fruit s basket Word Searches

Word Search - Chapter 11 2025-04-28

4 Items: A narrator of sorts that is never seenSome sort of obstacle blocking resourcesBullying that occurs on digital technologyUsed to assess the fiction female character(s)

CRIJEVA STOKE ZA KLANJE 2025-05-25

6 Items: Crijevo u koje se nadjeva krvavicaCrijevo koje povezuje tanko s debelimProizvod punjen u svinjsko slijepo crijevoProizvod punjen svinjsko ili goveđe ravno crijevoCrijevo u kojemu se vrši apsorbcija hranjivih tvariNaziv kobasice koja se nadjeva u ovčja tanka crijeva

Week 5's words, from Bullying para./last wordlist of Sem 1 2023-12-01

22 Items: upticknovicemandatetrivialallegedmaintaininnatelyproctorscorporalestablisheliminatebystanderhonor-codesubsequentstigmatizecounterpartperpetratorretaliationinfractionsprogressiverestorativeintervention

What is the 1st 90's Hip Hop Album that you see? 2023-09-08

55 Items: atliensironmanillnanaillmaticaqueminisoulfoodthescorethediaryhardcorethechronicreadytodiedoggystyleridindirtyhardtoearnsexpacketstheinfamousalleyezonmesupadupaflycypresshillmuddywatersentadastageinamajorwayharlemworldliquidswordsresurrectionitwaswrittenthewarreportthepurpletapequikisthenamemomentoftruthdoyouwantmorecheckyourheadwhuttheealbum...

Amazing F 2026-03-15

13 Items: A pink birdA sea animalPart of our bodyYou eat with thisA red/orange animalIt smells very niceA farmer works hereAnother word for dadEvery country has oneIt makes a ribbit soundDifferent animals live hereDifferent things are made hereApples, bananas, pears in one word

Mary Anning 2023-10-17

7 Items: Drugi naziv za ihtiosaura.Svoj je život posvetila proučavanju...Anning je kao dijete preživjela udar...Proučavala je prostor koji danas nazivamo...Vrsta dinosaura s krilima koju je otkrila Anning.Vrsta umjetnosti koja prikazuje prapovijesni život.Drugi naziv za fosilizirani izmet koji služi za proučavanje prehrambenih navika praživotinja.

ponavljanje 1.r. vjeronauk 2023-12-22

18 Items: ime prve ženeMarijin mjesecIsusovi učenicirazgovor s Bogomime prvog čovjekasveti dan za kršćanedrugi naziv za Sveto pismozajednica roditelje i djecečin kojim postajemo kršćanikoliko dana bog stvara svijetslijepac kojeg Isus ozdravljazajednica svih vjernika kršćanamjesto gdje su živjeli prvi ljudiljudi koji su živjeli svetim životom...

What is the 1st 90's Hip Hop Album that you see? 2023-09-08

33 Items: atliensironmanillmaticaqueminisoulfoodthescorethediarythechronicreadytodiedoggystyleridindirtytheinfamousalleyezonmesupadupaflycypresshillmuddywatersentadastageliquidswordsresurrectionitwaswrittenthepurpletapequikisthenamemomentoftruthdoyouwantmoreenterthewutangtheslimshadylpreasonabledoubtblackonbothsidescapitalpunishmentmamasaidknockyaout...

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

woordzoeker van matthijs 2025-03-05

81 Items: ZonOogManZeeDagVisKatKoeBoekHuisAutoBoomBladDeurRaamHandTandKaasMelkKindWerkWindMaanSterBergStadDorpMaatPijnDoodTijdJaarTuinGrasMuisHondSpelFilmAppelFietsMolenTafelStoelVogelLichtBroodVrouwRegenKamerSlaapGelukLevenNachtMaandZomerLenteBloemFruitVleesPaardSportLeraarRivierVriendSchoolDonkerSneeuwEilandStraatLiefdeDromenDenkenLachenHuilenZingenHerfst...

Spanish List - 3A 2026-03-17

37 Items: hamteaeggsmilkWithbreadtoastbaconlunchsaladapplepizzawaterdrinkneverWhat?cerealbananayogurtcookieorangecheesecoffeeto eatalwayssausagewithoutlemonadeto drinkbreakfastfor lunchhamburgersoft drinkfood, mealfruit saladstrawberriesfor breakfast

Spanish Word Search By O'rien N 2026-05-13

40 Items: teafateggsfoodmeatfishpeasricebreadtoastbaconlunchsaladfruitapplepizzaonioncerealorangegrapescheeseto eatdinnertomatobannanasausagecookiesbannanato takechickenlettuceto drinkcarrrotsBreakfasthamburgersandwhichvegetablesgreen beansstrawberriesfrench fries

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

;) 2026-05-29

17 Items: 你老师Which place do people swim in? (p+3)Which place do people go to watch movies? (c+5)Which place do people go to take a train? (t+12)Which place do people stay when they travel? (h+4)Which place has trees, grass, and playgrounds? (p+3)Which open public area is often found in a city? (s+5)Which large ship is used for travel and holidays? (c+5)...

Grocery 2026-02-05

214 Items: IceJamOilTeaBeefCakeCornDeliEggsFetaFishKaleLambMeatMilkPeasPitaRiceSaleSaltSoapSodaSoupTunaWineYamsZitiAisleBasilBeansBreadBroomChiliChipsCiderCreamDairyDoughFlourFruitHerbsHoneyJuiceLemonLimesMelonPastaPeachPlumsPizzaSauceShelfSugarWaterApplesBagBoyBagelsBakeryBasketButterCapersCerealCheeseCoffeeCouponDonutsGarlicGingerGrapesIceTeaJamJarOlives...

week 14 2025-11-04

9 Items: 炸洋葱juicy fruityummy drinkgoes on a sandwichon the table with saltcrunchy green vegetablebreakfast food with milkvegetable cooked in the ovenJack dropped the _ _ _ _ _ _ _ into a pot of boiling water and cooked them for ten minutes.

Spanish Vocab 2B 2026-02-13

34 Items: ofmyflagdeskdoorhereyourmouseclocktablechairthereposterscreenwindowbehindwhere?in, onbookbagcomputerkeyboardItś a...on top ofunderneaththe (mas.)the (fem.)some (mas)in front ofsome (fem.)what is this?next to, besidepencil sharpenerwaste paper basketthere is, there are

Kennelly & Associates Word Search Find as many words as you can in two minutes to win a fall basket! 2023-09-22

30 Items: hoperaykimfolgerstherapywheatonempathytootsieskindnesskrakowskikrakowskirihabyakolisaarmanremingtondrkennellyterrynearydawnmodicaandreabennshruthiraocompassiondedicationthirtyyearscelebrationinspirationanniversarymentalhealthrobertlasicasandicorbettcaroledankersmakeadifferencesolutionstogether

Životni Ciklus Životinja 2022-06-06

23 Items: gmižeima dlakeptica selicanoćna životinjaličinka leptirapotpuna preobrazbaorjentiranje zvukomapreobrazba 3 fazepočetna faza životaimaju škrge i perajenetpotpuna preobrazbaživotinje aktivne noćipoznate po migracijama3. faza razvoja leptirapreobrazba ima 4 fazeživotinja s kralježnicomjedinke spolno zrelepočinje u utrobi ili jajetu...

Ponovimo zajedno!!! 2023-09-06

10 Items: Mjesto u koje pišemo note...Nota koja traje jednu dobu...Znakovi koje pišemo u crtovlje....Znak koji pišemo na početku crtovlja....Instrument s tipkama, crnim i bijelim....Velika skupina ljudi koja zajedno pjeva...Velika skupina ljudi koja zajedno svira...Osoba koja upravlja zborom ili orkestrom...Znak kojim označujemo tišinu u glazbenom djelu.....

Le "s" et le "x" muet en fin de mot 2020-02-18

13 Items: basgensmoisnoixprixcorpspoidsrepaschoixdedansdehorsvacancesplusieurs

Spanish foods 2023-03-02

33 Items: hamteawitheggsmilksaladappleneverbreadtoastpizzato eatcookieI loveI likeorangebananacheesewithoutto sharelemonadeyou loveiced teabreakfastfor lunchhamburgerfood, mealfruit saladWhich? What?strawberriesmore or lessto understandfor breakfast

Abrisseau Word Search 2025-03-22

80 Items: FUTPINHOUXORMETECKTIGECEDRECHENEFLEURFRENEFRUITHETRENOYERSAPINSAULETRONCACACIAAUBIERBAOBABBONSAICHARMECYPRESECORCEERABLEEPICEAFUTAIEGINKGOGREFFELIERRELITCHIMELEZEMURIERRACINERAMEAUSOUCHEVERGERARBUSTEBOSQUETBOULEAUBRANCHEBUISSONCANOPEEDRAGEONEPINEUXESSENCEFEUILLUFIGUIERLISIEREOLIVIERORANGERPALMIERPLATANEPOIRIERPOMMIERPRUNIERSEQUOIATAILLISTILLEUL...

happy valentine's day 2026! 2026-02-05

10 Items: our ship namemy fave fruitmy zodiac signyour zodiac signmy favorite Sade song(one) of our fave brandsmy fave coffee/matcha spotwhere we had our first dateyour recent fave snack (i think)the name of your cute dog <3 r.i.p.

Golden Summer 2023-08-10

10 Items: ROYGBIVDihydrogen MonoxideTequila Based CocktailEnclosed Body of WaterWarmest Season of the YearFruit Flavored Frozen TreatBody of Water Surrounded by SandStar at the Center of the Solar SystemFood Consumed During Annual CompetitionAccessory Worn to Protect Eyes from the Sun

Restaurante Word Search 2026-04-27

20 Items: playateatroparquecolmadojoyeríalibreriapanaderíaheladeríapasteleriacarniceríaA place to buy shoesA place to buy fruitA place you go to eat.a place u watch moviesa place u buy groceriesA place to eat, drink, and chilla small store usually near neighborhoodscomercial a central attraction of storesPlace that sells clothes and other personals...

• W O R D S E A R C H • 2024-03-24

13 Items: wesoofanddayareyouadekveryhappyproudgraduationcongratulations

Macbeth Vocabulary 2023-03-16

20 Items: waitsmessengersto considerevil; wickedeasily perceivedfills with dismayconscience; moralsdrunken merrymakingextremely small in sizeextreme ill-will or spiteto adhere, clink, or stick fastthe murdering of one's parent(s)adherence to a strict moral codespecial honor expressed publiclyinduced to commit an unlawful act...

Element Symbols and Names to Know 2025-08-13

50 Items: BCHINOPKSWUAlSbArAsBaBeBrCdCaCsClCrCoCuFlAuHeFeKrPbLiMgMnHgMoNeNiPtPuRaRnSeSiAgNaSrSnXeZn

. 2025-10-26

10 Items: rudarudarudaMetal karakterističnog žutog sjajaTvari koje provode električnu strujuTvari dijelimo na čiste tvari i ______Jedini tekući metal pri sobnoj temperaturiFizikalna promjena, prelazak iz krutog stanja u tekućeSvojstvo neke tvari da vrlo brzo i lako reagira s drugim tvarima...

Životni Ciklus Životinja 2022-06-06

23 Items: gmiže3 fazeima dlakeima 4 fazeptica selicaspolno zreleaktivne danjunoćna životinjaličinka leptirapotpuna preobrazbaorjentiranje zvukompočetna faza životauče određene obrasceimaju škrge i perajenetpotpuna preobrazba2 faza razvoja kokošiživotinje aktivne noćipoznate po migracijama3. faza razvoja leptiraživotinja s kralježnicom...

6a 2025-04-03

28 Items: uglysameherelargesmallthingtherein,onprettybehindthe bestthe bestimportantthe worston top ofworse thanpossessionunderneathbetter thanin front ofown,one´s ownmore,more thantotheright(of)Next to, besideless,fewer..thenthe worst (plural)ni my opinion,for mein your opinion, for you

History and Government 2026-02-09

36 Items: 1787TEXASMLKDAYPUBLIUSSLAVERYARIZONAJPHN JAYGULF WARNEW YORKLABORDAYCHRISTMASKOREAN WARCALIFORNIANEW MEXICOJULY FOURTHWORLD WAR IVIETNAM WARMISSISSIPPIWORLD WAR IILOUISIAN WARTHANKSGIVINGVETERANS DAYCOLUMBUS DAYMEMORIAL DAYJAMES MADISONSTATES RIGHTSNEW YEARS DAYU. S. DIPLOMATWOODROW WILSONLIBERTY ISLANDPRESIDENTS DAYTHOMAS JEFFERSONINDEPENDENCE DAY...

Pluto Word Search 2026-05-01

20 Items: - Saints #9- Mickey's Dog- Sank in 1912- 80' president- Movie Award's- Ziggy Stardust- Mark and Donnie- Boston's NBA team- Taste the rainbow- 1918-1920 Epidemic- To be or not to be?- 80's Wrestling Icon- German-born physicist- Voice of Buzz Lightyear- Robin Williams as a woman?- 'Somebody That I Used to Know'- Lord of the Rings was filmed here...

Quesadilla Team 2026-07-21

14 Items: BeefSourSpicySalsaSweetCheeseOnionsPeppersTortillaSourcreamQuesadillaI am a vegetable. I am green. I look like a little tree. What am I?I am a popular meat. I give you eggs. You can fry me or grill me. What am I?I am a fruit. I am usually red or green. I am crunchy when you bite me. What am I?

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

Opće kretanje stanovništva 2026-03-09

12 Items: znanost o stanovnišvunenaseljeni kontinentpromjena mjesta boravkabroj umrlih na 1000 stanovnikabroj rođenih na 1000 stanovnikakoliko milijardi ljudi živi na Zemljikontinent s najviše stanovnika na Zemljisvakih 10 godina vrši se ... stanovništvaprva država po broju stanovnika u svijetusmanjenje broja stanovnika na nekom području...

Earth Stuff 2023-09-29

14 Items: 23.5∘ N23.5∘ Scauses day and nightcauses seasons and yearsVernal equinox's season is...Summer solstice's season is...winter solstice's season is...Autumnal equinox's is season...Circle surrounding the north poleCircle surrounding the south polethe earth is rotating at one________mphLine of latitude that splits the hemispheres...

Suprotno Word Search 2023-10-25

12 Items: od anđelato se melješalje vojskuju je sfarožićživila je u glibuoganj od cega se bjes bojaookuplanje je u Čađevom dvoruuništava vojsku ohole carevneoleh ban tu je odveo Nevu Nevečicus cime je ribar palunko liovio ribekralj za kojim je bila potraga od strane palunkamali tako ze zove djete od ribara palunka i od zore-djevojke

Organizacijska struktura 2024-01-14

12 Items: Razmjena informacijaSvjesna aktivnost čovjekaPodjela posla, čine je ljudiMjesto susreta ponude i potražnjeKako nešto treba izgledati u budućnostiSve što nam treba da bi nešto proizveliStruktura organizacije prema funkcijamaNačini na koje ljudi koriste oskudne resurseStruktura organizacije određena vrstom posla...

trs23 ver2 u8 2022-10-19

11 Items: a fruitplay a ______ a cakeyummy dessertfood made from milka meal you eat outsideuses fire to make lightspecial day when you get presentshot food made with tomato and cheeseget together with friends and have funfood made by putting something between slices of bread

CRIJEVA STOKE ZA KLANJE 2025-05-25

6 Items: Crijevo u koje se puni krvavicaProizvod punjen u svinjsko slijepo crijevoCrijevo koje povezuje tanko s debelim crijevomNaziv kobasice koja se puni u ovčja tanka crijevaProizvod punjen u svinjsko ili goveđe ravno crijevoCrijevo u kojemu se vrši apsorpcija hranjivih tvari

A Love Story Told in Letters 2026-01-29

19 Items: Be ______I ___ YouRhymes with BugWhere you proposedFavorite restaurantWhite, milk, or darkWill you be my _____?Our anniversary monthHoliday cherub of loveFirst vacation togetherSymbol for hugs & kissesFirst date to the moviesBlanket, basket and foodFirst cat we got TOGETHERHow long will I love you?Romantic planned time outColor associated with love...

Jedem Word Search 2024-09-17

16 Items: komparativ pridjeva zaoprošlo nesvršeno vrijemesuperlativ pridjeva južnineodređeni glagolski oblikzapovjedni glagolski načinpovratno-posvojna zamjenicaimenuju bića, stvari i pojavegenitiv jednine imenice boracvidski par glagola ocjenjivatinominativ množine imenice jastuknominativ množine imenice čovjekglasovna promjena k, g, h u c, z, s...

UBICA LAS PALBRAS QUE SE ESCRIBEN CON C, S O Z 2024-08-21

15 Items: LuzZasMasaTizaCrisisDeshazRizosoCazuelaFusibleRasguñoSazonarDeslizarGrosellaCazadoresSustituir

Naomie Crosswolrd edition 2026-03-10

13 Items: : Crush prime: vu que t’es lele: très impolie même: Toi de time en time: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: camer du côté de tik tok: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

FRUIT and VEGATABLES 2024-11-15

2 Items: ogórekpomidor

p3 u:2 2025-07-02

8 Items: a sour fruitkids favourite gamehome of prehistorical manusualy perform in the watersurfers on the beach love itto measure it you need a clocka numer of fingers in one hendactivity you can do in the mountain

June 2026 Safety 2026-06-16

13 Items: ___________ Action PlanStay low when moving through _______.It is important, for the safety of everyone, that everyone stay ______.Be aware of your surroundings and know the location of your nearest _______.What does the "P" in the acronym "PASS" stand for when using a fire extinguisher?...

Fruit Word Search 2025-12-11

2 Items: hot, tall, different, placeplants, rainy, type, trees, growth

The /s/ sound spelt c before ’i’ and ‘e’. 2025-04-08

10 Items: VoiceCircleCircusCeleryPencilCenturyCentaurPrincessMedicineCelebrate

Aboridžini Word Search 2023-04-26

8 Items: Australski domorodciglavni grad Australijerazvijena grana poljoprivrede (vuna)uz sydney najveća aglomeracija u Australijikontinent s kojeg dolazi najveći udio Australacaruda koja je bila osnova razvoja od sredine 19. st.savezna država u kojoj ima najviše hrvatskih iseljenika...

Erin's B-Day Wordsearch 2025-11-22

8 Items: your stressball(s)your favorite smellfirst system member you met"implement" in our first scenethe best implement *now with sand*the cutest puppy in the whole wide worldthe beautiful natural phenomenon that made us pause frankensteinwhere you found me and comforted me when I was stressed about how staff was going

1.Kh. Word Search 2022-09-08

20 Items: Noer AliAbdul HalimDewi SartikZaenal MustofaKang Ibing (Komedian)Nike Ardila (Penyanyi)Darso (Penyanyi Sunda)H. Uu Rukmana (Budayawan)Mang Udjo (Tokoh Angklung)Mak Eroh (Tokoh Lingkungan)Nano S. (Seniman Karawitan)Harry Roesli (Seniman Musik)Gugum Gumbira (Seniman Tari)Mimi Rasinah (Seniman Topeng)Mang Koko/ Seniman Karawitan)...

Stray kids 2026-01-23

202 Items: UTaEx19DLCFNFTOPBMeAnyWowFamTMTN/SRunYouMess0801ItemEasyWhy?WeGoDoItJjamFateGlow4419Who?Not!RockStop0325ZoneBleepCreedGhostYouthUltraSsickHavenSlumpDLMLUNovelScarsThereGiantNightTTATHChillTasteVenomLeaveAllInMirohBoxerScarsLimboHugMeCloseAlienHappyDriveUnfairSoGoodGetLitCheeseDominoGoLivePhobiaLostMeSaiyanTrumanEscapeCinemaDivineHollowParade3Racha...

Božić Word Search 2024-11-20

14 Items: Dan iza Božića?Što slavimo 25.12.?Gdje se Isus rodio?Sto slavimo na Božić?Dan prije Božića zove se?Vijenac s cetiri svijeće?Najpoznatija Božićna pjesma?Mjesto odakle je Djed Božićnjak?Što Djed Božićnjak donosi djeci?Trava koju stavljamo ispod bora?Kako se zove misa na Badnju večer?Razdoblje od 4 tjedna prije Božića?...

• W O R D S E A R C H • 2025-08-30

12 Items: byeaJforandJARSEarthMEDANKLINIKProjectBirthdaynatureaJREBOISASI

Term 4 Week 8 s as in treasure 2019-12-02

8 Items: massageamnesiasabotageenvisiontreasuercollisionenclosureconclusion

Musical Genres 2024-03-11

15 Items: suiiimade for moviesA sub-genre of piepopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombiamusic made with digital instruments...

Apple Word Search 2026-02-05

2 Items: The red planetFruit on a tree

Chep & Raquel 2025-01-24

21 Items: FakeFakeFakeFakeGroom's first nameBride's middle nameHoneymoon destinationLocation of engagementBride's birthday monthBride's favorite drinkGroom's favorite fruitGroom's birthday monthCouple's favorite pastimeBreed of Groom's first dogBreed of Bride's first dogCouple's anniversary monthCouple met during this eventCouple's favorite pizza store...

Summer 2024-07-31

86 Items: fanhotsuntanbikeboatfinsfireheatjulyjunekitelakepailparkplaypoolrestswimtenttripwarmbeachcabincanoedaisydrivefruitgamesgrasshumidmuggyoceanrelaxsunnytowelvisitwavesaugustdivinggardenhikingpicnicshortssmoressummertraveltshirtvoyageberriescampingfireflyfishingflowersfrisbeeholidaysailingsandalssnorkelswelterthunderbarbecuebarefootbaseballicecream...

Girlfriend Word Search 2025-02-03

20 Items: Our songMy birthdayMy eye colorWhat are we?Dream careerOur first dateFavorite movieOur go to placeSomething i loveMy dream reptileSomething i hateMy favorite fruitMy favorite colorsMy favorite flowerOur anniversary monthFavorite memory of usMy favorite thing to doGolden rubber in these…Favorite thing about youHow long will we stay together

Day of the Dead Spanish Vocabulary 2025-11-10

31 Items: tombmaskarchsaltfoodangelbibleskullcrossaltarwaterfruitflowerscandlesincensemarigoldskeletonofferingdead breadsugar skullsspirit guidespicture/photoflower petalsday of the deadcoffin or casketwhimsical skeletondecorated cut papermonarch butterfliescemetery or graveyardface of day of the deadday of the little angels

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

Spanish Project 2026-05-11

40 Items: teafatmeatfishpeasricebreadbaconlunchsaladfruitapplepizzaonioncerealorangebananagrapescheeseto eatdinnerbuttersausagecookieschickenlettucecarrotsplantainsandwichto drinkthe foodtomatoesspagettipastriesbreakfasthamburgerice creamvegetablesstrawberriesto take a look

Pit stop - Food 2025-09-11

84 Items: HotDogEggTeaSaltSoyaMeatCakeCrabMealCafeKidsSoupBeerWineForkRicePizzaOnionSnackBeansItalyFruitJuiceDrinkWheatBreadSugarHoneySweetWaterOliveLunchKniveSpoonBaconToastGravyCurryPastaSnakeSheepburgerChilliPepperRelishTomatoCheeseBananaDishesHungryPeanutButterCerealAnimalPicnicBarleyDinnerLizardPrunesOrangeCoffeeHaggisLocustToppingSausageKetchupMustard...

Summertime Word Search 2026-03-25

80 Items: hathottansunskidaysbeeslazysandpoolgolfsunnybeachtripsfruitcreambloomgreensweatflopscanoehumidcampsboatsoceanseasonbreezenaturefamilywarmthtraveltennispicnicshellsshortsvibrantrelaxedoutdoorcampingflowerssceneryfriendssunburngogglesbonfirehammocksandalsswimmingbackyardcolorfulcricketsmemoriesbarefootcarefreeswimsuitsunshinecanoeingmosquitotanktops...

FOOD 2025-09-18

10 Items: A long orange vegetable that rabbits love. (C_____)A cold sweet dessert, often eaten in summer. (I_______)A vegetable that can make you cry when you cut it. (O____)Food from animals, for example beef, pork, or chicken. (M____)A hot brown drink that many people have in the morning. (C_____)...

• W O R D S E A R C H • 2024-08-02

12 Items: meintheeajwhenraintourliveworldstoppedjakartafollowing

Word Search 2026-05-12

5 Items: food commonly eaten with cerealbeverage often drank with cerealwhat do people put in their cereal?what do people put their cereal in?what meal is cereal typically eaten for?

Easter 2026-03-24

10 Items: what you put eggs inA cross with Jesus on it.The thing eggs are made of.the things rabbits do to moveanther word for painting eggsThe season easter is celebrated.The holiday celebrated in spring.jelly filled sweets you might finda flower that starts with the letter DThe animal most associated with easter.

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

OSMOSMJERKA - IMUNOLOGIJA 2023-11-23

15 Items: Signal 2Treg staniceCD4 i CD8 stanice"Death by neglect"Drugo ime za T staniceProbir T stanica u timusuMjesto sazrijevanja T stanicaLitička granula koja stvara poreZajednički naziv za sva 3 signalaLigand koji potiče apoptozu stanicaCitokin nužan za proliferaciju T stanicaStanice koje nisu bile u dodiru s antigenom...

Trampolin 5: st. 1 temaord "i naturen" s. 22/26 2025-11-11

12 Items: tiekuujokimerivuorimetsätähtirantapolkutaivasaurinkotunturi, vaara

Food 2024-07-01

86 Items: teacornricemilksaltpearsbaconbananagrapesapplesomeletveightcoffeepepperbutterspinachcarrotspeachesorangesoatmealbiscuitsausagemrsdashcheeriosricechexlemonadetunasaladhamburgerspaghettiwheatrollsidesaladfruit cuppineappletomatosouphousesaladgreenbeanseggnoodlespeachcrispapplesaucefruitjuiceprunejuicegrapejuiceapplejuicehamsandwichhummusplate...

Pathophysiology Word Search 2026-02-15

15 Items: The most common cause of cold soresCaused by the bacterium Mycobacterium leprae.An infection of the dermis and subcutaneous tissueCondition caused by high levels of white blood cells.Chronic inflammation that occurs a response to allergens.A chronic inflammatory skin disorder causing patches of dry skin....

Patnje mladog Werthera 2023-04-01

10 Items: Gdje W. upoznaje Lottu?Tko piše posljednji dio romana?Što je prema W. apsolutna sloboda?Što Albert poklanja W. za rođendan?Kakvi su ljudi prema W. najsretniji?Što W. skicira umjesto Lottine slike?Kako se zove Wertherov najbolji prijatelj?U koje je vrijeme W. počinio samoubojstvo?S kojom osobom W. razgovara samo preko Wilhelma?...

Geneetiliselt muundatud organismid 2024-05-15

10 Items: Mikroorganismidel on lihtne...Kus on nõutud toiduainete märgistamine?Geneetiliselt muundatud organismid on....Mis on geneetiliselt muundatud organismi lühend?Milline geeni haru tegeleb geenide siirdamisega?Kes oli esimene transgeenne loom 1980.aastate algul USA-s?Pärilikkusaine muutmiseks mõjutatakse neid tugevatoimeliste........

School Word Search 2023-03-28

5 Items: The building you are now inThai girl in Korean pop groupThe city where this school isHow many apples make five apples?This colour is the name of a fruit

apirl 2025-04-03

6 Items: PrecipitationThe period of floweringA holiday that occurs on April 25Something pretty that grows and has petalsSweet produce that grows well around this timeA powdery substance that flies around and causes allergies

Peter and Cornelius 2025-12-03

6 Items: I must _____ my tonguePeter spoke to ____ kindlyI must not say bad ______________ -control is a fruit of the SpiritThe ______ Spirit helps us to control ourselvesWho saw a vision and later controlled his tongue

Thankful for OChem - Find 5 for 5! 2024-11-27

9 Items: Anti-oxidant found in cranberriesFamous Amino acid found in turkeyPolysaccharide in mashed potatoesfructose+glucose; found in desserts5-membered heterocycle with one oxygenName of rxn that happens while cooking turkeyApple slices brown when this group polymerizesion that Na replaces to make cheese dip dippier...

Household 2025-02-12

100 Items: BedFanJarMatMopMugPanRugCribDeskDoorIronLampOvenPoufRackSinkSofaVaseYarnBasinBenchBroomChairClockCouchDryerLightPlantPlateQuiltShelfStoolStoveTableTowelXeroxBasketBottleClosetCradleDrawerEggcupFaucetFlowerFridgeGlovesHamperHangerHeaterJuicerKettleLadderLaptopMirrorNapkinPillowRemoteShowerSwitchVacuumWasherWindowZesterBlanketBolsterBookendCabinet...

E2 2026-03-31

100 Items: DYEHOPJOYBOWSEGGSHIDEIRISKITELACELAMBLILYMINTNESTPAWSPINKPLAYSEEKTAILAPRILBLOOMBUNNYCANDYCHICKDAISYFIELDFOUNDGAMESLAUGHMARCHPAINTPANSYPARTYPEEPSRELAXROBINSEEDSSMILESONGSSUGARTULIPBASKETBREEZEBRUNCHCARROTCRAFTSEASTERFAMILYFLUFFYGARDENMEADOWPASTELPETALSPICNICRABBITRADISHSPRINGSPROUTTREATSBLOSSOMCOOKIESEGGHUNTFLOWERSFRIENDSGARLANDGLITTERLADYBUGPASTURE...

Jednorog Word Search 2024-02-07

8 Items: biće koje riga vatruosoba koja mjenja oblik u vukadjevojka koja je spremna za udajukako se zove biće s rogom na čelu?kako nazivamo biće koje ima jedno oko?biće koje ima rogove i predstavlja zlosiše ljudima krv i noću izlazi iz grobabiće koje živi u vodi i ima riblje tijelo (žena)

Freedom 2025-02-12

9 Items: synonym for freedomantonym for freedomthe ability to choosethere is no freedom without _________one of the four freedoms related to securityone of the four freedoms related to expressionone of the four freedoms related to economic needsone of the four freedoms related to belief/religion...

Vocabulary Words 2025-09-13

8 Items: decidestone fruitadvertise and sellleftovers fed to pigsgives birth to a litter of pigletsa plant that grows back every yearto cut meat and package it into pieces for cookingto snack on leaves, twigs, or vegetation growing off the ground

FOOD 2022-08-30

8 Items: A small, round cake or piece of breadAn oval, purple vegetable that is white insideA small round fruit on particular plants and trees.Food which is unhealthy but which is quick and easy to eatA small sea animal which you can eat, and which has a shell and ten legsA small, round, soft red or black fruit with a single hard seed in the middle...

Na putu s Isusom iz Nazareta 2022-04-28

5 Items: ISUSJUDAFARIZEJIGRIJEŠNICIVELIKIPETAK

C Y B E R S E C U R I T Y 2025-02-03

23 Items: spamscamdatatrustalertsafetythreatshieldsecurebreachsystemprivacyhackingmalwaredefensefirewallprotocolpasswordphishingintrusionencryptionauthenticatevulnerability

Když vítr modeluje krajinu 2026-03-27

8 Items: Která část skal se obrušuje nejvíce?Co vítr přenáší kromě prachu a kamínků?Jakým procesem vznikla Pravčická brána?Jaký skalní útvar je dole úzký a nahoře širší?Které horniny se obrušují rychleji než tvrdší?Jak se říká skalnímu útvaru s tvrdší „čepičkou“?Ve kterém prostředí vítr nejčastěji vytváří duny?...

C Y B E R S E C U R I T Y 2025-02-03

23 Items: spamscamdatatrustalertsafetythreatshieldsecurebreachsystemprivacyhackingmalwaredefensefirewallprotocolpasswordphishingintrusionencryptionauthenticatevulnerability

C Y B E R S E C U R I T Y 2025-02-03

23 Items: spamscamdatatrustalertsafetythreatshieldsecurebreachsystemprivacyhackingmalwaredefensefirewallprotocolpasswordphishingintrusionencryptionauthenticatevulnerability

Fall 2025-11-24

20 Items: SPORTFRUITCANDYLEAVES.LEAF COLORON A HOLIDAYKINGS ISLANDON A HOLIDAYGROWN IN FALLSTARTS IN FALLMADE OF APPLESINVOLVES LEAVESCOLOR OF LEAVES.NAME OF A HOLIDAY.STARTING DAY OF FALLAPPLES OR CRANBERRY'SSTARTING MONTH OF FALLHAVE SOMETHING FALLING OFFBOUNCES WHEN RIPE AND FLOATS IN A BOG WHEN RIPE...

Easter 2025-03-30

98 Items: cruzmisanidoPapaEggsfindfishhideLentmassnestPopeporkcerdocestaJesúsvelasblessbunnyCandychickcrossGamesJesuslambsbuscarconejodulcesfloreshuevosjuegosPascuaBasketchainschurchEasterpriestrabbitSpringTulipscadenasiglesiapescadopollitocandlesegghuntflowerslookforbendecircirialesconejitoconejitocorderoscuaresmaescondermariposanarcisosholidaysHolyWeek...

random words\ 2025-12-30

102 Items: 67cathotpottopartdogboybigfamcatbadcupdierotmanps5owlwifelifetreecookbirdsnowballgirllovehopeloudlikebikebitekiteminemainplanclamlambgoattacogaotfoodgoodtallbookwakedeadleapipadballtreeswiftmusicdrumsradiobeetsbeatschiefbirdsflakekittydoggywordspeacesmallfightmightplanepizzashortalivedeathtablebrainrobotaddiesantapapertayloranimalfriendwordlecounty...

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

Anime Shows 2022-11-21

57 Items: manendnotetailmoontaxiballcharaouranstonejojospieceeatergeassmaidennarutobleachknightyugiohbutlererasedrezerobasketperiodslayerkaisenclovertrigunaoashimagicapersonaat workhaikyuudurararaexorcistinuyashahellsingparasyteon titanbeastarsx hunterof kingschamploooverlordx familyneverlandof healerpunch manrevengersmegaloboxart onlinestray dogspsycho 100...

August 2025-01-12

100 Items: JoyMapFillFlowGlowGrowHoldOpenPathPlanAlignAwareBeginBloomFieldHeartLearnLightListsPausePeaceQuietReadyShareShineSpaceSparkAutumnBasketBrightCenterExpandForestGatherGiftedGoldenMeadowMomentNaturePoetryRecordSacredSeasonSummerWealthArrangeBlessedCaptureClarityCollectComfortCompassConnectContainEmbraceEveningExploreHarvestHorizonImagineInspireJourney...