health and wellness Word Searches

ENERGY AND FUEL 2020-02-15

15 Items: COALWATTSOLARTURBINENUCLEARBIOFUELVOLTAGEWINDMILLRENEWABLEPETROLEUMFOSSILFUELPOWERPLANTGREENHOUSEELECTRICITYSUSTAINABLE

Fire and Rescue 2015-12-22

15 Items: REDHOSEPOLEROPEBOOTSRADIOSIRENSMOKEFLAMESGLOVESHELMETLADDERYELLOWGOGGLESHYDRANT

Fruits and Berries 2024-01-15

15 Items: pearfujinashilemonorangepapayatangelopineappleblueberryraspberrystarfruitmangosteenwatermelondragonfruitpassionfruit

Cookies and Milk 2024-02-14

15 Items: dadalexmilkamoselliscosmomelvinthelmasunsetsummerfamousgrandmahershelcookieswishbone

Rudra and friends 2024-03-30

15 Items: mehrjashrudramokshaarnadhitiaryanzidanesaumilsayurisiddhiarujaaarulaaapoorvashikhar

Food and Nutrition 2024-06-20

15 Items: fatsfiberproteinsvitaminsmineralscaloriesbalancednutrientssaturateddigestionhydrationmetabolismunsaturatedcholesterolcarbohydrates

Games and Sports 2024-06-20

15 Items: leagueagilityrefereefitnessteamworkstrategypracticeendurancetechniqueequipmenttournamentrecreationcompetitioncoordinationsportsmanship

Aluminium Word Search 2024-02-26

9 Items: DOORSDOORSDOORSREPAIRWIPERSWINDOWSTINTINGAND GRABrecalibration

Omit Word Search 2023-12-09

10 Items: Cautious and watchfulTo leave out or excludeFull of energy and enthusiasmCalm, peaceful, and untroubledFully in agreement or of one mindAttractively unusual or old-fashionedTo move back or away from a point or limitHaving or showing zeal; fervent or enthusiasticTending to keep a firm hold of something; clinging or adhering firmly...

Omit Word Search 2023-12-09

10 Items: Cautious and watchfulTo leave out or excludeFull of energy and enthusiasmCalm, peaceful, and untroubledFully in agreement or of one mindAttractively unusual or old-fashionedTo move back or away from a point or limitHaving or showing zeal; fervent or enthusiasticTending to keep a firm hold of something; clinging or adhering firmly...

Philanthropic word search (Hard) 2023-11-07

10 Items: having a friendly, generous and considerate towards othersabundant, plentiful, or having a large quantity or somethingact of using one’s wealth, resources, or time to benefit othersnot holding back, being harsh or severe in criticism or judgementHaving a kind and generous disposition or intention towards others...

8th grade Andrew Henry 2024-05-17

15 Items: To increase speeda positively chargedneutrally charged atomThe weight of an objecta negatively charged atom.An element with a symbol of HWhen an object turns 360 degrees.a compound that can be seperated.A compound that isn't seperatable.: Charged particles that create energy.A compound made from hydrogen and oxygen...

elafant and piggy 2016-05-26

15 Items: garldpiggyelafantiaMAFROGTHINKYOUmowillemsTHINKOROMAhappypigdayMYFRINDISSADWEAREINABOOKELAFANTPIGGYIWILLTAKEANAPIRILLYLIKESLOPWAITINGISNOTEAZYMYNEWFRINDISSOFUN

Elephant and piggy 2016-05-26

15 Items: piggygeraldelephantiaMAFROGTHaNKYOUmowillemsTHaNKOROMAhappypigdayWEAREINABOOKMYFRIeNDISSADIWILLTAKEANAPELephANTPIGGYIReaLLYLIKESLOPWAITINGISNOTEAsYMYNEWFRIeNDISSOFUN

Christianity and War 2017-03-15

15 Items: oldnewteneyewarloveholyjesustoothmurderrevengemuslimsblessedcrusadestestament

RNA and DNA  2018-05-21

15 Items: CodonSugarUracilAdenineThymineGuanineCytosineProteinsAminoacidPhosphateTranslationTranscriptionTemplatestrandCharacteristicsComplementarystrand

Science and engineering  2021-10-28

15 Items: Techfieldnaturegeologyprogramprocessdigitalsolutionresearchwirelessknowledgechallengechemistryhypothesismeteorology

UFOs and Aliens 2022-02-21

15 Items: landarmylockboardobjectplanetattacknearbysupplyweaponexplainsurvivefriendlyidentifyintelligent

Crime and Punishment 2023-01-25

15 Items: canepupilcrimeschoolnaughtytroubledisruptteachersanctionbehaviourclassroomexclusiondetentionpunishmentachievement

Hearing and Sound! 2023-02-07

15 Items: loudsoftearsmutenoisequietpitchwavesvolumedecibelamplifysoundproofvibrationsecholocationsophisticated

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Desserts and Drinks 2023-05-05

15 Items: cakeoreomilkcolajellowaterpepsicoffeecupcakecookiess'moresespressoicecreambrowniesmilkshake

Persuasion and Argumentation 2019-04-01

15 Items: biasethoslogospathosrefuteargumentrebuttalevidencenegativeeditorialpersuasiveaffirmativeargumentativecounterargumentThesisstatement

SOUND AND LIGHT 2014-06-13

15 Items: EchoPitchVolumeConvexOpaqueVibrateConcaveAmplitudeSonicBoomSoundWaveWavelengthReflectionRefractionTranslucentTransparent

Waves And Sound 2014-01-08

16 Items: Belwavewavenoisepitchsonarspeedeffectdopplerfrequencysupersonicinfrasonictransversethermometercompressionslongitudinal

Hardware and software 2023-10-11

15 Items: ramrominputmouseoutputspeakerhardwaresoftwarekeyboardharddrivemicrophonemotherboardwordprocessingoperatingsystemapplicationsystems

Joy and Depression 2023-10-24

15 Items: joyhopewarmthsadnessdespairlaughterserenityoptimismdarknesshappinessgratitudeisolationdepressionlonelinesscontentment

Tara and Tiree 2023-11-23

15 Items: partborncornfarmhardhorseporchbreakscorecausesmartchorebeforecourageblustery

Jakob and Skye 2023-12-18

15 Items: kaiayaizzyskyejasonhazeljoneskeelajakobkristykendrajuniortimbergrandmamerrychristmas

Countable and uncountable 2024-01-20

15 Items: eggmilkricesaltsoupapplesugarwaterpotatotomatocarrotorangepineapplewatermelonstrawberry

IGH and GH 2024-04-01

15 Items: gassighrightsightmightnightghostlightsolidflightfrightbrightmatterliquideclipse

HOUSES AND HOMES 2024-05-07

15 Items: onedoorramptownliftboathousetowerblockcanalwallsstairsladderbedroombungalow

Margin Word Search 2022-10-08

10 Items: callmakersactioncandletradestradingappetiteobjectivesand demandof liquidity

Ian 2024-06-21

13 Items: jumpFloydthreesoccerMartinappleswalsallCollegeof Yorkforty-twoand tonicBromwich Albion FCUniversity Professor

What is Erosion 2024-04-03

10 Items: Particles of soil or rock that are transported by erosion.Naturally occurring inorganic substances that make up rocks.The breakdown of rocks and minerals into smaller particles or sediment.The flow of water over the Earth's surface, often carrying sediment with it.forces: Forces such as wind, water, and gravity that shape the Earth's surface....

Good Laboratory Practices 2024-05-14

17 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs writtenYear GLPs approvedThe first A in ALCOAThe second A in ALCOAYear GLPs written into LawDescribes how a task is done on a studyCurrent Summary of training and experienceDirector Single point of contact for a study...

Herculesandthetwelvelabors Word Search 2022-08-09

10 Items: A young Greek king needs to retrieve the Golden Fleece to retrieve his throne, and many adventures arise.The Greek hero of the Trojan War endured multiple challenges and adventures on his ten year voyage home to Ithaca.A Greek demigod is forced to complete a list of challenges as a punishment for something he did while under a spell....

Building Relationships 2023-10-24

18 Items: A characteristic of the product or service, such as the interest rate or the term.Explicitly choosing not to do something, such as to not receive bank product literature.One seller’s portion of the total sales of a product, usually measured as a percentage of deposits....

chorus assignment 2024-02-22

11 Items: singannieactorEliotchartsmusicalbroadwayin the rainof the operaand the beastschool musical

Elvis Christmas 2023-10-09

20 Items: DogtcbBearRockelvisClausHotelAlbumgospelMoviespresleyChristmasgracelandChristmasBell RockrockabillyJordanairesfrom HawaiiChristmas Musicof Rock and Roll

Revolutionary War - Section 2 2022-10-05

15 Items: to leave military duty without returninglong steel knives attached to the end of gunscountry who came began helping the Americans in 1776European country recruited by France to help the U.S.France signed two treaties with the colonies after this battleBritain's most powerful weapon in the war. America could not match it....

Newspaper Word Search 2023-01-17

48 Items: gymartlbiohiomemelmaomathapplepuppytraincodingpythongooglekittenfive-afive-bsocialfrenchhealthreginacanadawebcamscratchsciencealbertacalgaryontariotorontoairportcolumbusmr.shellairframemiss.kausmicrosoftjohn-cenanewspapercomputerscaliforniamrs.flamantwenty-onecounsellorheadphonesbible-classwinter-campsouth-koreachromebooksmicrophonessaskatchewan

PSII Chapter 11 & 12 2023-04-19

33 Items: lawmealfoodmenuclaimhealthcovereddisplaystandardvariableschedulepublicitydisclaimercombinationadvertisingself-servicegrowth-phaseestablishmenttruth-in-menudecline-phasemarketing-planmaturity-phasevending-machinemenu-managementpromotional-mixsales-promotionnutrient-contentpersonal-sellingpublic-relationsintroductory-phasestrategic-business...

Juneteenth Word Search 2023-06-16

15 Items: to ask for somethinga synonym of documenta financial institutionthe reason we do not work 6/19agents provide this to borrowersagents answer this when it ringsUCC-1 and UCC-3 are a form of thisagreement between two or more partiesrecognition for good work/performancemethod by which time off requests are sent...

-an -in and -un and high frequency words 2023-01-03

25 Items: canpinsunrunfantanmanbunfunfinwinbinplayspinplanchingrinthanskinthinwhenwentwantlittlebecause

Serene Word Search 2023-12-10

10 Items: Full of energy and lifeQuick and active; livelyCalm, peaceful, and untroubledTo have a strong desire or longingPresent, appearing, or found everywhereClever or skillful in using the hands or mindHaving or showing zeal; fervent or enthusiasticHaving or showing a feeling of vague or regretful longing...

EARTH AND SPACE 2014-06-30

15 Items: atollbiomasequatorfissureglacierablationepicenteratmospheresubductionbigbangtheoryauroraborealisCorioliseffectsedimentaryrockmetamorphicrockcontinentalshelf

Coaching and Mentoring 2015-04-02

15 Items: AskGoalsStyleAdviseCareerDirectInformListenConnectPartnerChampionFeedbackSpiritedSystematicConsiderate

Rewards and Consequences 2015-10-08

15 Items: MOVEPRAISETIMEOUTWARNINGREWARDSHEROCARDSOWNERSHIPDUTYSUPPORTACHIEVEMENTCONSEQUENCESEXPECTATIONSPLANNERPOINTSRESPONSIBILITYCELEBRATIONEVENINGAFTERSCHOOLWORKSHOP

Dragons and Giants 2016-03-15

15 Items: hawkthawdrawyawnsaucecrawlcausevaultlaunchauthorlawyerAugustlaundrybecausedaunting

Places and buildings 2016-09-10

15 Items: riversquarechurchmosquebridgemarketmuseumtheatrecarparkstationhospitalchemiststownhallpostofficeartgallery

Economics and Politics 2019-11-20

15 Items: goldbankpeoplepolicycapitalcountrymortgageproductspoliticsterritoryemploymentgovernmentstagflationsovereigntyinternationalization

BLACK AND WHITE 2020-03-04

15 Items: ORCAPANDAZEBRAPENGUINFOOTBALLDALMATIANWHITETIGERYINANDYANGRUFFEDLEMURMALAYANTAPIRCHECKERBOARDZEBRACROSSINGPIANOKEYBOARDPINDSTRUPKIRKEDOWNYWOODPECKER

Mesopotamia and Mesoamerica 2020-08-05

15 Items: mayagodswheelstarsyucatanfarmingsumeriababyloncalendarzigguratastronomysacrificemysteriousmesoamericamesopotamia

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

History and Sports 2023-03-09

15 Items: alisuezlouiscoldwarrobinsoncommunismwaterpolodeathmatchinternmentcivilrightssovietunionmiracleonicenationofislamrosietherivetercommercialization

Teeth and Food 2023-03-14

15 Items: fatsteethmolarcanineenamelsugarsincisorchewingcuttingproteinvitaminmineralgrindingdigestioncarbohydrate

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

VERTEBRATES AND INVERTEBRATES 2023-05-18

15 Items: tunafrogtoadeaglesnakesnailwhalesmonkeypigeonsalmonturtlepenguindolphinsjellyfishbutterfly

Habitats and Interactions 2023-06-04

15 Items: preybioticabiotichabitatspeciesconsumerinvasiveorganismpredatorproducerecologistecosystemsymbioticbiodiversitycommensalism

Paul and Silas 2023-07-23

15 Items: lawpaulsilasbereajasonjesuscaesarsabbathmessiahsearchedbelievedsynagoguenightfallscripturesthessalonica

SOUND AND LIGHT 2014-06-13

15 Items: EchoPitchVolumeConvexOpaqueVibrateConcaveAmplitudeSonicBoomSoundWaveWavelengthReflectionRefractionTranslucentTransparent

Waves And Sound 2014-01-08

15 Items: Belwavenoisepitchsonarspeedeffectdopplerfrequencysupersonicinfrasonictransversethermometercompressionslongitudinalwave

DISEASES AND DISORDERS 2020-02-25

15 Items: AIDSASTHMACANCERDENGUEMALARIALEPROSYDIABETESEPILEPSYSWINEFLUJAUNDICEARTHRITISALZHEIMERSBRONCHITISHAEMOPHILIACEREBRALPALSY

"Feelings and Emotions" 2023-10-18

15 Items: sadshycalmhappyangryproudlovedscaredexcitednervousworriedgratefulfriendlyconfusedsurprised

Environment and Agriculture 2024-02-07

15 Items: airfoodfuelsoilfibercropswaterbioticplantsabioticanimalsfarminglivestockirrigationagroforestry

Love and Relationships 2024-02-10

15 Items: When we two partedThe rain set early in to-nightThe clouds had given their allWe stood by a pond that winter dayThree summers since I chose a maidI run just one ov my daddy's shopsThe fountains mingle with the riverMy father worked with a horse-ploughIt is eighteen years ago, almost to the dayI think of thee!—my thoughts do twine and bud...

Searching and Fearless 2024-03-25

15 Items: fearhopeangerpridefalseshamechangegrowthcouragesponsorwillingbreatheprocessutilizehonesty

Light and Sound 2024-04-04

15 Items: Wavepitchprismopaqueabsorbtransmitvibrationamplitudereflectionrefractionwavelengthtranslucenttransparentecholocationlight spectrum

Light and Sound 2024-04-04

15 Items: Wavepitchprismopaqueabsorbtransmitvibrationamplitudereflectionrefractionwavelengthtranslucenttransparentecholocationlight spectrum

blue and gold 2024-04-09

15 Items: Artsstemboldnigellegacyforwardsuccesspurposeof Cadetsworkforceathleticschampionsengagementnighthawksleadership

Privacy and Security 2024-04-25

15 Items: virusadwareprivacyhackersmalwaresecuritypasswordphishingintrusiondatabreachexplotationcyberattackssystembreachinternetofthingsmalicioussoftwares

Good and Evil 2024-05-07

15 Items: godevilgoodsatandevilirenaeusmoralevilaugustineomnipotentomniscienttemptationnaturalevilomnipresenttranscendantomnibenevolent

Alcohol and Drugs 2024-06-20

15 Items: alcoholtobaccocannabisoverdoseaddictionnarcoticssubstancestimulantswithdrawaldependencydepressantsprescriptionintoxicationhallucinogensrehabilitation

How It Works Steps 4, 5, and 6 - from the Basic Text (6th Edition) 2023-05-25

18 Items: We do not _____. (pg 33)Our fellow members do _____ us. (pg 32)If we are not _____, we are humiliated. (pg 34)_____ is what we strive for in Step Six. (pg 34)No one is forcing us to give up our _____. (pg 29)The important thing is that we do our _____. (pg 31)We find ourselves growing into mature _____. (pg 35)...

WESTERN SADDLE PARTS 2024-01-18

13 Items: Where the rider’s bottom rest during riding.Extends down from each side of the seat and look like small flaps.Is positioned under the jockey, behind the seat, and below the horn.A post-like appendage sticking up in the front, center of the saddle.A piece of leather that connects the stirrups to the side of a saddle....

max and the midknights book 1 and 2 2021-12-21

66 Items: maxsirbeelutenatebookwandcopycragkingmaryknotpearsimongoosenolanbrucekevynsworddustytorinborisrovakseedsdwarfconradmilliedragonbananapeircewrightfendradaggerbladessheildbananaguardsbodkinseymortomatoportalpotionbudrickmumblinbyjoviaghastlylincolncrossedcrystalnereliavulturegriffingadaboutsedgwickbrickbatknotheadleafnadobagpipesformlingsdogmother...

LONG e and LONG i (ee and igh) 2024-03-08

21 Items: seemeetfreeneedsighteenkeeppeepnightthreelightrightgreensleeptightmightteethstreetflightspeechplight

First Nine Weeks 2014-09-09

36 Items: Iamegoonmyisbetoupatinamitcanseetheandredareyesbigforrunyoutoorannotgoeslikehereintolooklovecomesaid

Aluminium Word Search 2024-02-26

9 Items: DOORSDOORSDOORSREPAIRWIPERSWINDOWSTINTINGAND GRABrecalibration

BASEBALL 2022-06-08

5 Items: ____ and then runball hit to you then you _______ ityou throw it and hit it it is a ______slap it hits your glove You can ______ ityou field it you turn and you __________ it

Types of Plastics & Their Uses 2022-06-05

10 Items: Acrylic, which is strong and transparent, is commonly used as a substitute for _____.Polystyrene, otherwise known as _____, is commonly used to make disposable takeaway boxes.Polyethylene, which is commonly extracted from natural _____, is used to make plastic bags....

Aluminium Word Search 2024-02-26

9 Items: DOORSDOORSDOORSREPAIRWIPERSWINDOWSTINTINGAND GRABrecalibration

united 2023-03-08

22 Items: swedennorwaypolandicelandfinlandnetherlandsthe sunshine statecity in central floridathe third planet from the sunthe sixth planet from the sunthe second planet from the sunthe fourth planet from the sunthe eighth planet from the sunthe seventh planet from the sunA highway that goes around a city.the 7th largest country in the world...

Word Search_ the National Assembly and elections 2023-06-15

17 Items: termvotingballotdebatecaucuscampaignelectionmajoritydemocracycandidateoppositionparliamentlegislationconstitutionconstituencyrepresentativeHere are 16 terms related to the National Assembly and elections for your word search puzzle:

Key to Literary Analysis Test 2022-12-12

15 Items: yougoodThis theme can be revealed in literature, in the book “Night”, when the horrors of the concentration camps made Elie believe less in god.By revealing their mistakes through their ______________, an author of a memoir risks being judged by the audience for their flaws and mistakes they made....

Omit Word Search 2023-12-09

10 Items: Cautious and watchfulTo leave out or excludeFull of energy and enthusiasmCalm, peaceful, and untroubledFully in agreement or of one mindAttractively unusual or old-fashionedTo move back or away from a point or limitHaving or showing zeal; fervent or enthusiasticTending to keep a firm hold of something; clinging or adhering firmly...

Ent. Vocab Words Word Search 2022-11-15

40 Items: PossesionsNatural skillThe way you actWhat you stand forA plan for marketingConcepts used to MarketPeople who work for othersThe ability to do something wellsummary A summery of your writtenMarketing to a huge amount of peoplePeople who start their own businessesA model to make problem-solving easierComing up with ideas often with people...

Trend in health care 2024-03-23

6 Items: catlionzebrahippoelephantMan's best friend

Personal Financial Planning 2023-10-17

23 Items: The assets a person ownsPerson who depends on another personLong-term insurance with a savings elementShort-term insurance with no savings elementPayments made by a corporation to its stockholdersThe increase in the value or usefulness of an assetThe decrease in the value of usefulness of an asset...

Blood Bank Vocab 2022-10-31

23 Items: TomesNot frozenBlood typeSelf-donateImmediatelyblue flowerOpen system30-37 degreesVolunteer unitSticky factorsBroken scannerFor frozen RBCsOxygen-enrichedUsed in testingInitiate clottingPlasma replacementFor antibody patientsBoth Fresh and FrozenTwo O Negs and Two LPElectronic monitoring3500 for five minutesValidated for 24 hours...

Kenzie's Science Wordsearch 2023-12-18

20 Items: Is earths GalaxyA group of stars making a shapeIt must be big and orbit a starA path that a planet is stuck inThey study of everything in spaceWhen light bounces off the objectA piece of rock floating in spaceDischarged gas air and other stuffA rock that enters earths atmosphereBelief of that signs tell our personality...

christian-8th grade 2024-05-15

15 Items: temperature at which a solid meltshappens between metal and notmetaltemperature at which a gas condensestemperature at which a liquid freezes2 elements are sharing valence electronschange from a solid state to a liquid statechange from a gaseous state to liquid statechanging from a liquid state to a solid state...

6th Grade Literary Elements  2017-04-03

39 Items: andandmoodfactmainideaplotrhymecausegenrethemesimilesymboleffectrisingactionclimaxactionauthorspurposecompareopinionfallingdialoguemetaphorcontrastsequenceconflicthyperboleflashbackvisualizeinferencerepetitiongeneralizeresolutionalliterationonomatopoeiaforeshadowingpersonification

Door Word Search 2022-09-15

28 Items: A rounded roofA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingwood that is prepared for use in buildingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Volcanos 2023-05-23

16 Items: dikesillventFlowDomeFlowflankCloudcratersummitChambercalderafissurefumarole(includes Ash, Lapilli, and Bomb)Cone (also known as a Parasitic Cone)

Sensation and Perception 2014-03-27

15 Items: hueirispupilretinacorneasensorysensationreceptorsperceptionwavelengthsaturationafterimageopticnervetransductionaccommodation

IT and computers 2015-02-23

15 Items: pciosbasicapplemouselaptopdisplayandroidcomputerkeyboardsoftwarestevejobsbillgatesmicrosoftprocessor

Animals and instruments 2015-07-31

15 Items: antpigbearaygobasssinghippodrumspianomonkeyrabbitguitarviolintrumpetelephant