrevelationdeliveranceselfexamination

Lesson 41 and 42 Vocab 2015-09-21

20 Items: civilcivicspopularpublishcivilitypopulousrepubliccandidlyvalidityveracitypublicizedeceptionfalsehoodplausiblepopularitypopulationpopularitypopulationpublicationcivilization

Fossil Fuels and Renewable energy 2017-03-31

18 Items: peatreusevapourrecyclebitumencondensecrudeoilevaporatesaturatedbiodieselbioethanolcombustionfossilfuelshydrocarbontemperatureconservationdistillationcondensation

Search 9 - Planets and Moons 2019-04-14

18 Items: SaoNesoNaiadTritonNereidProteusLarissaGalateaDespinaMargeretTrinculoThalassaHalimedePsamatheFranciscoFerdinandLaomedeiaHippocamp

Module 4: Enlightenment and Revolution 2020-09-22

20 Items: IsaactheorytheoryMethodNewtonSalonsGalileoGalileiBaroqueDespotsGeocentricScientificRevolutionScientificPhilosophesRationalismEnlightenedHeliocentricNeoclassicalEnlightenment

Michael and Watasha's Baby Shower 2023-11-04

18 Items: cjmcybabycribshowerrattlewatashamichaeldiapersswaddleblanketbouncerpregnantbassinetpacifiersnuggleslullabiesnightfeedings

Illness, Good and Bad Food 2023-11-12

18 Items: eggscoughfeverbeanspizzachipssugarsneezecerealfruitsnoodlemalariasandwichallergieschocolatevegetableshamburgersstomachache

Reagan and Miss Fitz's Wordsearch 2024-07-04

18 Items: zooplayclassbeacheurosvideosummerleaverslastdayholidayicecubereportsleagreenwordsearchicelollieswaterfighthighschoolresidential

Causes and consequences of urbanisation 2024-07-16

18 Items: pushpullslumruralurbantokyodelhisocialnewyorkmegacityeconomiccommunitypopulationurbansprawlurbanisationenvironmentalnaturalincreaseinternalmigration

Two stuntwomen and a stuntman 2022-11-06

20 Items: intoartstoughextramajorawardstuntskillhomessportydoubleviewerinjuredclothingeasy-goinghigh heelscompetitivesword-fighttrampoliningteacher (Physical Education)

Jock and Shy Word Search 2022-11-22

19 Items: shypopjocknerdlovedoveforcelgbtqcouplerivalsoppositehandsomeprincesschildhoodhighschoolfriendshipgraduationteacherspetrelationship

Fruits, stationary, and body parts 2013-05-21

19 Items: lijuzibizishoujiaoputaoxiguaboluozuibaerduocaomeilanmeiqianbishubaopingguoyingtaojiandaoyanjingxiangjiao

Photoshop Tools and Functions Wordsearch 2017-11-10

20 Items: saveCMYKenterctrldctrltctrlushiftlayerfilterselectinversemarqueecontrastblurtoolcontrastmagicwandsharpentoolclippingmaskclonestamptooltransformation