fruit s basket Word Searches

100 English Words 2025-03-10

100 Items: CatDogIceSunJoyZooFastJumpKindPlayRainTreeBabyEasyKingLionNestDoorGoldKiteLampOpenStarXrayYawnIdeaSnowYearEchoAppleGreenHappyLaughNightQuietVoiceWaterZebraChairDanceFunnyHouseOceanQueenRiverSmileTableUnderBreadClockHeartJellyQuickCloudLemonMusicQuiltTigerWagonXenonMonkeyOrangeYellowAlwaysGardenIslandPencilWindowYogurtEnergyFlowerInsectPillowRabbit...

Easter/Spring Word Search 2025-03-31

101 Items: dyehopmaypiebeescakefindlambnestpinkwineyamsbunnycandycrossdressducksgamesgrasshappyhatchjesusmarchpeepspeonyrollsseedsbasketbonnetbrunchbutterchickschurcheastergardenhummusliliesparadepollenrabbitspringsundaytreatstulipsyellowcadburycarrotsegghuntequinoxflowersfriendsholidaypastelspuddlesshovelsbakedhambloomingchangingcolorfuldecoratedesserts...

KIDCUPIDSEARCH 2026-01-27

100 Items: BOWBOXFUNHUGJOYREDTAGTOYBEARBOOKCARDCUTEDRAWGAMEGIFTGLUEHUGSKINDLIKELOVEMAILNOTEPINKPLAYSONGSTARTAPEWARMXOXOARROWCANDYCARDSCHALKCHEERCLASSCOLORCRAFTCUPIDDANCEHAPPYHEARTHELLOJUICELAUGHMUSICPAINTPAPERPARTYROSESSHARESMILESNACKWHITEYUMMYBASKETBESTIECOOKIECRAYONFAMILYFRIENDGIGGLEHEARTSINVITELETTERPENCILSCHOOLSMILEYSNACKSSWEETSTREATSARTWORKBALLOONBELOVED...

Flower word search 2026-02-09

101 Items: BudBeeRoseLilyIrisStemLeafVaseSeedGrowSoilRainPosyTulipDaisyPoppyLotusPeonyAsterLilacPansyBloomPetalThornPlantOrchidVioletAzaleaZinniaCosmosYarrowCloverGardenFloralPollenNectarSproutMeadowSpringSummerColourNatureBasketWreathJasmineBegoniaFreesiaPetuniaAnemoneHeatherBlossomBouquetFloristGarlandCorsageDaffodilMarigoldLavenderHibiscusMagnoliaBluebell...

Household Items 2026-03-15

100 Items: BedMatMopPanPotMugPenRugFanSofaSoapLampBulbIronBowlForkFoilMittTapeCordVaseKeysDeskTableDryerSheetTowelAlarmBroomKnifeBoardWhiskLadlePlateGlassSpoonStoolClockFramePhoneScalePlantCoffeeVacuumWasherPillowShowerMirrorHangerBasketBucketSpongeOpenerPeelerGraterHammerPliersWalletRemoteHeaterCandleToasterBlanketPlungerDresserDustpanSpatulaCleanerBattery...

Easter Word Search 2026-03-16

100 Items: EggHamPieToyJoyTombHopeLambLilyNestHymnCakeGiftGamePlayPalmAmenJesusCrossBibleFaithBunnyChickTulipBloomGrassCandyFeastChoirBreadSugarTreatSmileRisenGraceVigilAltarPeaceLightEasterSundayChurchPrayerGospelSaviorBasketRabbitSpringPastelRibbonParadePicnicBrunchFamilySermonCandleCookiePuzzlePriestChapelCalvaryWorshipHolidaySunriseCupcakeBlossomMiracle...

Halloween Word Search 2026-05-30

100 Items: batwebowlcatfogboofunmaskmooncrowhowlclawcapewormmazewitchghostmummycandytreatfangscloakscaryeeriemagicspellnightbonesskullpatchblackgreentrickpartyravenappleporchpaintspiderzombiegoblinfrightspookycreepycacklepotioncoffinshadowcobwebautumnorangepurplecandleparadescreamshriekforestcookiebucketbasketchillsriddlepumpkinmonstervampirecostumehaunted...

WORD SEARCH FRIDAY FUN ACTIVITY 2025-07-28

15 Items: A RED PLANETEXCEL PROGRAMA SEARCH ENGINEUSA SPACE CENTERSOLID STATE DRIVEA BIRD LARGEST EGGPOPULAR ONLINE VIDEOEVERY FRIDAY ACTIVITY1 billion bytes of dataA FRUIT OR MOBILE PHONEAMIT AND DHARM HIT MOVIEONLINE PURCHASE PLATFORMLEONARDO DICAPRIO 2006 MOVIEA CONTINENT IS 90% COVERED BY ICEA BIRD FAMOUS FOR ITS DANCE AND FEATHERS

Prof Furman's Jewish Food Class Review Word Search 2026-06-03

15 Items: Fancy mustardJews from UgandaThe ______ BanquetAshkenazi fish dishIsrael's "national snack"Machines make them squareName of the farm we visitedHe made frozen bagels famousClassic deli sandwich fillingJews from the Iberian PeninsulaThese cookies became kosher in the '90sThanksgiving feast dish of Bene Israel Jews...

Na putu s Isusom iz Nazareta 2022-04-28

5 Items: ISUSČUDAJUDAPONCIJEPILATVELIKIČETVRTAK

Wedding Word Search 2024-09-02

20 Items: Ballroom NameThe First ManMaid of HonorThe First BookBride's FamilyThe new twentyThe First WomanMeow Meow's PetGroom's First NameBride's First NameName of Flower GirlA girl's best friendIt's a prominent fruitThe bride's meal choiceGarden where it all beganLast name; Sounds ScottishFlavor of the Wedding CakeFather Tom's first occupation...

Fearless 2025-03-29

30 Items: lawsavedfearsfruitperfectevidencenot seensubstancehoped forimitatorssacrificeLord JesusGod is loveHoly Spiritdivine loveonly believedear childrendo not be afraidvaried expressionsjoy that overflowspeace that subdueskindness in actionstrength of spiritgrace through faithlife full of virtuefaith that prevailsgentleness of heartsweet smelling aroma...

CIT 2025-10-31

18 Items: KN viša od KTKN niža od KTGornji i donji?A11 je oznaka zaVc je paneuropski?Idejni, glavni i ?Klasični ili čisti?A6 spaja Bosiljevo i ?Most je, a zapravo nije?Za odvodnju vode s kolnika?Izvode se u brdovitim terenima110 je ograničenje na _____ cesti?Ako je mogu svi koristiti cesta je?Trak između dva kolnička traka (AC)....

Love Search 2026-05-13

15 Items: ElementaryYour beautyAdmiring oneYour birth monthAnniversary MonthYour contact nameOUR favorite fruitYour comfort comedyFlick/my old nicknameA candy and a nicknameWhat I feel when I'm with youMy favorite nickname you gave meThe month we started talking pt2The amount of love I have for youOur ship name and a nickname for you

LA 2025-01-23

11 Items: or play.represent the word.supported with evidenceexpression of a point of view about aThe task of combining sounds rapidly, to– A struggle between opposing forces in adifferent things to show the similarities.A comparison of the features or qualities of– The specified or clearly implied person(s)– An inclination or tendency towards an idea...

Piratas y el triangulo ch 4 2025-09-24

32 Items: soeyeweekI canalmostflyingto grablookingrunningcall meto drivesuddenlystandingthinkingforecastterrifiedit seemeds/he helpsthey lookednear / closewave (ocean)nor / neitherhe/she jumpedhe/she got upso / thereforehe/she woke updear / loved oneI/she/he shiveredbright / brillianthe/she repaired / he/she fixedhe/she was able (to) / he/she could...

Animal abc 2026-01-20

26 Items: is for catis for dogis for foxis for pigis for yakis for bearis for lionis for newtis for quailis for sheepis for tigeris for zebrais for iguanais for monkeyis for rabbitis for walrusis for gorillais for octopusis for unicornis for vultureis for elephantis for kangaroois for alligatoris for jellyfishis for x-ray fishis for hippopotamus

Yra ir kitokių buveinių. 2026-05-05. Gamtos mokslai. Parengė mokytojas S. Chveduk 2026-05-04

30 Items: žolėbitėavyspelėlapėPievakarvėpievaožkosuodasvorassmilgabuliusjautisžiogaivabzdysdobilasganuklabuveinėžolėdismėsėdiskatinasgandrasšunažolėkatilėlisstadionasšienavimasvartotojasgamintojaskurmiarausis

ESCAPE ROOM 2025-04-02

14 Items: Čime se kadi na Misi?Koji je prvi sakrament ?Mjesto pretvorbe na MisiKaže se na kraju molitve.Najmanja država na svijetu.mjesto gdje svi želimo doći.Kako se zove najvažniji blagdan?Čime je Noa spasio sve životinje?Tko su Božji pomoćnici s krilima?Koliko je dana Bog stvarao Zemlju?Kako se zvala prva žena na Zemlji?Kako se preziva Don Boscov učenik ?...

Med Surg Test 5 2025-10-14

20 Items: primary symptom of GERDalso known as abdominal striaethese cysts are found in the sacrococcygeal areahypotension and fatigue are expected following thisconsumption of this is a risk factor for oral cancerthis type of diet should be followed after a cholelithiasisconsuming a low fiber diet is a risk factor for this disease...

Primorsko-goranska županija 2023-01-04

7 Items: Središte Primorsko-goranske županije.Ime župana Primorsko-goranske županije.Koja je po redu Primorsko-goranska županija?Naziv županije u kojoj najveći grad nije sjedište.Koja je prva riječ u nazivu himne Primorsko-goranske županije?Koja županija graniči s Primorsko-goranskom, a da nije na moru?...

You Word Search 2024-08-29

36 Items: OnJargymOutSlidtreeGoalBallFistPoolmuchCoolDatesaid:imagesaid:said:creamSwingwingsunderSeesawSpiralBasketCoffeeChatGPTFrisbeeWhere'sSaffronArmbandsicecreamPistachiochocolateStrawberryI gave you some words can you makee a board game like this?...

Thanksgiving 2025-11-16

100 Items: EatNapPieBakeCornDishFarmFastFoodGoodHomeHopeLoveMealNutsOvenSideAcornAppleBeansBreadBrownCheerCiderFeastGourdGravyGreenHonorLoyalMaizeMercyPartyPeacePecanPlateQuietRoastRollsShareSpiceSweetTableAutumnBasketBountyButterChurchColonyDinnerDonateFamilyFellowFlavorFriendGatherGivingGobbleHealthHumbleLessonMemoryNativeOrangeParadePeoplePrayerRecipe...

Spring fling 2026-03-17

99 Items: EGGNESTLAMBTHAWKITEBLOOMROBINTULIPMUDDYBUNNYCHICKCROSSSEDERMATZOCOMALFLOATTEXANAGGIEMULCHPORCHPUDDLEBREEZEPOLLENPASTELEASTERBASKETBONNETEXODUSTASSELTUBINGRAPIDSCOOLERGRUENERAIDERBOBCATFIESTAWARMTHSPROUTGARDENTROWELFEEDERCOCOONPICNICBLOSSOMALLERGYDIPLOMACURRENTSANDBARUNICORNMUSTANGBEARCATEQUINOXSAPLINGCOMPOSTMONARCHTADPOLERENEWALREBIRTHFRISBEE...

Tumble leaf 3 2026-03-23

97 Items: CANJIGNAPWEBZENPOTEGGBIRDBOWLLEAFROSEPAILSOAPFLATSNAPBIKEREELWILDMITTBARNLOOMCANEGOLFHORNCHALKBEACHSHELLSCARESTUCKTOOLSBEADSRIVERBELLSSTACKWEIRDOFUNNELBASKETTURTLEHOGBUGRACKETPILLOWRIPPLESTRESSCOFFEEHEIGHTSHAPESMURPHYBALLETTUXEDOLEAVESQUARTZAMAZONHODGESBIXPIXPRESENTCLOTHESARUGULASKIMMERMONSTERDRAWINGANCHOURPAPERBAGPOSTCARDPINWHEELFEATHERSSNOWBALL...

Spring Word Search- 100 WORDS! 2026-04-06

100 Items: skybudbeemudmaydewroselilyseedsoilrainwarmwindgrowstemtreekitebikenesteggsducklambcalffoalpondhuntthawmeltbloomtulipdaisyplantcloudgrassgreenfreshfieldswingbootschirpbirdsrobinhatchbunnychickearthreusecleanwaterrivermarchaprilcandyfrostmuddyspringflowergardenshowerbreezenaturesproutpetalsleavesforestmeadowpicnicpuddlejacketrabbitinsectreducestream...

GameStop Word Find 2026-05-28

101 Items: BUYCATDFVDIPDRSGMEITMKENOTMOWNPUTSECUBSUNOYENBABYBANKBONDCALLCARDCASHCNBCDARKDEBTDTCCEBAYFOMOHODLKOSSLENDLOANMAYOPACKPOOLRATERYANSALESEGASELLSWAPXBOXYOLOATARICHEWYCLOSECOHENCOVEREDGARFLOATJAPANKITTYLEAPSMARIOMOASSPOWERSHORTSTEVESTORETEDDYBANANABASKETBORROWCANADAFORGETGAMINGOPTIONREGSHOSETTLESHARESSWITCHALADDINBITCOINCITADELDIGITALGRADINGMORNING...

Cottage Word Search 2026-06-10

100 Items: FoxIvyOakJamPieRoseWrenFawnDeerLambBarnPearFernMossCozySageMintDaisyTulipHoneyRobinFinchGooseApplePeachAcornBirchBrookBreadApronQuiltPorchThymeMeadowGardenRabbitWillowPicnicBasketTeacupTeapotSconesBakingSewingCandleHearthRusticSimpleCloverSunhatCottageBlossomBeeswaxLadybugSparrowChickenRoosterOrchardHarvestPumpkinBlanketCrochetLanternVintage...

I dunno mann (Advanced, random words) 2026-07-10

100 Items: favornormalensurerejectsummitflawedtopplepigeonretirepatrolpeanutgutterstringimmunescreamrepeatapathydoublemirrorproperinjectticketballetpatrolbasketmodulebucketenergychickenretireediagrammentionrubbishrecoverrequestwhisperportiondeveloplaborerterraceprivateacademyforwarddeliverthinkerdepositquarrelsopranoattractapprovediamondhistoryscandalrequest...

Word saerch page 15 BOY´S STUFF 2015-07-21

6 Items: RELOJBARBAPELOTAMALETÍNCINTURÓNBILLETERA

Beber Word Search 2024-03-13

35 Items: hamwitheggsmilksaladappleneverbreadtoastcoffeecerealto eatcookieI loveI likeorangecheeseto drinkto sharelemonadebreakfastfor lunchhamburgerfood, mealfruit saladapple juicepizza pizzaWhich? What?strawberriesorange juicemore or lessfrench friesto understandfor breakfastdrink/beverage

TAN'LAYA ENDO 2025 2025-12-20

35 Items: matliftfishthinkmouthchilddreamBridgeAlbinoportermaggotmonthlydecidedoutsidetermitea metalfinisheda gossipPassengermore thanimportantcrocodiletoadstooladvertisetestimonyforbiddennot on topcrustaccea(fruit) RipeA bird of preygrow/germinaterich man/womanscatterbrainedA general traderyou often see them in the sky at night

Word Search One 2025-05-22

20 Items: Your momYour dadYou read itYou drive itYou drink itA barking petA meowing petYou eat at itYou sit on itA male friendYou live in itTells the timeYou play with itShines in the skyYou look through itGrows in the forestA red or green fruitA place for learningYou open it to enterYou eat it with butter

unit 5: Vocab sections 5-7 2025-12-16

26 Items: the jamthe teathe milkthe snackthe fruitice hockeythe butterlos churrosto play golfthe sandwichto do boxingthe chocolateto play tenisto do surfingto have dinnerto do swimmingto play soccerto do taekwondoto do wrestlingwe eat breakfastthe orange juiceto have breakfastto play the guitarto play basketballto play volleyballgalletas the cookies

3-1 Vocabulario 2026-01-23

42 Items: funbadcarsgolfgoodchessfruitpizzamusicbooksgreatawfulsportssoccertennismoviesboringanimalspartiesbaseballfootballlacrossesoftballhorriblemagazineswrestlingice creamdeliciousexcellentvideogamesbasketballgymnasticsvolleyballhamburgersvegetablesdance classboard gamesinterestingfield hockeyChinese foodItalian foodmexicana Mexican food

April 2026 Word Search 3 2026-02-18

20 Items: a baby ducka young cowa young sheepa young horsea young rabbitoutdoor play areawalking leisurelymelodic bird callsa fruit tree flowera young bird in nesta bell-shaped flowera two-wheeled vehiclean animal tunnel homerunning at steady pacea tubular flower spikea toy flown in the winda large fragrant blossoma pink spring tree flower...

Vocab man 2026-03-24

37 Items: hamteaeggsmilkbreadtoastbaconlunchsaladapplepizzawatercerealbananayogurtcookieorangecheesecoffeeto eatsausagehot doglemonadeiced teato drinkbreakfastfor lunchhamburgersoft drinkfruit saladapple juicestrawberriesfrench friesorange juicefor breakfastvegtable soupham and cheese sandwhich

Basketball 2022-07-26

10 Items: Credited as the inventor of basketball.Women's basketball was introduced at this even in 1976.A shot attempt that doesn't hit the rim or the backboard.The acronym for the National Collegiate Athletic Association.The first African American to be drafted by an all white team.An uncontested shot 15 feet from the basket directly in front....

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

TLA 2026-05-20

108 Items: SSWCJHJJDJJKJTJAbeBenBriCamEvaGilLiaNiaSamZenZoeAdamAliaAriaFinnIzzyJackKaviLeahLilyMayaNoahOwenSebiAlexFAlexSAliceAngelAubryAyannCalebChaseEmilyEthanGabeGGabeHGabeLGraceIliadImnetIsaacJadenJuliaKatieLucasLukeHLukeTMateoMilesPennyRivkaSarahTommiAmeliaAndrewBaylenCamdenCarmenColtonCorbinDeclanFinleyHannahHenryJHenryLHenryTJordanMagnusMargotOliver...

P Word Search 2023-07-05

114 Items: pbtdʈɖcɟkɡqɢmɱʙnrɾɳɽɲŋɴʀʔɸfθɬsʃʂçxχħʜhβvðɮzʒʓʐʝʑɣʁʕɦwʋɹɺlɫɻɭɥjʎɰʟiyɨʉɯuɪʏʊeøɘɵəɚɤoɛœɜɝɞɐʌɔæaɶäɑɒ˥˦˧˨˩dzɪ̈ʊ̈ɯ̽ɒ̈˩˥˥˩˦˥˩˨˧˦˧

My Chemical Romance Ultra Word Search 2026-05-29

89 Items: Gun.MaMaSingBloodDead!EmilySleepCancerHelenaNANANARomanceRayToroCubiclesDESTROYATotheEndMikeyWayBobBryarAmbulanceF.T.W.W.WInterludeTeenagersGerardWayFrankIeroBurnBrightDesertSongSummertimeDangerDaysBoyDivisionHang'EmHighKissTheRingMakeroom!!!PartyPoisonZeroPercentAllTheAngelsDisenchantedHeavenHelpUsPlanetaryGo!VampireMoneyBuryMeInBlackCemeteryDrive...

<333 2026-01-30

16 Items: favourite flowermy favourite animewhere we first metyour favourite animefunniest person everrgo-to late night spotour anniversary monthour favourite fruit ;)our favourite chocolatethe love of my ____ <33favourite late night snackmy favourite nickname for youyour favourite nickname for mehappy 2 year _____ my love! <3favourite movie we saw together...

Animal Crossing Word Search 2023-07-03

88 Items: cjbugaxenetboblunapavejackfishleifreddwisptentlaketreecafestarlolatimmytommykappndreammabelsableflickcyrusreesekicksbeachcliffriveroceanshellfruitborischerimaplemerryislandaiportwilburharveyzipperjinglemuseumfossilforestsaharaturnippascalspringautumnwintersummerrecipeshovelladderflowerseasonmarinaauroraorvilletomnookwardellscallopcelesteisabelle...

Mega Harvest Word Search 2024-10-01

95 Items: HayJamSoilCornRiceBarnMilkEggsTreesFruitPearsPlumsSeedsVinesCropsGrainMaizeWheatSheepHorseGoatsHerdsHoneySugarDairyBreadAutumnOrchidApplesGrapesOnionsMowingSowingBarleyFieldsStableCattleCheeseFarmerLabourYieldsPeachesOrangesRhubarbCarrotsBerriesFlowersGrowingCuttingPickingTractorTrailerFarmingCerealsBeehiveChickenYoghurtProduceRainfallTomatoes...

Spanish Vocab 2025-11-18

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

Iloveyou Word Search 2026-02-03

10 Items: our first kissour fav icecreamwhere we first metfirst board game together"you only **** 1/3 of me??"these are growing in your backyard!i <3 early morning breakfast with you herea ray rays best friend (hint: "a mans best friend")model of car i accidentally hit in the garage freshman year...

The Avery Search! 2026-05-05

13 Items: a fruit!bark bark!free drinks!cute nicknameher cunty erawhat is avery?she was a fairyplain cream cheesea frequent, late night snacka picture above her toilet at homewhat i hear playing from the shower every nighttake a shot every time this is in the dissertation!what she orders, what she makes me too!! (extra lime)

E 2024-02-08

73 Items: naocowratcatgodrinkyomomobondkimibirdboarmayusakikisahiroharuyukiisuzumachikyokoarisahondasohmasheeptigersnakehorsecurseakitoritsuayametohrusecretrandomkomakiprincemanabekakerurabbitmonkeydragonkagurauotanikurenomomijihatoriembracebanquetren-sanshigureeternityriceballseahorsehamajimafried-eggtransformharu-x-rinhastruharukisa-x-hirokyo-x-tohru...

Household Items 2025-10-13

100 Items: fanmopmugpenrugcombdeskforklampovensinkbroomchairclockcouchglassknifeladleplateshelfspoonstovetabletowelbasketbucketcandlecarpetfaucethangerhamperkettlelotionmirrornapkinpencilpillowspongevacuumbandagebathtubblanketblendercabinetcurtaindoormatdresserdustpanplungershampooarmchairbackpackbedframebedsheetcalendarcomputerdoorbellhandsoapkeychain...

Arena Word Search 2026-02-02

100 Items: BIDNETDUNKFANSFOULFOURLEADPASSPOSTSEEDSLAMARENABENCHBLOCKCHEERCOACHCOURTCROWDDRIVEFINALGUARDLAYUPMARCHPAINTPOWERPRESSSCORESPEEDSWEETSWISHUPSETASSISTBASKETBOUNCEBUZZERCAMPUSCUTTERFRENZYHUSTLEJERSEYROSTERSEASONSTREAKTRAVELATHLETEBRACKETCAPTAINDEFENSEMADNESSMATCHUPOFFENSEPLAYOFFRANKINGREBOUNDREFEREERIVALRYSHOOTERSTADIUMSTUDENTTIMEOUTVICTORYWINNING...

MOMO 2026-03-05

100 Items: EggHamJoyHuntLilyRainLambBirdNestHymnPinkHopeBunnyCandyAprilBloomTulipGrassGreenSunnyTweetHaresCrossJesusBibleFaithmarchFeastchickbunnyHappyEasterRabbitBasketEggdyeParadeBonnetHidingSpringFlowerGardenWarmthBreezeGrowthSundayChurchSaviorPrayerChapelFamilyBrunchDinnerPurpleSweetsTreatsJoyfuloutdoorEgghuntFindingBlossomWeatherNewlifeFriendsCookies...

Household Items 2026-03-15

100 Items: BedMatMopPanPotMugPenRugFanSofaSoapLampBulbIronBowlForkFoilMittTapeCordVaseKeysDeskTableDryerSheetTowelAlarmBroomKnifeBoardWhiskLadlePlateGlassSpoonStoolClockFramePhoneScalePlantCoffeeVacuumWasherPillowShowerMirrorHangerBasketBucketSpongeOpenerPeelerGraterHammerPliersWalletRemoteHeaterCandleToasterBlanketPlungerDresserDustpanSpatulaCleanerBattery...

GameStop Word Find 2026-05-28

100 Items: BUYCATDFVDRSGMEITMKENOTMOWNPUTSECUBSUNOYENBABYBANKBONDCALLCARDCASHCNBCDARKDEBTDTCCEBAYFOMOHODLKOSSLENDLOANMAYOPACKPOOLRATERYANSALESEGASELLSWAPXBOXYOLOATARICHEWYCLOSECOHENCOVEREDGARFLOATJAPANKITTYLEAPSMARIOMOASSPOWERSHORTSTEVESTORETEDDYBANANABASKETBORROWCANADAFORGETGAMINGOPTIONREGSHOSETTLESHARESSWITCHALADDINBITCOINCITADELDIGITALGRADINGMORNINGPLAYERS...

Huge Thanksgiving Word Search 2026-05-31

100 Items: piecupfuncornchefforkbarncozymazefeastgravyrollsciderfloattableplatespoonacornwagonapplewheatgourdcrispscarfbootsmaplegamesmusicdanceturkeyautumnfamilycaringsmilesparaderecipebakingdinnersuppernapkincandleleavessquashforestmeadownaturejacketnutmegcookiebasketpicnicpuzzlecraftsseasonharvestpumpkinfriendssharingkitchenhayrideorchardsweaterbonfire...

Find 100! Words 2026-07-03

100 Items: EJTVBBQRaiJazzAshaBallBabyNewsBeanCafeSahibBingoHymnsMusicPhoneMapleCallsBibleCardsCraftsTriviaOutingSocialMotherFatherEasterCanadaCaringMemoryBakingChurchSoccerBasketTravelMoviesFiestaDiwaliEventsPicnicRosaryBalloonStrollsMassageFeedingDinnersSingingNewYearTherapyRiddlesPuzzlesFitnessDancingCookingBowlingReadingLaundryAnimalsHistoryCouncilWalmart...

‘c’ makes ‘s’ sound before ‘i’, ‘e’ and ‘y’ 2026-07-10

9 Items: cemeterycriticiseexcellentexistencehindrancenecessaryprejudicesacrificeconvenience

wish on a star word search 2026-04-11

28 Items: the host of woaswhat's in pinatathe prize of woasthe goal of woas 2the cohost of woasthe enemy of stumpyspeaks total gibberishthe bounty for bofaduma fruit with no friendsthe abbreviation of the showthe species that star is fromthe thing that bluekill emitsan egg like contestant of woasthe name of alarm clock's teamthe blue token friends with tab...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

S3 Robo en la noche 2024-02-08

25 Items: comehiddena callcapturedthe ropethe courtthe cabinto get madthe bad mennobody movethey kisseddon't hit meto cut fruitshe sat downwhat's wronghad a hold ofthey had stolenbright feathersshe couldn't moveyou were using mea terrible situationthere wasn't a signalthree different voicesshe is going to testifya small, roadside restaurant in C.R.

Boeger Word Search 2024-10-07

95 Items: JaxBeefCakeEggsGoatMilkReneeJanelZeldaBaconBellyBreadCakesChipsCreamFruitGoudaGritsJuiceMangoRanchSaladSpicySweetBoegerDebbieJustinJoshuaSherryRobloxCapersCeleryCheeseCoffeeGreensMuffinOnionsOrangePepperPitHamSalmonSconesSmokedBartoszJoeNeriKimJackKennedyKristinAlainnaColleenAmongUsBiscuitBraisedBriocheChickenGriddleGrilledLettuceSausagePancake...

Spanish Vocab 7 2024-11-21

41 Items: HamTeaEggsMilkWithBreadToastBaconLunchSaladApplePizzaWaterNeverCerealBananaYogurtCookieOrangeCheeseCoffeeTo EatAlwaysRight?SausageHot DogWithoutLemonadeTo DrinkBreakfastHamburgerHow awfulSoft DrinkFood, MealFruit SaladStrawberriesFrench FriesWhich? What?More or LessTo understandDrink/Beverage

Sandwich Words 2025-05-14

28 Items: Sun ______ PotPlay ______ KeysHot ______ FondueRed ______ BisqueSnow ______ HousePeanut ______ FlySoap ______ HouseIce ______ CheeseDown ______ GroundCoffee ______ ShowAm I ______ LagoonJumbo ______ ScampiTaco ______ BottomsTalking ______ AcheTennis ______ MakerRed ______ RecorderBlack ______ in OneLincoln ______ CabinMichael ______ River...

Spanish Vocab 2025-11-15

34 Items: tombMaskArchSaltfoodangleBibleSkullCrossAlterwaterfruitCoffinFlowerscandlescandlesIncenseIncenseskeletoncemeteryOfferingMarigoldsGave yardDead BreadSugar skullSugar Skullspirit GuidesFlower petalsDay of the deadWhimsical skeletonDecorated cut PaperMonarch butterfliesFace of Day of the DeadDays of the little angels

Spanish Vocab 2025-11-20

31 Items: TombMaskArchSaltFoodAngelBibleSkullCrossAltarWaterFruitFlowersIncenseMarigoldSkeletonOfferingDead BreadSpirit GuidesFlower petalsDay of the deadCoffin or CasketPicture or PhotoVelas or CandelasWhimsical SkeletonCemetary/GraveyardDecorated Cut PaperMonarch ButterfliesDay of Little AngelsFace of Day of the DeadCalavera de Azúcar or Alfeñique

food and appliances 2026-03-22

96 Items: egghamfoodcakemilkovenmayopearricesaltstewmeatlavasteakbreadtoastwheatflourwaterfruitapplejuicemangoicingbagelroastplantsflowercheesebananaorangecitrusshrimpbamboograpesprunessmorespeppergarlicburritoburgerscupcaketoastermustardketchupraisinssasaugenuggiesbrocollieggplantsandwichchowmeinmilkywayhersheysicecreamchocolatemicrowaveplaydoughlemonzest...

The Avery Search! 2026-05-05

13 Items: a fruit!bark bark!free drinks!cute nicknameher cunty erawhat is avery?she was a fairyplain cream cheesea frequent, late night snacka picture above her toilet at homewhat i hear playing from the shower every nighttake a shot every time this is in the dissertation!what she orders, what she makes me too!! (extra lime)

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Phoenix Suns 2025-06-03

12 Items: Book's middle nameSuns' finals opponentSuns' finals opponentSuns' finals opponentA favorite Al McCoy CatchphraseSuns' 2nd leading all-time scorerSuns' first Slam Dunk Contest winnerSuns' 1st NBA Rookie of the Year winnerAnother Suns' NBA Rookie of the Year winnerSuns' player that won NBA MVP Award 2 times...

OLOL Wordsearch 2026-02-12

10 Items: six _ _ _ _ _First,second,third _ _ _ _ _ _As smooth as a _ _ _ _'s bottom.The case of the missing _ _ _ _ _This car brand is also a special stoneThis county wears a yellow and green jerseyyou can tie your hair up in a _ _ _ _ _ _ _ _A king or queen is in charge of a _ _ _ _ _ _ _A long car ride is sometimes called a long _ _ _ _ _ _ _...

Himna Word Search 2023-11-30

17 Items: glavni grad Srbijeglavni grad Italijeglavni grad Hrvatskeglavni grad Mađarskeglavni grad Slovenijeglavni grad Crne Gorevijeće koje upravlja gradomskladao ju je Josip Runjaninglavni grad Bosne i Hercegovineupravlja zemljom poštujući zakoneŽupanija u kojoj živiš zove se...organizirani način upravljanja državompredstavlja državu u zemlji i inozemstvu...

Musical Genres 2024-03-11

17 Items: suiiimusic popularmade for moviesA sub-genre of pieclub and party musicpopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombia...

Econ: Ch.17.1 2025-01-11

6 Items: Profits paid to stockholdersShares of ownership (Begins with "s")A small business owned by one individualWhen a business is owned by two or more peopleA business type which is recognized as a separate legal entityType of organization which does not seek to make a profit for stockholders

Confectionary word search 2024-03-08

16 Items: – mashed fruit made into a paste (tyrė)– a protein common in wheat flour (glitimas)– thick mixture used to bake pastries (tešla)– product used to add carbon dioxide in dough (mielės)– mixing device for large quantities of food (plakiklis)– primary appliance used to bake food (vyrykle, krosnis)– tool used to slice food into smaller pieces (trintuvė)...

DOBA REVOLUCIJA 2023-12-12

16 Items: francuska himnatemeljni zakon državemjesto "bitke naroda"mjesto" trocarske bitke"mjesto kongresa 1814./1815.mjesto konačnog poraza Napoleonaotok na kojem je umro Napoleon, Svetabritanski admiral, protivnik Napoleonaotok na koji je prognan Napoleon 1814.predstavnici sitnog građanstva u Francuskojkraljica u Francuskoj za vrijeme revolucije...

Midterm review 2026-07-22

19 Items: brownblackwhiteyelloworangePet felineWhite water birdAnimal with a humpAnimal with a pouchAnimal with a shellClothes you sleep inClothes for your feetYou use this for sushiFood that contains seedsFood that comes from plantsYou use this to cover from rainWhat you wear to protect your eyesYou use this for ice cream or soup...

FARMAKOLOGIJA 2023-10-30

12 Items: neželjena djelovanja lijekanačin primjene lijeka kroz ustagdje se primjenjuje lijek topikalnoanatomsko-terapijsko-kemijski sustavznanost koja se bavi doziranjem lijekaznanost o utjecaju lijeka na živa bićao čemu ovisi djelovanje lijeka kao otrovsposobnost lijeka da se veže s receptoromodređuje količinu i brzinu apsorpcije lijeka...

jeffreys word search zine 2026-05-16

12 Items: Karleewho is in Paris?your favorite appyour first Thai BLyou are part of the?what did H.E.R.'s tita say?one of your favorite cuisinessomething you always make and eatfirst you're poor and now you're...?who turned the Met Gala into and X-GALA?if you don't drink this you're not a real man...

KOMUNIKACIJA U VEZI SA ZAPOŠLJAVANJEM 2025-10-13

9 Items: izraz licaprocjena želje i motivacijeproces prenošenja misli, porukaprocjena sposobnosti i iskustvaposlovno pismo čiji je cilj iskazati interes za radpolitika i praksa cijele organizacije (kozm.salona)ponašanje pojedinca u skladu s moralnim i etičkim načelimaposlovno pismo čiji je cilj uvjeriti poslodavca da nas zaposli...

N'Senga Word Search 2023-07-31

10 Items: Rank it!Thai BasilSenga's Choice Of Fruit At C4The Ugliest Shoes In The WorldWhat Senga Works With At The LabThe Vehicle Senga Drives On ShiftThe Bean Senga Was Accidentally CalledSchmidt & Nick Are The Best CharactersSenga's Second Favorite Ice Cream FlavorWhat Senga Gets Made Fun Of For Yelling On Snapchat

Puzzle 2023-11-09

7 Items: Abundant noble gasItalian coffee dessertOrigin of gouda cheeseDirector who likes feetFlorida license plate fruitThey have blue blood, three hearts and a doughnut-shaped braingolf tournament that Tiger Woods won by 12 strokes cementing his first-ever major championship win

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

Jedrina Word Search 2025-11-04

30 Items: Stvaraju smoluOrgani ga čineDaje trajnost drvetaNalazi se u godovimaČini ga skup stanicaOdvodi od lista glukozuDrugi naziv za libriformNizovi paralelnih stanicaNalazi se u drvnim tracimaŠtiti deblo od vanjskih utjecajaDebla koja imaju mali pad promjeraPresjecanje je okomito na os drvetaOsobina debla da na njemu nema grana...

Elektromagnetska indukcija 2 (za 3 :) ) 2026-05-28

13 Items: Tijelo koje guraš u zavojnicu da izazoveš indukcijuInstrument pri čijem se sviranju javlja elektromagnetska indukcijaPredznak u Faradayevom zakonu koji matematički predstavlja Lentzovo praviloNaziv za novo magnetsko polje koje stvara sama inducirana struja u zavojniciLentzovo pravilo je zapravo zakon o ovome za energiju primijenjen na indukciju...

Grade 4 Spelling wordsearch week 18 2026-01-13

10 Items: not includedan amphibianall of the peoplea sour yellow fruitvery course texturepurchased at a store or onlinewhat you do at school (hopefully)a beautiful flower that is usually scenteda container made of class or plastic to hold liquidsomeone who is born at the same time from the same mom

S. Z. ,6. razred 2025-06-02

3 Items: WIFI, LOZINKA, BLUETOOTH, IP ADRESA, DOWNLOAD, UPLOAD,VIRUSI, CRVI, TRJANSKI KONJ, ANTIVIRUS, KOLAČIĆI, ANIMACIJA, PREZENTACIJAHADRVER, SOFTVER, BIT, BAJTCLICKBAIT,DEEPFAKE,DATOTEKA, UMJETNA INTELIGENCIJA, E- NASILJE, DIGITALNI TRAG,SCRATCH, GRANANJE, IF- ELSE, PONAVLJANJE,

Príprava espressa 2024-11-06

8 Items: Aký tvar má mať šálka na espresso?Ako sa volá pomôcka na utlačenie kávy?Čo je základnou zložkou kávového nápoja?Aký tlak je potrebný na prípravu espressa?Aký typ vody by ste mali používať pri prípČo môže ovplyvniť chuť espressa pri príprave?Aká teplota kávovaru je potrebná pred prípravou kávy?...

Fruit 🍑🍓🍒🍌🍎🍊🍍🍋🥥🍇🍉🥝🍏🍈🫐 2025-08-27

22 Items: PearLimeKiwiMangoGuavaPeachAppleLemonGrapeCherryPapayaBananaOrangeCoconutSoursopApricotHoneydewBlueberryPineappleStrawberryWatermelonBlackberry

Banana Word Search 2026-06-24

10 Items: The color of grass.An animal that can fly.A place where you learn.An animal that says “meow”.Something you use to write.A drink that comes from cows.A big animal with a long nose.Something you read with pages.Something you wear on your head.A yellow fruit that monkeys like.

Super Summer Fun! 2026-06-01

15 Items: CelebrationA cold treatBlended fruitYou drink thisEating outsideRainy and loudYou swim in thisThe opposite of coldSandy and also has waterThings you play in summerThis grows from the groundSomething you wear in a poolYou put this on to avoid sun burnsOur solar system orbits around thisA yummy drink that is sometimes sold at stands.

Applebutter Word Search 2025-02-11

15 Items: An edible seaweed often used in sushi and soups.A dark red legume commonly used in chili and salads.A crispy treat that contains a hidden message inside.A firm-textured fish that is popular in seafood dishes.A green melon with sweet, juicy flesh often eaten fresh.A crunchy root vegetable that is mild and slightly sweet....

• W O R D S E A R C H • 2020-09-10

10 Items: BUKUIWANINDIEHUJANMEDANNANDATAMANBINJAIZAYYANGRAMEDIA

• W O R D S E A R C H • 2022-02-08

10 Items: WEANDARENOWTHENEACHOTHERLOVINGFOREVERTOGETHER

žodžiai s z dz 2025-04-30

3 Items: saladzūkassultys

word search for the japanese vocabulary for fruit and days of the week 2025-10-24

12 Items: なしりんごすももいちご月曜日火曜日水曜日木曜日金曜日土曜日日曜日オレンジ

bye :( 2024-10-28

12 Items: fuegitocatch fisheswhat you eatwhat you drinka place that got fishesyou get this from a treeyou ubicate on this OBJECTyou use this for directionsyou get this from a tree alsoyou watch movies in this placeyou go to this place when you are sickthe place where you sleep in the outdoor

kayla's bored :( 2025-08-12

12 Items: AugustOur friendA scary fruit to eatSomeone who loves youA certain furry friendSomething we sit at (no spaces)Something we send back and forthWe always get clarity after thisyour second favorite furry friendWhat I always make sure to give youA restaurant that doesn't fill me up :(Where we go early in the mornings (no spaces)