fruit Word Searches

Turkey Turkey 2025-11-21

15 Items: The traditional main course.A large and celebratory meal.The time of year when crops are gathered.A festive procession, like the one in NYC.The feeling of appreciation and gratitude.The season when Thanksgiving is celebrated.A group of early settlers who arrived in 1620.The feeling of being thankful and appreciative....

Cafeteria Food Word Search 2025-12-03

13 Items: Healthy sideItalian dishPopular PastaIce cold treatVegetable AlternativeCheap Wingstop OptionDeep fried cheese sticksComes in cartons and bagsPopular side among burgersServed with rice and broccoliPopular sandwhich served on FridaysPopular lunch(not chicken sandwich)Rare Dish served with tortilla and meat

Word Search for Dementia Care 2026-03-10

10 Items: sweet from beesUsed for cookingcomes from animalsyou slice and eat ityellow food on a coba warm drink in a cupdrink made from fruita grain eaten with stewmakes food taste bettersmall food cooked in soup

Alpha Word Search 2024-01-31

26 Items: SAM STOPBOY BAKERDOG DAVIDHENRY HATTOM TOASTYELLOW YAKZEBRA ZOOADAM APPLECAT COWBOYGEORGE GRAYKING KEVINMARY MAGICNORA NANCYFRANK FRUITJACK JORDANLARRY LUCKYQUEEN QUIETEXTRA EDWARDIDAHO INDIANPACIFIC PAULROBERT ROGERVALLEY VALUEWALLY WALRUSOCEAN OCTOBERUNDER UMBRELLAXYLOPHONE XEROX

trs23 ie2 u6p2 2023-02-07

10 Items: Not the same.Green thing with leaves.E.g. chicken, pork, beef.E.g. bread, rice, noodles.E.g. milk, cheese, yoghurt.E.g. sardines, tuna, salmon.E.g. lettuce, carrot, potato.E.g. apples, bananas, oranges.E.g. lion, dog, crocodile, mouse.Some food between two pieces of bread.

FOOD 2015-06-15

76 Items: teapeaeggoilwinebeersodamilkleekbeanpearplumcornricebeefveallambporkcrabsaltwaterciderfruitjuiceonionmelonapplepeachlemongrapewheatpastabreadcreamtroutcoffeeradishcarrotgarlictomatopeppercherryorangebananabuttercheeseturkeymuttonoystershrimpsalmoncabbagespinachlettucebrocoliapricotcoconutbiscuityoghurtchickenlobstervinegarmustardlemonadepotatoes...

Spanish Vocab #3A 2024-03-10

35 Items: hameggsmilkwithbreadtoastbaconlunchsaladapplepizzawaternevercerealbananayogurtcookieorangecheesecoffeeto eatalwayssausagewithoutlemonadeto drinkto sharebreakfasthamburgersoft drinkfood, mealfruit saladstrawberriesto understanddrink,beverage

for you 2026-01-20

24 Items: offdowncornrainstateundersolarcountrycreativerockmelonwatermelonstrawberrysedible treesfavorite birdwalks in outdoorssurrounds your homesomething bees makewhat makes your honeyself sufficient home..something dairy cows makesomething you speak freelyshare your videos to your subscribers onsomething your willing to share with others...

Acai Word Search 2023-06-23

73 Items: acaifigsPalmackeefruitdatesguavakiwislimespearsplumspluotApplefruitmelonapplesduriangrapeslemonsmangosolivespapayaquinceavocadobananasjujubeskumquatlycheesorangespeachespepperstangeloapricotscherriescurrantseggplantrambutontamarindtomatoesvoavangazucchinicherimoyacucumbersmuskmelonpersimmonpineapplestarfruitsapadillabilberriesgrapefruitmangosteen...

Summer 2024 2024-05-21

68 Items: inskysunhatballwavehazyrainswimjumpdivereadtimefoodtentfirewinebeerbugsrestrelaxbeachspadewateroceannighthumidwindypartybathetowelmusicgrillfruitcreamradioflopsdreamtravelcastlebucketnightssizzlebreezenoodleloungetrunksholidayseasideseagullmonsoonthunderdancingdessertberriessurfingboatingfishingvacationseashelllanternssunshinefloatingadventure...

Words 2025-08-08

76 Items: HandGrayJumpJoinCuteDeadKiteDeskBallJustLazyDateDishRadioProudHeartJuiceFruitNightLearnColorKnockPartyKnifePaperEnterEarthMingyuCanadaGroundDollarYellowPurpleCloudySpiritAnswerDeleteBehindBottomCameraBurgerTennisCenterMinghaoHundredCounterPreviewWelcomeHistoryMistakeFeatureBetweenBicycleTyphoonExampleCorrectThousandChrismasTogetherDinosaurBurstday...

Summer Word Search 2025-06-19

75 Items: maphatredlakepalmcornflagbluehumidoceanbeachwavessaladfruitmoteltowelwhitebreezehikingbikingdivingtubingburgerhotdogpicniccruisetravelshortsparadepicnicfourthbonfiresurfingsailingcampingfishingcupcakehighwaygogglessandalst-shirtlibertysunshineheatwaveseashellswimmingcanoeingkayakingpopsiclelemonadeicecreambarbecuesmoothiesuitcaseairplaneroadtrip...

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

Christmas Family Wordsearch 2023-10-10

20 Items: Day DCountyDJ GordonHome TownThe MammyMammy's bossSenior DaddyMiddle madzerDaydee schoolChristmas SongsHome in WestmeathBrandon's ice creamNice but dim and furrylavish it with whiskeyDaisy's addiction screenAmy's favourite card gameWe don't play for this GAATriona's favourite fruit babyMost wonderful time of the year...

Spanish 1 - U7: La Comida 2025-04-25

30 Items: soupcornbaconpotatocoffeeseafoodcoconutthe milkthe ricethe meatthe eggsthe fishbroccolithe breadthe fruitthe applethe beansthe onionice creambreakfastthe orangethe cheesethe tomatothe carrotthe cerealthe chickenthe lettucethe cucumberthe watermelonthe vegetables

Frühstück - Breakfast 2025-07-09

20 Items: egg (das Ei)tea (der Tee)milk (die Milch)fruit (das Obst)honey (der Honig)cheese (der Käse)toast (der Toast)muesli (das Müsli)roll (das Brötchen)butter (die Butter)jam (die Marmelade)sausage (die Wurst)coffee (der Kaffee)yogurt (der Joghurt)breakfast (das Frühstück)pancake (der Pfannkuchen)croissant (das Croissant)cornflakes (die Cornflakes)...

Amazing F 2026-03-15

13 Items: A pink birdA sea animalPart of our bodyYou eat with thisA red/orange animalIt smells very niceA farmer works hereAnother word for dadEvery country has oneIt makes a ribbit soundDifferent animals live hereDifferent things are made hereApples, bananas, pears in one word

week 14 2025-11-04

9 Items: 炸洋葱juicy fruityummy drinkgoes on a sandwichon the table with saltcrunchy green vegetablebreakfast food with milkvegetable cooked in the ovenJack dropped the _ _ _ _ _ _ _ into a pot of boiling water and cooked them for ten minutes.

woordzoeker van matthijs 2025-03-05

81 Items: ZonOogManZeeDagVisKatKoeBoekHuisAutoBoomBladDeurRaamHandTandKaasMelkKindWerkWindMaanSterBergStadDorpMaatPijnDoodTijdJaarTuinGrasMuisHondSpelFilmAppelFietsMolenTafelStoelVogelLichtBroodVrouwRegenKamerSlaapGelukLevenNachtMaandZomerLenteBloemFruitVleesPaardSportLeraarRivierVriendSchoolDonkerSneeuwEilandStraatLiefdeDromenDenkenLachenHuilenZingenHerfst...

Spanish List - 3A 2026-03-17

37 Items: hamteaeggsmilkWithbreadtoastbaconlunchsaladapplepizzawaterdrinkneverWhat?cerealbananayogurtcookieorangecheesecoffeeto eatalwayssausagewithoutlemonadeto drinkbreakfastfor lunchhamburgersoft drinkfood, mealfruit saladstrawberriesfor breakfast

Golden Summer 2023-08-10

10 Items: ROYGBIVDihydrogen MonoxideTequila Based CocktailEnclosed Body of WaterWarmest Season of the YearFruit Flavored Frozen TreatBody of Water Surrounded by SandStar at the Center of the Solar SystemFood Consumed During Annual CompetitionAccessory Worn to Protect Eyes from the Sun

happy valentine's day 2026! 2026-02-05

10 Items: our ship namemy fave fruitmy zodiac signyour zodiac signmy favorite Sade song(one) of our fave brandsmy fave coffee/matcha spotwhere we had our first dateyour recent fave snack (i think)the name of your cute dog <3 r.i.p.

Spanish foods 2023-03-02

33 Items: hamteawitheggsmilksaladappleneverbreadtoastpizzato eatcookieI loveI likeorangebananacheesewithoutto sharelemonadeyou loveiced teabreakfastfor lunchhamburgerfood, mealfruit saladWhich? What?strawberriesmore or lessto understandfor breakfast

Abrisseau Word Search 2025-03-22

80 Items: FUTPINHOUXORMETECKTIGECEDRECHENEFLEURFRENEFRUITHETRENOYERSAPINSAULETRONCACACIAAUBIERBAOBABBONSAICHARMECYPRESECORCEERABLEEPICEAFUTAIEGINKGOGREFFELIERRELITCHIMELEZEMURIERRACINERAMEAUSOUCHEVERGERARBUSTEBOSQUETBOULEAUBRANCHEBUISSONCANOPEEDRAGEONEPINEUXESSENCEFEUILLUFIGUIERLISIEREOLIVIERORANGERPALMIERPLATANEPOIRIERPOMMIERPRUNIERSEQUOIATAILLISTILLEUL...

trs23 ver2 u8 2022-10-19

11 Items: a fruitplay a ______ a cakeyummy dessertfood made from milka meal you eat outsideuses fire to make lightspecial day when you get presentshot food made with tomato and cheeseget together with friends and have funfood made by putting something between slices of bread

Cool and New Word Search 2025-01-03

17 Items: #1's #8Type of gunThe true #1#1 in FrenchAllergy to #1#1 in Italian#1 in Turkish#1 in SpanishCommon in sushiRed fruit flavoring49-51% of my fursonaDemoted in Ovenbreak#8 if it was a sport#1, battered and friedAquatic buggish thingsTreasure in Clam WatersAssociated with this symbol

FRUIT and VEGATABLES 2024-11-15

2 Items: ogórekpomidor

p3 u:2 2025-07-02

8 Items: a sour fruitkids favourite gamehome of prehistorical manusualy perform in the watersurfers on the beach love itto measure it you need a clocka numer of fingers in one hendactivity you can do in the mountain

Naomie Crosswolrd edition 2026-03-10

13 Items: : Crush prime: vu que t’es lele: très impolie même: Toi de time en time: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: camer du côté de tik tok: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

hello man`s 2024-10-25

3 Items: it grow on trees.you use this for directions.what you are suppose to build to sleep.

Apple Word Search 2026-02-05

2 Items: The red planetFruit on a tree

Fruit Word Search 2025-12-11

2 Items: hot, tall, different, placeplants, rainy, type, trees, growth

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

Pit stop - Food 2025-09-11

84 Items: HotDogEggTeaSaltSoyaMeatCakeCrabMealCafeKidsSoupBeerWineForkRicePizzaOnionSnackBeansItalyFruitJuiceDrinkWheatBreadSugarHoneySweetWaterOliveLunchKniveSpoonBaconToastGravyCurryPastaSnakeSheepburgerChilliPepperRelishTomatoCheeseBananaDishesHungryPeanutButterCerealAnimalPicnicBarleyDinnerLizardPrunesOrangeCoffeeHaggisLocustToppingSausageKetchupMustard...

Summertime Word Search 2026-03-25

80 Items: hathottansunskidaysbeeslazysandpoolgolfsunnybeachtripsfruitcreambloomgreensweatflopscanoehumidcampsboatsoceanseasonbreezenaturefamilywarmthtraveltennispicnicshellsshortsvibrantrelaxedoutdoorcampingflowerssceneryfriendssunburngogglesbonfirehammocksandalsswimmingbackyardcolorfulcricketsmemoriesbarefootcarefreeswimsuitsunshinecanoeingmosquitotanktops...

Summer 2024-07-31

86 Items: fanhotsuntanbikeboatfinsfireheatjulyjunekitelakepailparkplaypoolrestswimtenttripwarmbeachcabincanoedaisydrivefruitgamesgrasshumidmuggyoceanrelaxsunnytowelvisitwavesaugustdivinggardenhikingpicnicshortssmoressummertraveltshirtvoyageberriescampingfireflyfishingflowersfrisbeeholidaysailingsandalssnorkelswelterthunderbarbecuebarefootbaseballicecream...

Girlfriend Word Search 2025-02-03

20 Items: Our songMy birthdayMy eye colorWhat are we?Dream careerOur first dateFavorite movieOur go to placeSomething i loveMy dream reptileSomething i hateMy favorite fruitMy favorite colorsMy favorite flowerOur anniversary monthFavorite memory of usMy favorite thing to doGolden rubber in these…Favorite thing about youHow long will we stay together

Day of the Dead Spanish Vocabulary 2025-11-10

31 Items: tombmaskarchsaltfoodangelbibleskullcrossaltarwaterfruitflowerscandlesincensemarigoldskeletonofferingdead breadsugar skullsspirit guidespicture/photoflower petalsday of the deadcoffin or casketwhimsical skeletondecorated cut papermonarch butterfliescemetery or graveyardface of day of the deadday of the little angels

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

FOOD 2025-09-18

10 Items: A long orange vegetable that rabbits love. (C_____)A cold sweet dessert, often eaten in summer. (I_______)A vegetable that can make you cry when you cut it. (O____)Food from animals, for example beef, pork, or chicken. (M____)A hot brown drink that many people have in the morning. (C_____)...

Food 2024-07-01

86 Items: teacornricemilksaltpearsbaconbananagrapesapplesomeletveightcoffeepepperbutterspinachcarrotspeachesorangesoatmealbiscuitsausagemrsdashcheeriosricechexlemonadetunasaladhamburgerspaghettiwheatrollsidesaladfruit cuppineappletomatosouphousesaladgreenbeanseggnoodlespeachcrispapplesaucefruitjuiceprunejuicegrapejuiceapplejuicehamsandwichhummusplate...

apirl 2025-04-03

6 Items: PrecipitationThe period of floweringA holiday that occurs on April 25Something pretty that grows and has petalsSweet produce that grows well around this timeA powdery substance that flies around and causes allergies

Peter and Cornelius 2025-12-03

6 Items: I must _____ my tonguePeter spoke to ____ kindlyI must not say bad ______________ -control is a fruit of the SpiritThe ______ Spirit helps us to control ourselvesWho saw a vision and later controlled his tongue

Vocabulary Words 2025-09-13

8 Items: decidestone fruitadvertise and sellleftovers fed to pigsgives birth to a litter of pigletsa plant that grows back every yearto cut meat and package it into pieces for cookingto snack on leaves, twigs, or vegetation growing off the ground

School Word Search 2023-03-28

5 Items: The building you are now inThai girl in Korean pop groupThe city where this school isHow many apples make five apples?This colour is the name of a fruit

FOOD 2022-08-30

8 Items: A small, round cake or piece of breadAn oval, purple vegetable that is white insideA small round fruit on particular plants and trees.Food which is unhealthy but which is quick and easy to eatA small sea animal which you can eat, and which has a shell and ten legsA small, round, soft red or black fruit with a single hard seed in the middle...

Fall 2025-11-24

20 Items: SPORTFRUITCANDYLEAVES.LEAF COLORON A HOLIDAYKINGS ISLANDON A HOLIDAYGROWN IN FALLSTARTS IN FALLMADE OF APPLESINVOLVES LEAVESCOLOR OF LEAVES.NAME OF A HOLIDAY.STARTING DAY OF FALLAPPLES OR CRANBERRY'SSTARTING MONTH OF FALLHAVE SOMETHING FALLING OFFBOUNCES WHEN RIPE AND FLOATS IN A BOG WHEN RIPE...

WORD SEARCH FRIDAY FUN ACTIVITY 2025-07-28

15 Items: A RED PLANETEXCEL PROGRAMA SEARCH ENGINEUSA SPACE CENTERSOLID STATE DRIVEA BIRD LARGEST EGGPOPULAR ONLINE VIDEOEVERY FRIDAY ACTIVITY1 billion bytes of dataA FRUIT OR MOBILE PHONEAMIT AND DHARM HIT MOVIEONLINE PURCHASE PLATFORMLEONARDO DICAPRIO 2006 MOVIEA CONTINENT IS 90% COVERED BY ICEA BIRD FAMOUS FOR ITS DANCE AND FEATHERS

Wedding Word Search 2024-09-02

20 Items: Ballroom NameThe First ManMaid of HonorThe First BookBride's FamilyThe new twentyThe First WomanMeow Meow's PetGroom's First NameBride's First NameName of Flower GirlA girl's best friendIt's a prominent fruitThe bride's meal choiceGarden where it all beganLast name; Sounds ScottishFlavor of the Wedding CakeFather Tom's first occupation...

Fearless 2025-03-29

30 Items: lawsavedfearsfruitperfectevidencenot seensubstancehoped forimitatorssacrificeLord JesusGod is loveHoly Spiritdivine loveonly believedear childrendo not be afraidvaried expressionsjoy that overflowspeace that subdueskindness in actionstrength of spiritgrace through faithlife full of virtuefaith that prevailsgentleness of heartsweet smelling aroma...

Word Search One 2025-05-22

20 Items: Your momYour dadYou read itYou drive itYou drink itA barking petA meowing petYou eat at itYou sit on itA male friendYou live in itTells the timeYou play with itShines in the skyYou look through itGrows in the forestA red or green fruitA place for learningYou open it to enterYou eat it with butter

unit 5: Vocab sections 5-7 2025-12-16

26 Items: the jamthe teathe milkthe snackthe fruitice hockeythe butterlos churrosto play golfthe sandwichto do boxingthe chocolateto play tenisto do surfingto have dinnerto do swimmingto play soccerto do taekwondoto do wrestlingwe eat breakfastthe orange juiceto have breakfastto play the guitarto play basketballto play volleyballgalletas the cookies

3-1 Vocabulario 2026-01-23

42 Items: funbadcarsgolfgoodchessfruitpizzamusicbooksgreatawfulsportssoccertennismoviesboringanimalspartiesbaseballfootballlacrossesoftballhorriblemagazineswrestlingice creamdeliciousexcellentvideogamesbasketballgymnasticsvolleyballhamburgersvegetablesdance classboard gamesinterestingfield hockeyChinese foodItalian foodmexicana Mexican food

April 2026 Word Search 3 2026-02-18

20 Items: a baby ducka young cowa young sheepa young horsea young rabbitoutdoor play areawalking leisurelymelodic bird callsa fruit tree flowera young bird in nesta bell-shaped flowera two-wheeled vehiclean animal tunnel homerunning at steady pacea tubular flower spikea toy flown in the winda large fragrant blossoma pink spring tree flower...

Vocab man 2026-03-24

37 Items: hamteaeggsmilkbreadtoastbaconlunchsaladapplepizzawatercerealbananayogurtcookieorangecheesecoffeeto eatsausagehot doglemonadeiced teato drinkbreakfastfor lunchhamburgersoft drinkfruit saladapple juicestrawberriesfrench friesorange juicefor breakfastvegtable soupham and cheese sandwhich

Beber Word Search 2024-03-13

35 Items: hamwitheggsmilksaladappleneverbreadtoastcoffeecerealto eatcookieI loveI likeorangecheeseto drinkto sharelemonadebreakfastfor lunchhamburgerfood, mealfruit saladapple juicepizza pizzaWhich? What?strawberriesorange juicemore or lessfrench friesto understandfor breakfastdrink/beverage

TAN'LAYA ENDO 2025 2025-12-20

35 Items: matliftfishthinkmouthchilddreamBridgeAlbinoportermaggotmonthlydecidedoutsidetermitea metalfinisheda gossipPassengermore thanimportantcrocodiletoadstooladvertisetestimonyforbiddennot on topcrustaccea(fruit) RipeA bird of preygrow/germinaterich man/womanscatterbrainedA general traderyou often see them in the sky at night

S3 Robo en la noche 2024-02-08

25 Items: comehiddena callcapturedthe ropethe courtthe cabinto get madthe bad mennobody movethey kisseddon't hit meto cut fruitshe sat downwhat's wronghad a hold ofthey had stolenbright feathersshe couldn't moveyou were using mea terrible situationthere wasn't a signalthree different voicesshe is going to testifya small, roadside restaurant in C.R.

Boeger Word Search 2024-10-07

95 Items: JaxBeefCakeEggsGoatMilkReneeJanelZeldaBaconBellyBreadCakesChipsCreamFruitGoudaGritsJuiceMangoRanchSaladSpicySweetBoegerDebbieJustinJoshuaSherryRobloxCapersCeleryCheeseCoffeeGreensMuffinOnionsOrangePepperPitHamSalmonSconesSmokedBartoszJoeNeriKimJackKennedyKristinAlainnaColleenAmongUsBiscuitBraisedBriocheChickenGriddleGrilledLettuceSausagePancake...

Spanish Vocab 7 2024-11-21

41 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysRight?SausageHot DogWithoutLemonadeTo DrinkBreakfastHamburgerHow awfulSoft DrinkFood, MealFruit SaladStrawberriesFrench FriesWhich? What?More or LessTo understandDrink/Beverage

Sandwich Words 2025-05-14

28 Items: Sun ______ PotPlay ______ KeysHot ______ FondueRed ______ BisqueSnow ______ HousePeanut ______ FlySoap ______ HouseIce ______ CheeseDown ______ GroundCoffee ______ ShowAm I ______ LagoonJumbo ______ ScampiTaco ______ BottomsTalking ______ AcheTennis ______ MakerRed ______ RecorderBlack ______ in OneLincoln ______ CabinMichael ______ River...

Spanish Vocab 2025-11-15

34 Items: tombMaskArchSaltfoodangleBibleSkullCrossAlterwaterfruitCoffinFlowerscandlescandlesIncenseIncenseskeletoncemeteryOfferingMarigoldsGave yardDead BreadSugar skullSugar Skullspirit GuidesFlower petalsDay of the deadWhimsical skeletonDecorated cut PaperMonarch butterfliesFace of Day of the DeadDays of the little angels

Spanish Vocab 2025-11-20

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

food and appliances 2026-03-22

96 Items: egghamfoodcakemilkovenmayopearricesaltstewmeatlavasteakbreadtoastwheatflourwaterfruitapplejuicemangoicingbagelroastplantsflowercheesebananaorangecitrusshrimpbamboograpesprunessmorespeppergarlicburritoburgerscupcaketoastermustardketchupraisinssasaugenuggiesbrocollieggplantsandwichchowmeinmilkywayhersheysicecreamchocolatemicrowaveplaydoughlemonzest...

<333 2026-01-30

16 Items: favourite flowermy favourite animewhere we first metyour favourite animefunniest person everrgo-to late night spotour anniversary monthour favourite fruit ;)our favourite chocolatethe love of my ____ <33favourite late night snackmy favourite nickname for youyour favourite nickname for mehappy 2 year _____ my love! <3favourite movie we saw together...

Animal Crossing Word Search 2023-07-03

88 Items: cjbugaxenetboblunapavejackfishleifreddwisptentlaketreecafestarlolatimmytommykappndreammabelsableflickcyrusreesekicksbeachcliffriveroceanshellfruitborischerimaplemerryislandaiportwilburharveyzipperjinglemuseumfossilforestsaharaturnippascalspringautumnwintersummerrecipeshovelladderflowerseasonmarinaauroraorvilletomnookwardellscallopcelesteisabelle...

Mega Harvest Word Search 2024-10-01

95 Items: HayJamSoilCornRiceBarnMilkEggsTreesFruitPearsPlumsSeedsVinesCropsGrainMaizeWheatSheepHorseGoatsHerdsHoneySugarDairyBreadAutumnOrchidApplesGrapesOnionsMowingSowingBarleyFieldsStableCattleCheeseFarmerLabourYieldsPeachesOrangesRhubarbCarrotsBerriesFlowersGrowingCuttingPickingTractorTrailerFarmingCerealsBeehiveChickenYoghurtProduceRainfallTomatoes...

Spanish Vocab 2025-11-18

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Confectionary word search 2024-03-08

16 Items: – mashed fruit made into a paste (tyrė)– a protein common in wheat flour (glitimas)– thick mixture used to bake pastries (tešla)– product used to add carbon dioxide in dough (mielės)– mixing device for large quantities of food (plakiklis)– primary appliance used to bake food (vyrykle, krosnis)– tool used to slice food into smaller pieces (trintuvė)...

N'Senga Word Search 2023-07-31

10 Items: Rank it!Thai BasilSenga's Choice Of Fruit At C4The Ugliest Shoes In The WorldWhat Senga Works With At The LabThe Vehicle Senga Drives On ShiftThe Bean Senga Was Accidentally CalledSchmidt & Nick Are The Best CharactersSenga's Second Favorite Ice Cream FlavorWhat Senga Gets Made Fun Of For Yelling On Snapchat

Puzzle 2023-11-09

7 Items: Abundant noble gasItalian coffee dessertOrigin of gouda cheeseDirector who likes feetFlorida license plate fruitThey have blue blood, three hearts and a doughnut-shaped braingolf tournament that Tiger Woods won by 12 strokes cementing his first-ever major championship win

Grade 4 Spelling wordsearch week 18 2026-01-13

10 Items: not includedan amphibianall of the peoplea sour yellow fruitvery course texturepurchased at a store or onlinewhat you do at school (hopefully)a beautiful flower that is usually scenteda container made of class or plastic to hold liquidsomeone who is born at the same time from the same mom

Applebutter Word Search 2025-02-11

15 Items: An edible seaweed often used in sushi and soups.A dark red legume commonly used in chili and salads.A crispy treat that contains a hidden message inside.A firm-textured fish that is popular in seafood dishes.A green melon with sweet, juicy flesh often eaten fresh.A crunchy root vegetable that is mild and slightly sweet....

bye :( 2024-10-28

12 Items: fuegitocatch fisheswhat you eatwhat you drinka place that got fishesyou get this from a treeyou ubicate on this OBJECTyou use this for directionsyou get this from a tree alsoyou watch movies in this placeyou go to this place when you are sickthe place where you sleep in the outdoor

kayla's bored :( 2025-08-12

12 Items: AugustOur friendA scary fruit to eatSomeone who loves youA certain furry friendSomething we sit at (no spaces)Something we send back and forthWe always get clarity after thisyour second favorite furry friendWhat I always make sure to give youA restaurant that doesn't fill me up :(Where we go early in the mornings (no spaces)

Fruit 🍑🍓🍒🍌🍎🍊🍍🍋🥥🍇🍉🥝🍏🍈🫐 2025-08-27

22 Items: PearLimeKiwiMangoGuavaPeachAppleLemonGrapeCherryPapayaBananaOrangeCoconutSoursopApricotHoneydewBlueberryPineappleStrawberryWatermelonBlackberry

bye :( 2024-10-28

12 Items: fuegitocatch fisheswhat you eatwhat you drinka place that got fishesyou get this from a treeyou ubicate on this OBJECTyou use this for directionsyou get this from a tree alsoyou watch movies in this placeyou go to this place when you are sickthe place where you sleep in the outdoor

Word Search for Lucy 2025-04-05

12 Items: covered in fluffmaking very little noiseto ask God to protect sb/sththe state of not being dangerousin or from a country that is not your ownan underground railway/railroad system in a citythe direction that you look towards to see the sun risethe direction that you look towards to see the sun go down...

word search for the japanese vocabulary for fruit and days of the week 2025-10-24

12 Items: なしりんごすももいちご月曜日火曜日水曜日木曜日金曜日土曜日日曜日オレンジ

Watermelon Word Search 2025-06-28

16 Items: juice me!red, greenaloha fruitdelicious pie!rhymes with glumrhymes with beara lemon's cousinthis is a sad berrythe _______ of my eyeis this berry made of hay?what's green, white, and red______ cobbler and ice creambrown and fuzzy on the outsidelooks more like an orange than a grapesome people like this in their iced tea...

Me and You 2025-07-04

17 Items: my eye colourmy middle nameour walking spotmy birthday monthour first concertyour Greggs go-tomy favourite fruityour comfort movieyour hogwarts housemy favourite colourfirst restaurant dateour fave ginger doggymonth of our anniversarymy character in our duetfirst movie we saw at the cinemastudio number we had our first kiss in...

Day of the Dead Word Search 2025-11-11

34 Items: tombMaskArchSaltfoodangleBibleSkullCrossAlterwaterfruitCoffinFlowerscandlescandlesIncenseIncenseskeletoncemeteryOfferingMarigoldsGave yardDead BreadSugar skullSugar Skullspirit GuidesFlower petalsDay of the deadWhimsical skeletonDecorated cut PaperMonarch butterfliesFace of Day of the DeadDays of the little angels

Tricky words - NTS 2025-11-20

98 Items: busygroubuildearlyeartheightfruitguardguideheardheartlearnoftenreignwomanwomenactualanswerappeararrivecaughtcentrecircledecideenoughfamousheightislandlengthminutenoticerecentthoughweightaddressbelievebicyclebreathecenturycertainextremegrammarhistoryimaginelibrarynaturalnaughtyperhapspopularpossesspromisepurposequarterregularspecialstrangethought...

Summer Words 2026-02-09

100 Items: IceSeaCornHazyJulyJuneSnowWashBeachCatchDaisyFruitOceanRelaxTrailVisitAugustBoogieBreezyCoolerDivingHikingPicnicSummerSweatyTravelTrunksVoyageBalloonBerriesBoatingBoilingBonfireCampingCoconutCookoutFarmersFlowersFrisbeeHolidayJourneyOutsideOutingsRaftingSailingSandalsS'moresSnorkelWeatherAllergicBarbecueBarefootBaseballCatchingCanoeingCarnival...

El dia de Accion 2025-12-02

9 Items: Main food of Thanksgivingtravelers that came to AmericaA sweet starchy rooted vegetableA person born in a specified placeThe day Thanksgiving takes place onAn orange fruit typically seen during FallA baked mixture of flour, water, and yeastoftenly a dessert, containing crust, and fillingA mix of vegetables commonly eaten with dressing

French Summer 2025-05-12

12 Items: Tasty fruitWhat is spiky?What is bright?Tasty but pinchyFire with no fireNeed for marshmellowsTo protect from the sunNo head is complete without oneWhat is small that people use to float?How do you protect yourself from the sun?What do little kids sell next to the street?Kids love them so much that we made pools with them

2020 Book Cover Word Search 2019-12-28

100 Items: CatCupDayDogEyeGunHatIceKeyLegRedSeaSkySunTieWebBeltBikeBirdBlueBoneBootCityCoatDarkFangFireFlagFoodGirlGoldGreyHornKissLeafMoonNoseRainSandScarSnowStarTailTreeWingWoodBeardBlackBladeBloodChainCloudCrownDevilDressFairyFruitGlassGloveGraveGreenHorseHouseLightMouthNightSmokeSnakeSpaceStoneSwordTeethThornTowerWatchWaterWhiteBlondeBridgeCastleCowboy...

Monthly Challenge E-G 2023-05-18

96 Items: eachearseasyeggselseevenevereyesfacefactfallfarmfindfinefirefishfiveflapfoodfootformfourfreefrogfromfullgamegaspgirlgivegoatgoldgoodgrowearlyeartheightenjoyeventeveryfightfirstfloorfrontfruitfunnygiantglassgreatgreengroupguesseatingendingenergyenoughexcitefamilyfamousfarmerfatherfewestfigurefingerfinishflowerflyingfollowforestforgetfriendfuture...

Fun Word Search Puzzle for Grade 1 with Clues 2024-12-05

20 Items: Swims in waterA place to liveFloats on waterFlies in the skyUsed for writingMan's best friendWorn on your feetA soft purring petA bird that quacksTwinkles in the skyA red or green fruitSomething you sit onLights the night skyFull of pages to readA sweet dessert treatGrows tall with leavesA white drink from cowsUsed for eating or work...

Au marché 2025-08-18

44 Items: jameggpearfoodricemealbeefporktunameatfruitpeachapplepastalunchsnailsteaksaladonionbananaorangetomatoyogurtdinnergarliccarrotpotatopepperto cookseafoodchickensausagelettucepie/tartto orderto tastebreakfastvegetablelet's eat!strawberrygreen peassupermarketafternoon snackto go shopping/grocery shopping

food 2026-03-13

96 Items: oxfoxhamtacofishoreomeatsoupcakecokebearporkiceeplumpeartalkotackodonotdonutfrieschipsbreadtoastberryramensteakbeanspizzagoudafudgefruitmelonhoneyfantagummybaconchickrasingrapeburgerburtoebrritodontutpotatolinzernachosbananacrepespozolecheesecoffeespritemuttontoasterpavlovapoptartsasuagecheddarvanillavensiondogmeatcatmeatcrosainttorteeeafrenhfri...

7th 2024-05-12

99 Items: teaeggredcapmilkcakericefishcallcombflatroompinkgraybluesuitcoatbelttallcooksaladkebabdatesbreadfruitcreamhoneyjellyjuiceonionappleradioclocktabletowervillabrowngreenwhiteblackshirtshoesscarfdresssocksshortnursebakerpilotcheesequincetomatobananapotatocarrotstreetofficemirrorgaragestairsorangeyellowjacketchadorglovesdriverworkerdoctorwaiterfarmer...

Year 3 End of Year Spelling Wordsearch 2025-07-17

100 Items: busybuildearlyeartheightfruitgroupguardguideheardheartlearnoftenreignwomanactualanswerappeararrivebreathcaughtcentrecircledecideenoughfamousheightislandlengthminutenoticerecentthoughweightaddressbelievebicyclebreathecenturycertainextremeforwardgrammarhistoryimaginelibrarymentionnaturalnaughtyperhapspopularpossesspromisepurposequarterregularspecial...

How well do you know Rim FM 100.1 2025-09-15

21 Items: Voice of the ?Broadcast area?Fruit shop drawCallum's last nameTony Barnes programJacki & Bec' programPopular radio serialHow to listen online?For the community...?Weekly cake supportersWeekly bistro vouchersHow old is the station?Where is Rim FM located?Elsa' program on ThursdayProduces station sponsorsAnniversary draw supporters...

Christmas 2025-11-15

100 Items: ARTARMANTCARCUPDOGEGGEYEFANFOXHATICEINKJARKEYBIRDBOATBALLBOOKCOOKCAVEDOLLDOORDESKDEERDUCKFISHFROGFIREGATEGIFTGOATGAMEHANDHILLIRONIDEAJUMPKITEKINGKNEELAMPLEAFLAKELIONLINELOCKLOVEAPPLEACTORANGELAWARDBRAINCLOUDCHAIRCANDYDREAMDRESSEARTHEAGLEFRUITFENCEGLASSGLOVEGRASSHOUSEHORSEJUICEJEWELLIGHTLEMONANIMALAUTUMNBOTTLEBANANABASKETBUTTONBRIDGECANDLECIRCLE...