fourth of july Word Searches

Of Mice and Men vocab 2024-02-23

25 Items: deep respectanxiety or fearmocking laughterappease or softenlook at thoughtfullyflattering to pleasedisappointed and sadrepetitious and dulldeserving condemnationsullen and ill-temperedquick to argue or fightdisrespectful, demeaninggreat sorrow or distressunexpected words or actionsindication of a future eventunfriendly, cool, or distant...

They're from Australia! 2025-10-12

18 Items: Месяц №1Месяц №2Месяц №3Месяц №4Месяц №5Страна №1Страна №2Страна №3Страна №4Страна №5Страна №6Страна №7Страна №8Местоимение №1Местоимение №2Местоимение №3Местоимение №4Местоимение №5

Respect and Understanding in a Diverse Society 2025-06-10

10 Items: of lawRightsRespectEqualityDemocracyToleranceCommunityInclusionPrejudiceResponsibility

hanukkah 2025-12-16

10 Items: oillightjudahlatkesmenorahdraidlehanukiahof davidmaccabeesufganiot

Jesus Word Search 2026-01-27

10 Items: loveknowJesuscannotpeopleof Mananotherdisciplesglorifiedcommandment

Aztec and Mayan 2024-11-12

15 Items: SunJadeLionSpainOlmecEmpireCortesJaguarTributeof LifeSerpentFlowersMontezumaCivilizationHieroglyphics

Relay Word Search 2025-06-05

15 Items: lapropelineteamracerelaycheerbatontrackcrowdsprintmedalswinnersneakerstug-of-war

Exersice 2025-06-19

15 Items: roomNeatyardFiftyDirtyMessyBesideBrightTwentyThirtyBetweenfront ofRestroomClassroomCafetaria

WORDSEARCH 2025-07-24

16 Items: mandayVowsKisscakeRingsForeverFlowersProposalMarriageSpeechesCeremonyof honorHoneymoonChampagneReception

Day of the dead 2026-01-17

15 Items: AltarcandyMexicoParadeCandlesSpiritsmariachiMemoriesAlebrijeCemeteryFacepaintSkeletonsRemembranceof the deadCempasuchil

Departmentstore Word Search 2025-06-29

14 Items: A field where corn is grown.A place where people go to eat meals.Having existed for a long time; not new.A piece of land planted with fruit trees.A place where films are shown on a large screen.Not existing before; recently made or discovered.A building offering lodging and other services to travelers....

Good Laboratory Practice 2024-05-20

20 Items: The G in GLPThe L in GLPThe P in GLPThe L in ALCOAThe C in ALCOAThe O in ALCOAYear GLPs proposedYear GLPs finalizedThe first A in ALCOAThe second A in ALCOAYear GLPs written into lawSingle point of control for a studyDescribes how a task is done on a studyCurrent Summary of training and experienceFormed because safety of animals used was at risk...

Liana & Geffrey 2025-03-12

27 Items: groom's hometownBride's last namegroom's dream carbride's dream doggroom's birth placebride's birth placeWhere the couple metHoneymoon destinationgroom's favorite colorthe bride's birth monthcouple's favorite hobbythe chore the groom doeswho said I love you firstWhere the couple got engagedthe month the groom proposedcut of bride's engagement ring...

Year 7: Term 4 Week 4 2025-10-30

20 Items: A push or a pull. (5)The act of moving. (6)Change in speed over time. (12)Rise and fall of ocean water. (5)Day and night are equal length. (7)Orbits a planet, like the Moon. (9)A icy rock with a glowing tail. (5)How much matter is in an object. (4)Pulls everything toward the Earth. (7)Spring, summer, autumn, or winter. (6)...

word search 2026-01-22

30 Items: / Jack's age/ Gizmo's breed/ The brides name/ The grooms name/ Live, ____, Love/ ___ is in the air/ Fashionably _____/ Sheri & Jack's car/ In Sheri's bouquet/ ___ for joining us/ Something you throw/ Number of groomsmen/ The county you are in/ An awkward first ____/ Cheers to Mr & Mrs ___/ The best genre of music/ A Best Man's first name...

Condo/Condo LP 2024-02-12

10 Items: Name of the insured on an HOA policy.Name of the insured on an HO6 policy.When a Condo is missing either an HOA or HO6 policy.When a Condo has is missing both an HOA and HO6 policy.Name of the policy we need for the interior of the Condo.Name of the form that is typically used for HOA policies....

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Alliteration Word Search 2025-02-05

9 Items: The general or literal meaning of a word.A subtle difference in a shade or meaning, expression, or sound.The repetition of speech sounds in the beginning of nearby words.Taking words in their usual or most basic sense without metaphor or allegoryA group of words not containing a subject and a predicate(e.g, running in the rain)...

Famous Brands 2024-03-15

25 Items: "Just do it."Makers of the CorvetteThe main competitor of Coca-ColaScandinavian building block brandThe world's most-used search engineCreators of MS-DOS operating systemCoffee chain with a green siren logoCompany with a doughboy for a mascotstore chain owned by the Walton familyKnown for their animated musical films...

Ambitious Story Vocabulary 2025-06-26

22 Items: Gloomy, sullen, or downheartedUnconventional, quirky, or oddFragile, easily broken or crackedSuffering from illness or frailtyFull of clever tricks or strategiesContinuing to try despite difficultiesSecret or hidden, not openly displayedLasting for a very short time, ephemeralWorn and torn, especially from age or use...

Searching Tone and Mood 2023-01-31

6 Items: Finding faultBeing cheerfulThe state of being doubtfulHaving the character of SarcasmIt is not being in the company of othersExhibit strong emotion as a result of pain

Industrial Revolution Word Search 2023-07-27

16 Items: jethro tull's stellar inventionjoseph foljambe helps farmers outa noun denoting a period of big changea problem with industrial revolution citiesa problem with industrial revolution citiesperson who introduced the dutch four-field systemsomething workers didn't really have at this timethis machine could work eight bolts of thread at once...

Scarcity Word Search 2025-01-16

15 Items: A tax imposed on imported goods.A plan for managing income and expenses.The action of buying and selling goods and services.The amount by which expenses exceed income or revenue.The financial assets used to produce goods and services.The financial gain obtained when revenue exceeds expenses....

ICP Vocab 4 2025-02-26

16 Items: The ability to cause changeenergy, Energy due to motionIs force applied through a distanceThe rate at which energy is convertedThe ratio of output work to input workadvantage, The ratio of output force to input forceIs anything around which you can imagine a boundarypotential energy, Energy that is due to chemical bonds...

Page 10 vocabulary 2025-03-05

15 Items: Related to the whole world.Doing something suddenly, without planning.Ideas about what will happen in the future.A serious talk or discussion about a topic.Easy to understand or see through; open and honest.The belief that good things will happen in the future.A way of thinking about something or seeing a situation....

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Bhil Word Search 2023-05-31

20 Items: Bhil art follows this art style.A Bhil God, who has only one leg.Bhil tribe believes in this tiger ancestor.Dialect in which Bhils talk is called _______.The main staple food of Bhils is_______________.Dance-Drama of the Bhils is called_____________.Wall paintings of Bhils in Udaipur are known by this name....

Spanish Man 2023-02-10

32 Items: ofmytheflagdeskdoorhereyourmouseclocktablechairtherein/onposterscreenwindowbehindwhere?it's acomputerbackpackkeyboardtrash canon top ofunderneathin front ofsome, a fewWhat is this?next to,besidepencil sharpenerThere is, There are

CAFFEINE AND CANINES 10/20/2023 2023-10-20

31 Items: RetrieveA dogs kneeA dogs ankleA dogs “fangs”Most famous dogThe third eyelidA pattern of footstepsMy coonhound mix’s namemost popular male dog nameMy senior Yorkie dogs nameBroad head with short muzzlenarrow head with long muzzleMost popular female dog nameMy blonde shepherd dogs nameMy white and Brown dogs nameMy brindle pit bull dogs name...

Shemot 6.0 2026-01-11

34 Items: His name is _____ ?He also hid his ______.Shemot means _________.Moses escapes to _______.Moses is from which tribe?Moses kills an _________ .“Thus is My name _______. “Who is coming to meet Moses?The mountain of G~d is _____.The Israelites became ________.The gematria of the letter Chet.He names his first son _______ ....

Motion Word Search 2026-02-17

30 Items: liquid to gasliquid to solidsolid to liquidWater at 100 degrees C.The name of our galaxy.Measures kinetic energy.Distance divided by time.Atoms move independently.The ability to perform work.A change in position over time.Described the force of gravity.How much matter an object possess.The force you use to move your body....

Medicare 2024-06-07

17 Items: otcGapgymdoctordentalvisionco-payhearinghospitalmedicareemergencyambulanceOf Pocketspecialistdeductibleprescriptionpreventativecare

science lab scramble 0.0o2 2024-12-15

17 Items: tinh2ozincgoldironbonusbeakercoppercarbonsciencechemicaltitaniumaluminumantimonygraphiteplutoniumevaporation

Spies Word Search 2025-09-10

17 Items: ANAKSPIESRIVERJUDAHCALEBNEGEVMOSESAARONJOSHUAGIANTSYAHWEHCANAANGRAPESEPHRAIMOF ISRAELISRAELITESPOMEGRANATES

Wedding Wordsearch 2025-10-29

17 Items: domanVeilVowsBrideGroomRingsAisleAltarGuestsBouquetProposalof honorHoneymoonReceptionBridesmaidEngagement

Government Word Search 2026-02-09

18 Items: lawvotebillvetotaxessenatecollegeimpeachcabinetjudicialexecutivepresidentpresidentdiplomatsof rightslegislativeconstitutionof representatives

McKenna's Word search 2023-12-18

8 Items: the study of the movementsA constellation in the skySomeone that travels to spacethe time or date twice a yearssmaller virgin of the big dippera group of stars forming a patternA ball that is made up of ice and gasscience that deals with celestial objects

AP LANG VOCAB 2025-09-17

27 Items: – severely critical– intervene with something– a security guard or watcher– being everywhere all of the time– something causing misery or death– to provoke or incite somebody into action– of, characteristic of, or resembling a lion– marked by doubt, uncertainty, or skepticism– to indicate something by action or implication...

C social vocab 2024-01-11

18 Items: daopeitydaoismcensorfarmerworlordancestorlegalismcurrencyideographof heavenaristocratpictographbureacracyhereditaryacupunctureconfucianismcivilservice

Gobi Search 2023-04-11

7 Items: Gobi’s ownerThe dog that went missingA foot race longer then a normal marathoncountry of eastern Asia bordering on the Pacifica city in and the capital of Scotland, in the SE part: administrative center of the Lothian region.contests to determine which of the competitors is able to run a certain distance in the shortest time....

SHAKESPEARE 2025-03-16

19 Items: HAMLETPLAGUEHAMNETOTHELLOMACBETHSONNETSKING LEARCYMBELINECORIOLANUSTHE TEMPESTRICHARD IIIGLOBE THEATREJULIUS CAESARANNE HATHAWAYAS YOU LIKE ITROMEO AND JULIETCOMEDY OF ERRORSMERCHANT OF VENICEMEASURE FOR MEASURE

Escape from Mr. Lemoncello's Library Vocabulary 2025-03-17

55 Items: oldequalto rushforbiddenpunishmentmysteriousto figure outto take turnsto throw awayto crash intorefuse to obeyA central roomjudge's hammerto think aboutto leave behindno longer in useto steer or directa noisy disturbanceto pronounce clearlyvery great in degreethe study of animalsA secure room; a safeto settle differenceselegant and fashionable...

Ch. 8 Executive Branch 2025-10-17

12 Items: Secret.Expressed will of the people.To postpone legal punishment.A release from legal punishment.Rules that have the force of law.To delibrately disclose information.To exist in fact rather than legally.Group of advisors that help the president.Official vote for president and vice-president.Appointment of a supporter to political office....

Community Word Search 2026-02-13

11 Items: Short for Return-Demonstration; the mastery check forFace-to-face contact with the family in their residence.The specific setting of our 3rd-day community immersion.The ongoing evaluation of nursing care and interventions.The method by which the nurse provides care using the PHN bag.The process of imparting knowledge to improve health literacy....

Peeta Word Search 2025-12-11

40 Items: the drunk guyto or at a distancestare angrily or sullenlyVolunteered for her sisterthat peeta gave to katnissskillfully, quickly, and neatlyvigor and spirit or enthusiasm.a false show, a make-believe actsaying the opposite of what you meanThe one that got reaped in district 12a quality that evokes pity or sadness....

Unit 109 Bar Service 2026-01-26

43 Items: ..................................... - Uses 50ml legal measure...................................... - A spirit made with grapes.Malted ..................................... - Ingredient in beer...................................... - Uses 25/35ml legal measure...................................... - Type of Non-alcoholic beverage....

First Great Story Word Search 2022-11-10

12 Items: Rockcrustorbitmattergravityexpandedmeteoriteof thingsparticlesshockwavesevaporationcondensation

5TH BASKETBALL 2025-10-16

12 Items: NBAMVPFIVECAKEPLAYAESONPARTYGIFTSTIMESSPORTSOF FAMEBASKETBALL

Coating Vocabulary 2025-06-17

28 Items: License Plate Number.A flaw or imperfection in a product.Cutting a wide web into narrower rolls.Material that is discarded during production.Bonding two or more layers of material together.Periods when equipment is operating and productive.Applying a liquid or semi-liquid material to a substrate's surface....

Mesopotamia, Egypt and Indus 2025-09-08

38 Items: wheelfarmingGeometryA seasonal wind.Belief in many godsEgyptian writing systemThe river changed coursefell It was hard to defendHow people meet their needs.In Indus the way the cities werethe world's first system of writingwell planned cities, indoor plumbingking who United upper and lower EgyptA ruler of ancient Egypt seen as a god...

Vietnam Word Search 2025-12-10

23 Items: Capital city in North Vietnam.The Vietnamese lunar New Year.People killed in a conflict or event.Freedom from disturbance; tranquility.Capital city in South Vietnam and was renamed in 1976.Old name for Vietnam when it was a French colonial territory.A person who has been captured and imprisoned by the enemy in war....

the summer i turned pretty ★ 2025-08-20

10 Items: boys’ motherconrad’s brotherseason of the yearserie’s protagonistbeach they used to goprotagonist’s brotherfirst name of the book’s authormilo’s ex and steven’s girlfriendthe most perfect and cute guy everbrothers that are owners of the beach house

Week 13 Word Search 2025-10-31

10 Items: ImpressiveLonely; solitaryDrove from hidingFood for domestic animalsStrange device or machineAllowing some light throughOutbreak of a contagious diseaseCondition of having to die eventuallyHaving the effect of restoring confidenceGetting little rain, and therefore very dry

God With Us 2025-12-17

20 Items: ImmanuelGod With UsJesus' MotherBetrothed to MaryAngel of the ____The Arrival of Jesusold word for "engaged"What Jesus saves us fromwhat the Angel told Joseph"Joseph, being a ____ man"How the Angel spoke to JosephBrought Joseph a word from Godthe baby born to save the worldWho's preaching today's sermon?an Old Testament messenger of God...

Day 2 Organizational Behaviour End-of-Class Review 2024-08-26

32 Items: According to psychology, this can be _____.People will behave _____ with how they are perceived.This is a popular personality type test or framework.Errors in attribution are also called distortions or _____.Perception affects _____ made by the individual, and the group.This is based on perception of what reality is, not reality itself....

Psychoactivedrugs Word Search 2026-02-09

35 Items: known for being relaxinggives an incredible sense of euphoria, highly addictivecatagorized by slurred speech, clumsy movements, and a bad recovery timethe diminishing effect of a psychoactive drug resulting from repeated usedepressant and opiate tha rushes euphoria after pain relief and relaxation...

FLECT/FLEX roots 2026-02-02

8 Items: Bending aroundA muscle for bendingFull of bends and curves; windingNot capable of being bent or moved/changedThe rise and fall and emphasis of the voiceto turn back and forth in the mind, think back onto bend or repel away (as to prevent something from harming)The act of bending on one knee, as a sign of devotion and respect

Cell Signaling Vocab 2026-01-07

11 Items: "Within the cell"Adding a phosphate group to a moleculeEnzyme that transfers phosphate groups to proteinsAbbreviated version of "G Protein-coupled receptors"An event that occurs late or later in a chain of eventsAny molecule that binds to the binding site of a receptorAn event that occurs early or earlier in a chain of events...

Cells 2025-01-17

13 Items: Cell deathHow cells reproduceA type of cell divisionA problem in the DNA of a cellThe control center of the cellThe smallest unit of living thingsA disease caused by a cell mutationThe variable we change in an experimentThe variable we measure in an experimentA prediction on the results on an experimentInstructions/code for all processes and cells...

Viaflex 2024-04-15

24 Items: Row mulchThe work of CLIOil field in TexasAssigned to internsRuns the machine linesWearing protective gearA method of making filmOne of the Viaflex Valuesone of the Viaflex visionsProtecting cables undergroundIt tests products for qualityResponsible for bringing in revenueTemporary employees during the summerKey ingredient in the Viaflex products...

Year 3 Term 2 Wk 2 Homework 2024-05-05

24 Items: DramaAn accidenta situation4 letter wordjoyful emotionsomething organisedPrecious to someone1st Month of the yearto won of give somethingorganising something nowOut in the bush on holidaysa crunchy red or green fruitEarth, Mars, Jupiter are theseTo get from one place to anotherA place where you go to get moneyNot perfect or excellent just.......

TECHNOLOGIES 2025-04-17

27 Items: = Writing code for computers= Portable personal computer= Organized collection of data= System for tracking location= Wireless internet connection= Online space for storing data= Remote-controlled flying device= Collection of related web pagesreality = Simulated 3D environment= Set of instructions for a computer= Protection against digital attacks...

Voca 8000 Lesson 2 2025-05-21

20 Items: at firstdelirious, intoxicatedwith roughness or violencea person who breaks the lawthe solid base of somethingskillful in using your handswhat is important to someonegreater in amount; importantin a way accessible to the publictelling the truth; honest or sincerenot capable; impossible doing somethingto make goods; to create; to manufacture...

Words with prefix inter- 2025-10-08

22 Items: to go intomiddle levelbetween citiesthe week's prefixto interrupt loudlywhere things interactmis-spelling of inter-preposition used when enteringa type of phone inside buildingsto stop something while it's movingabout many countries beyond your ownthe original, central part of a worda bit that comes at the end of a word...

Unit 2 Vocab 2025-10-14

41 Items: badgooda peta cata doga liea liontowardsthe zooa sharka zebraa tigera llamaa whaleyou area monkeya turtleit bitesobedienta serpenta giraffethe truths/he comesboogie mana polar bearhe/she grabss/he/it eatsgo to sleep!to disciplineI watch; look ata donkey-unicornde I have fear ofwe watch; look atthey have fear ofhe/she goes to...you watch; look at...

Edpuzzle 2024-02-22

6 Items: # of theatresmovie and playFamous theatreOver 12000 performances2nd part of wizard of ozShow about people auditioning

Mia. L Astronomy Word Search 2023-12-18

8 Items: looks like the dig spoonlooks like a small spoonshortest days of the yearThe belief of constellationsa celestial made out of ice and dusta system of million or billion starsScience test that deals with space and universeperson who is trained to travel in a spacecraft

1)Crest Word Search 2022-11-28

8 Items: highest part of a transverse waveThe wavelength measuerd in metersis the distance of one complete wave cycleIs the measurement of maximum displacementor the number of waves or vibrations produced per secondwave that moves the medium perpendicular to the wave motion6)in a longitudinal wave, areas of maximum displacement are known as?...

Psychology Sampling 2025-09-30

8 Items: The population a researcher wishes to studyRandom sampling requires this selection methodThe extent to which findings accurately represent a populationThe extent to which findings apply to the rest of the populationA method of sampling where participants choose to participant in a study...

president 2023-03-27

20 Items: potuspowerpolicynationpubliccapitolcongressauthorityexecutivecommanderstatesmandiplomacycommanderdemocracyleadershipwhitehousegovernancehead-of-stateadministrationcommander-in-chief

ELA Word Search 2025-05-28

20 Items: MoodPlotIdiomThemeSimileClimaxactionactionof viewImageryMetaphorConflictlanguageHyperboleExpositionResolutionAlliterationOnomatopoeiaForeshadowingPersonification

KARAPATANG PANTAO 2026-02-11

20 Items: UDHRPANTAOAKUSADOSTATUTORYPOLITIKALMAGNACARTAHENRYDUNANTBILLOFRIGHTSKINGLOUISXVINATURALRIGHTSCYRUSCYLINDERCONSTITUTIONALUSCONSTITUTIONOF INDEPENDENCETHOMASJEFFERSONKARAPATANGSIBILSOSYO-EKONOMIKSGENEVACONVENTIONELEANORROOSEVELTPETISYONNGKARAPATAN

Biology Vocab 2 2024-08-22

12 Items: Monomer that makes up proteinsSpecific reactant acted on by an enzymeA simple sugar that is the monomer of a carbohydrateSpecialized proteins that speed up chemical reactionsLarge compound formed by combining many monomers togetherA substance that speeds up the rate of a chemical reaction...

Czech Word Search 2024-05-05

16 Items: ofopystombssevenmagicvltavaunescolargeststatuescreatedrepublicconnectsmedievalinstalledpreservedrenaissance

Biology S1 Exam Review 2024-12-11

31 Items: water lovingself feederssplitting wateradding phosphatesplitting glucoseenzyme that makes ATPaffinity for electronsmore stiff fatty acidsreaction releases energyorganelle that holds DNAcycle with Acetyl CoA inputtransport that requires energybreaking down larger moleculesNADH and FADH2 are electron...organelle that synthesizes proteins...

HYDROPONICS 2025-04-03

20 Items: A method of growing plants without soilA substance added to plants to improve growthThe process of a seed developing into a plantUsing minimal resources to achieve maximum outputSupplying water to plants through artificial meansYoung vegetable greens harvested at an early stageA system where plant roots are misted with nutrients...

Chemistry of Life 2013-12-05

19 Items: pHacidlipidcarbonoxygensulfurelementproteinnucleicglucosepolymermonomerenzymeshydrogennitrogenphosphorustemperaturecarbohydratemacromolecule

feast of fifty 2016-11-03

19 Items: forceguardsparkargueguitaruproaraffordscorchcarpetOregonaboardseminarforwardenlargemorningbarnyardpredatorforecastcharcoal

feast of fifty 2016-11-03

19 Items: forceguardsparkargueguitaruproaraffordscorchcarpetOregonaboardseminarforwardenlargemorningbarnyardpredatorforecastcharcoal

feast of fifty 2016-11-03

19 Items: forceguardsparkargueguitaruproaraffordscorchcarpetOregonaboardseminarforwardenlargemorningbarnyardpredatorforecastcharcoal

Principles of Government 2017-04-21

19 Items: PollsSystemPowersBranchGlobalVotingSenateRightsFederalCitizenJudicialCongressExecutiveSeparationParliamentLegislativeCitizenshipRepresentativesResponsibilities

Principles of Government 2017-04-21

19 Items: PollsSystemPowersBranchGlobalVotingSenateRightsFederalCitizenJudicialCongressExecutiveSeparationParliamentLegislativeCitizenshipRepresentativesResponsibilities

City of Ember 2021-04-19

19 Items: linaorlyboatemberpoppyclarymurdomayornammyriverlooperlizzievindiegrannyfleerycandlelightspipeworksmessenger

shades of blue 2022-08-14

19 Items: skynavybabyroyallapisdenimspaceoceanslateazurecobaltarcticicebergolympicceruleansapphireegyptianelectriccornflower

Names of 5B 2022-08-22

19 Items: jtkaibenwrenjackrhysesmeowenezrajamestylerchaseconnorsydneybrynleemadelinecourtneyvictoriagenevieve

Parts of Speech 2024-03-28

20 Items: nounverbcommaessayrhymepluralperiodindentadverbindentsubjectliteralsingularsentencefragmentadjectiveparagraphfigurativepunctuationconjunction

Heir of Fire 2024-04-22

19 Items: valgmaevenarrokabraxossorschawendlynwyvernswyrdkeysfleetfootelidelochanskinwalkersthethirteenarobynnhamelchaolwestfallaedionashryvermanonblackbeakrowanwhitethornaelingalathyniusdorianhavilliard

Words of Affirmation 2025-02-05

19 Items: BRAVEFUNNYSMARTCARINGCLEVERLEADERLOVINGSTRONGCREATIVEFRIENDLYGENEROUSPOSITIVERELIABLEVALUABLECONFIDENTRESILIENTWONDERFULIMAGINATIVEINDEPENDENT

Topic of Sustainability 2025-03-05

19 Items: HabitatClimateLandfillEmissionsPollutionRecyclingRenewableResourcesUpcyclingEcosystemGreenhouseEnvironmentEcofriendlyConservationBiodiversityDeforestationBiodegradableReforestationSustainability

League of Nations 2025-11-06

19 Items: UKwwiwwiiwarsweakitalyjapanfailsWilsonpointsgenevafranceleaguestrongnationssuccesshelpfulworldwideprevention

Effects of imperialism  2014-11-03

20 Items: newrulecashcropscropspowerglobalchangescultureeconomyEuropeanresistedculturalimperialeducationinfluencesimperialisttraditionalnationalistindustrialized

Branches of Government 2015-03-11

19 Items: taxestreatySenateCongressjudicialTheHouseJusticesdiplomacyPresidentexecutiveUSCapitolfederalismWhiteHouselegislativeSupremeCourtUnitedNationsCabinetmembersRepresentativesinternationallaws

Properties of matter 2017-10-16

19 Items: gasrustburnmassdullcolorsolidlusterliquidvolumedensitytexturebrittlehardnessreactivemagneticmalleableappearanceconductive

Kinds of Potatos 2021-02-28

19 Items: doreRatteLaurasaladgundaBintjemelodytajfunparelmremarkaKennebecVitelotteYukon-GoldKerrs-pinkKing-Edwardduke-of-yorkrusset-burbanksolanum-tuberosumopperdoezer-ronde

Class of 2023 2023-05-05

19 Items: teahallyannaashiamollykyleelaurabrookekayleecarleyjasmynlindeekamrynpaytonjessicarebekahcourtneyannalisekatherine

League of Legends 2024-08-28

19 Items: LuxZedAhriJinxJhinAsheYasuoTeemoGarenRivenAkaliEzrealThreshAatroxSorakaDariusLeeSinKatarinaFiddlesticks

TYPES OF DRINKS 2024-10-25

19 Items: TEAHOTMILKSOURICEDSODACOLADIETPEPSICOCOAWATERTASTYCHERRYCOFFEEHERBALSEVENUPVANILLALEMONADESTRAWBERRY

Parts of Computer 2025-05-30

20 Items: UnitCordDriveMouseDriveSupplyReaderCameraMonitorPrinterKeyboardSpeakersProjectorDisk DriveDisc DriveHard DriveHeadphonesMotherboardAccess MemoryImage Scanner

Cities Of Pakistan 2025-06-08

19 Items: KasurOkaraQuettaJhelumMardanAttockMultanGwadarKarachiChiniotSialkotSargodhaPeshawarNawabshahShikarpurJacobabadAbbottabadBahawalpurRahimYarKhan

Streets Of YSWE 2025-07-11

19 Items: JaneKingJohnKeeleEmmettChurchRusticGoldwinStclairWoolnerLambtonWestonrdLawrenceEglintonAllianceMapleleafRosemountScarlettrdBlackcreek