fourth of july Word Searches

Asteroid Word Search 2026-01-20

36 Items: Audible heard or perceptible by the earAudio a transmitted signal you can hearBiodegradable capable of being decomposedBiotic of or relating to living organismsAudiovisual involving both hearing and seeingAudition a test of the suitability of a performerAuditory of or relating to the process of hearing...

Earth's Spheres and Earth's Layers 2026-01-20

21 Items: the gas we breathe inthe gas we breathe outall living organisms on Earththe thin outermost layer of Earthmolten rock within Earth's mantlethe layer of gases surrounding Earthweathered rock that supports plant lifethe liquid metal layer of iron and nickelthe solid hottest innermost layer of Earthdogs, humans, fish, and birds are all ____....

Guitar Word Search 2025-06-30

7 Items: LakeJulyBibleGuitarJoyfulPepperPinterest

bible 2025-11-18

20 Items: ruthpaulhagarrahabpetermiriamjosephpatirckdymphnaradegundphilomenaJoan of arccarlo acutisDominic savioPedro calugsodmary of nazarethfracis of assisihidegard of bingenElizabeth Ann setoncatherine of alexandria

Light - Reflection and Refraction 2025-04-22

31 Items: light-rayreal-imagefocal-pointconvex-lensray-diagramfocal-lengthincident-raylens-formulaconcave-lensstraight-linevirtual-imageconvex-mirrorreflected-rayrefracted-raypower-of-lensconcave-mirrorprincipal-axismirror-formulaoptical-centerimage-formationprincipal-focussign-conventionspherical-mirrorrefractive-indexlateral-inversionangle-of-incidence...

Important Word Search 2025-11-10

25 Items: MayMoonWolfMeltWormSnowJuneJulyshineTrailShapeNorthMarchAprilNativeSpecialHarvestQuarterJanuaryFebruaryNovemberDecemberImportantStrawberrySeptember October

Onomatopoeia Word Search 2025-09-29

20 Items: An example of blendingCompounding break+fastAn example of compoundingAn example of foreclippingShortening the end of a wordStudy of the meaning of wordsTaking words from another languageA word borrowed from India (Hindi)Words that imitate sounds are calledCombining two words to make a new oneUsing part of a word to form a new one...

Fatui Word Search 2025-04-09

16 Items: PierroDottoreSignoraCapitanoSandroneTsaritsaTartagliaPantaloneColumbinaArlecchinoPulcinellaScaramoucheReal name of DottoreReal name of CapitanoReal name of TartagliaReal name of Arlecchino

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...

Mrs. McInroe's Fourth Grade Homeroom 2025-08-10

16 Items: iandrueellalaceywyatttessapaxtonellanilizzetaliviaparkerbarrettdesmondmadisyngabrielmichelle

the fourth stall 2023-05-17

8 Items: mactestcameratrixieschoolkjelsonbathroomdetention

The fourth stall 2023-05-17

8 Items: mactesttrixiecameraschoolkjelsonbathroomdetention

Valentine's Game 2026-02-08

8 Items: My first gift to youFavorite Dating PlaceWe played it at TagpuanMonth when we became officialPlace of second Valentines DateMonth when you asked to court mePlace of our first Valentine's DateThe day when you replied to my story

Basic EKG Terms 2025-07-08

19 Items: irregular heart rhythmtop chambers of the heartthe pacemaker of the heartbottom chambers of the heartheart rate of less than 60 bpmpertaining to the heart muscledemonstrates contraction of atriaheart rate of greater than 100 bpmatria quiver; high risk for strokeHeart is located on right side of chestmarks to evaluate size of cardiac complexes...

Grandma's Birthday- Find the words to unlock your birthday surprise 2025-06-07

15 Items: After the factFour minus oneStay a short timeThe opposite of sadAn annual celebrationA place to come and goThe country Lauren livesA mode of transportationThe state in which you liveA device to carry belongingsThe seventh month of the yearA traditional game that involves diceThe absolute best feeling in the world...

First Form Lesson Thirty-one 2025-09-24

12 Items: 3rd prin. part of timeo3rd prin. part of valeo3rd prin. part of doceo3rd prin. part of teneo3rd prin. part of ardeo3rd prin. part of jubeo3rd prin. part of maneo4th prin. part of doceo4th prin. part of teneo4th prin. part of ardeo4th prin. part of jubeo4th prin. part of mansus

Create your ideal setlist with the first 8 songs you see 2025-12-04

27 Items: IfIRunGrowHomeOhNoJulyAloneShameJosieAdoreCoverLetGoCologneAspirinCryBabyLavenderComeBackHurricaneIfIdKnownToBeAloneHoldingOnBrownEyesUpAtNightBreatheOutWannaBeYouLoveInTheDarkSaturdayMourning

Government 2025-10-23

16 Items: lawsmayorrightsjudicialgovernorof rightof powercongressexecutivepresidentpresidentcompromiselegislativeconstitutionresponsibilityof representitives

Seasons, Months and Colours 2019-10-01

27 Items: mayredjunejulypinkgreybluemarchaprilwhitegreenblackbrownspringsummerautumnwinteraugustyellowpurpleorangejanuaryoctoberfebruarynovemberdecemberseptember

January Word Search 2023-11-19

27 Items: mytenageonetwohowyounamefivejunejulyninegoodpuppymarchthreeaprilsevenkittenaugustjanuaryoctoberbirthdayfebruarydecembernovemberseptember

Names 2025-09-28

27 Items: MAYRAINJUNEJULYMARCHAPRILAUGUSTJANUARYFLOWERSOCTOBERFEBRUARYNOVEMBERDECEMBERFIREWORKSSEPTEMBERHALLOWEENCHRISTMASTHANKSGIVINGMOMSBIRTHDAYVALENTINESDAYSTPATRICKSDAYADAMSBIRTHDAYALEXSBIRTHDAYALEXKSBIRTHDAYSUMMERVACATIONTAYLORSBIRTHDAYKATELYNSBIRTHDAY

Love Word Search 2025-11-10

27 Items: MayLoveKissHugsDateJuneJulyOkraCakeKatyTrustHeartLemonCrumblSevensDonutsForeverPartnerRomancePassionPromiseCatfishTownInnLaughterTogetherSoulmateMemories

banana 2025-11-14

27 Items: sunMaynoonmoonJuneJulynightlunchMarchAprildinnerMondayFridaySundayAugustmorningTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbreakfastWednesdaySeptember

LS-4-1 Unit 3 Lessons 1-3 Evolution and Natural Selection 2023-10-24

19 Items: early pre-birth stage of development.total DNA present in the nucleus of each cellheredity changes in groups of living organisms over timeanything that has or once had the characteristics of lifecarbon compound joined by peptide bonds; building block of proteingroups of individuals of the same species that live in the same area...

Gingivitis Word Search 2025-10-01

25 Items: An area of pathology.The study of disease.Medical term for a bruise.Inflammation of the tongue.Inflammation of the gingival tissue.Malignant tumor in epithelial tissueReferring to the area below the gingiva.Referring to the area above the gingiva.Closed cell or pouch with a definite wall.Malignant disorder of the lymphoid tissue....

Christmas Words # 2 2024-03-04

40 Items: joyonespinelovespellaromatreestreesClausseasonheartsmelodywarmthlightssmilesseasonlightsgivingsmilesessencefestivemagicalcinnamonfamiliesornamentserenitymemorieschristmasof givingmerrimentnostalgiaaffectionsnowflakesgracefullytraditionsenchantmentof Memoriesof nostalgiaof affectionof traditions

National Bison Month Word Search 2025-07-14

10 Items: A baby bisonU.S. park where bison roamThe natural habitat for bisonThe national mammal of the U.S.Group of bison traveling togetherConservation status in some regionsDescribes bison's origin in North AmericaThis month celebrates the bison as a national symbolYou need this legal term to enter a protected bison habitat...

Word Search 2025-01-08

30 Items: Related to the sunThe planet we live onEarth’s natural satelliteA being from another worldThe sky above us after sunsetThe closest planet to the sunA ball of glowing gas in spaceA large object orbiting a starThe start of a rocket’s flightAn object that orbits a planetThe fourth planet from the sunA vehicle used for space travel...

colors 12-word search 2023-03-15

12 Items: the color of nightthe color of grapesthe color of tangerinesthe color of a dandelionthe color of a snowflakethe color of strawberriesthe color of a tree's trunkthe color of lips of a babythe color of the Mediterranean Seathe color of a cloud during a stormthe color of the sky in good weatherthe color of leaves in spring and summer

Catch! Teenieping 2025-03-18

37 Items: IanJunKyleSarahKoreanLalapingHappyingJoahpingMaskpingNanapingTruepingDrMonziuTrustpingLuckypingHeartroseJellypingSweetpingTangypingHeartKingGigglepingTeeheepingFluffypingShashapingHarmonyTownQueenStellaQueenBelitaTeenieCatcherOkeydokeypingSugarBerryPactEmotionsKingdomMysticHeartWingJewelHeartWingPhoneThe Teenieping of loveThe Teenieping of Hope...

Asteroid Word Search 2026-01-20

36 Items: Audible heard or perceptible by the earAudio a transmitted signal you can hearBiodegradable capable of being decomposedBiotic of or relating to living organismsAudiovisual involving both hearing and seeingAudition a test of the suitability of a performerAuditory of or relating to the process of hearing...

Harry Potter Wordsearch 2023-09-26

16 Items: ronscarStonePotterMalfoyPrinceof FireHallowsKnow Whohogwartshermionegryffindordumbledoreof Secretsof Azkabanof the Phoenix

M2M 2024-02-04

12 Items: duom2mmayjulyMaritgirlsMarionMarionnorwaynorwaylorenskoglorenskog

Birthday puzzle 2025-06-14

6 Items: LesJulyTicketsWenesdaySixteenthMiserables

Module 10 HMH Vocabulary 2025-02-01

23 Items: The 2nd VP of JacksonsNickname of the high tariff placed on importsThe creator of the Cherokee system of writingAn informal group of trusted(by Jackson) advisersThe practice of giving government jobs to political backersAn agency created to manage Indian removal affairs in western lands...

DNA Structure 2025-03-10

16 Items: the scientist who took Photo 51the twisting ladder shape of DNAthe name of the sugar molecule in DNAthe abbreviation for deoxyribonucleic acidone of the bases in DNA that pairs with Adenineone of the bases in DNA that pairs with Guanineone of the bases in DNA that pairs with thymineone of the bases in DNA that pairs with cytosine...

Science Vocabulary Word Search chapter 11 (Lin) 2024-05-07

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

History and Government 2026-02-09

36 Items: 1787TEXASMLKDAYPUBLIUSSLAVERYARIZONAJPHN JAYGULF WARNEW YORKLABORDAYCHRISTMASKOREAN WARCALIFORNIANEW MEXICOJULY FOURTHWORLD WAR IVIETNAM WARMISSISSIPPIWORLD WAR IILOUISIAN WARTHANKSGIVINGVETERANS DAYCOLUMBUS DAYMEMORIAL DAYJAMES MADISONSTATES RIGHTSNEW YEARS DAYU. S. DIPLOMATWOODROW WILSONLIBERTY ISLANDPRESIDENTS DAYTHOMAS JEFFERSONINDEPENDENCE DAY...

Famous Landmarks Word Search 2023-04-14

20 Items: petrabig-bentaj-mahalcolosseumstonehengeeiffel-towermachu-picchugrand-canyontower-bridgeburj-khalifachichen-itzaniagara-fallsmount-rushmorepyramids-of-gizastatue-of-libertysydney-opera-housegolden-gate-bridgegreat-wall-of-chinachrist-the-redeemeracropolis-of-athens

World History 2023-07-17

20 Items: 29 CE _____ _____ crucified.1299 CE Osman I established the _____ Empire.1799 CE _____ Bonaparte takes control of France.1215 CE John of England sealed the “_____ _____”.570 CE Prophet Mohammed (the founder of _____) born.1492 CE Christopher _____ discovered a route going to the New World....

July Word Search 2025-09-16

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-17

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

Ch 4 The Muscular System 2025-04-20

24 Items: Inflammation of a fasciaArm or leg toward midlineArm or leg away from midlineExtreme slowness in movementAbnormal involuntary movementSurgical suturing of a muscleSurgical suturing of a tendonParalysis of all 4 extremitiesA condition of abnormal muscle toneAbnormally increased muscle activityLacking normal muscle tone or strength...

Damanuel 2025-11-11

12 Items: The god of warThe god of loveThe god of fireThe god of musicThe god of the seaThe god of lightingThe god of celebrationThe messengers of godsThe god of war and wisdomThe god of animals and huntingThe gods of fields and farmingA person who can speak to gods

Pr 1 2020 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksMondayFridaySundayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

CALENDAR 2021-12-15

28 Items: MAYJUNEJULYMARCHAPRILFIRSTTHIRDFIFTHNINTHSUNDAYMONDAYFRIDAYAUGUSTSECONDEIGHTHTUESDAYJANUARYOCTOBERTWELFTHTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBERBIRTHDATETWENTIETH

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Birthday month 2023-02-07

28 Items: fryjunejulyyearhometimegoodweekcokemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

Matilda's Word Search 2025-07-22

28 Items: sunhotpooljulysurfsunnygrassbunnybirdsfruitbeachoceansportsummeryellowflowerauguststitchcoconutrainbowpopsicleicecreamtropicalpalmtreepineapplebutterflywatermelonawesomeMarley

Rachel & Matthew 2024-07-18

20 Items: THEIR OCCUPATIONTHE APP THEY MET ONBRIDE'S MIDDLE NAMETHEIR FAVOURITE FOODNAME OF THE BEST MANTHE NAME OF THEIR DOGCOLOUR OF GROOM'S EYESTHE MONTH MATT PROPOSEDTHE NAME OF THEIR STREETA SPORT THEY PLAY TOGETHERMASCOT OF THEIR UNIVERSITYTHE LOCATION OF THEIR HONEYMOONTHE LOCATION OF THEIR FIRST DATETHE MONTH THEY BOUGHT THEIR HOME...

CREATION 6-21-19 2019-06-21

40 Items: FACEFISHFOWLGOODHERBKINDMADEMEATOVERSEASSEEDTHEMTREEUPONABOVEAFTEREVERYGIVENSHALLTHERETHINGCATTLEFOURTHHEAVENMOVETHSUBDUEWATERSBROUGHTCREATEDEVENINGGENESISMORNINGCREATURECREEPETHCREEPINGFRUITFULLIKENESSMULTIPLYFIRMAMENTREPLENISH

A S Word Quest 2024-04-11

23 Items: vailmovalDatesPatchtaurusFourthaustinmuffinTwelfthaxelradhoustonthievesFingersmarquisefacetimehoneybunteapiocathe WorldmcdonaldsEighteenthTwenty Fiveso smackablehe wanted to he would

High Frequency Words 2025-05-29

40 Items: doesoncesuresaysknowhourawayoftenagainwasteusingfoundmonthgreatfirstwritewaterrightbelowwhichaskedaboutfriendaroundpeoplealwaysfourthshouldbecomethroughbecauseremovedanotherthoughtbroughtwhereveranywhereimportantthroughouteverything

MH1 - Rangtelwoorden 2023-11-28

17 Items: 1st2nd3rd4th5th6th7th8th9th10th11th12th13th14th15th19th20th

Debating 2026-02-11

19 Items: arguerolesviewsmotiondebatepointsopposeropinionspeakercurrentargumentaudienceconcludeproposerprevioussecretarytimekeeperchairperson(e.g., point of order, point of information, point of inquiry)

Adoration, Word Search 2024-02-13

25 Items: a in acts 1c in acts 2t in acts 3s in acts 41st in 7 sacraments 82nd in 7 sacraments 93rd in 7 sacraments 104th in 7 sacraments 115th in 7 sacraments 126th in 7 sacraments 137th in 7 sacraments 14latin of Our Father 17communication with go 5tagalog of Our Father 18is an "action" of the whole Christ 151 of the 3 mysteries of faith starts with 7...

Bamidbar 5.0 2025-05-25

23 Items: “Mishkan”Hebrew, “Bamidbar”The Rosh of a man?Aaron’s firstborn.The son of Shedeur.Eleazar and IthamarThe chief prince of the Levites.The Levites belong to _________???This tribe numbered 41,500in the census.This tribe numbered 59,300 in the census.This tribe numbered 45,650 In the census.This tribe numbered 57,400 in the census....

July Word Search 2025-07-30

9 Items: SALESTOWERMEETINGBARBECUETEAMMATECANADIANNATIONALDISCOVERYMARKETING

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

Vayakhel 5.0 2025-03-15

16 Items: “Sh’mot”“Kippur”“Shittim””Yochanan”Son of BuziSon of Ahisamach“And he assembled”“To assemble together”Respond, sil vous plaitThe Holy One’s wedding ringHis name means, “In the shadow of G-d”to do, fashion, accomplish, to make, to build.This piece of furniture was made out of pure gold.The second piece of furniture made for the Mishkan....

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciónhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

HR 3B Crossword 2025-10-15

18 Items: LawWorthRightsRightsof LawEthicalJusticeJusticeContractLibertiesof PowersGovernmentParliamentand Balancesprocess of lawresponsibilityof the GovernedJudeo-Christian

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

2A 2024-01-24

28 Items: lunchclassfirstthirdfifthsixthninthtenthsecondfourtheighthEnglishseventhto teachto studyart classmathematicsthe class ofthe schedulethe homeworkspanish classscience classsocial studiesthe calculatorto talk, to speakphysical educationtechnology/computersin the… hour (class period)

End Of Month Reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

MONTHS OF THE YEAR  2020-05-21

6 Items: JULYAUGUSTOCTOBERNOVEMBERDECEMBERSEPTEMBER

Happy two months anniversary 2023-07-06

6 Items: twolovejulyhappymonthsanniversary

Phonics Pick 4- Week 3 2024-09-10

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

Athletic training vocab 2024-03-06

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

BIO 345 Chapter 1 Word Search - MC 2025-09-05

20 Items: - A group of people- The cause of a disease- The physiology of altered health- Defects that are present at birth- A complication of signs and symptoms- Death rates for a specific population- A manifestation that is noted by an observer- Aggravation of symptoms and severity of the disease- The study of disease occurrence in human populations...

FINAL GAME 2022-12-22

11 Items: Be QuickA JourneyBefore TwoCousins Dogs NameLong period of time(5x9)-(7x3) / (3x2)Jill's birthday monthWhere Aunt Kelly livesWhere the Bengals PlayNeeded to Enter an eventBig place that holds events

months of the year 2024-04-07

6 Items: mayjunejulymarchjanuaryoctober

COLORING WORD SEARCH 2025-12-10

6 Items: JULYMINUSRULERAUTUMNCIRCLESPHERE

End of month reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

F+S 2024-11-18

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

MT 115 Kinesiology Final Review 2023-03-27

16 Items: action of rectus femorisaction of fibularis brevisaction of the serratus anteriorcommon attachment of the hamstringsorigin of the forearm extensor groupaction of the psoas major at the hipreturns blood from the legs to the heartorigin at inner surfaces of lower six ribsmuscle belly between the gastrocnemius heads...

Ms. Saa's Fourth Grade Class 2025-08-18

16 Items: TJLeulJacobKhloeTaimaErrolMs.SaaLaurynAdysonBrileyStellaVioletZabrielAmeenahRajveerLincoln

Athletic training vocab 2022-08-29

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Cell cycle Rogan Ciesielski 2025-01-17

24 Items: the first stage of mitosisa series of events that take place in a cellthe stage of the cell cycle when DNA is replicatedthe process by which cells increase in size and massthe first stage of the cell cycle in eukaryotic cellsthe initial stage of the cell cycle phase called interphasethe final stage of cell division in both mitosis and meiosis...

2020 PR 1 & 2 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksSundayMondayFridayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

Word Search - colours, weather, food, months 2021-01-19

28 Items: sunhotrainwindbluepinkjulyjunecakecorncloudgreenblackwhiteyellowpurpleaugustcheeseorangeweatherrainbowjanuarychickendecemberfebruaryseptemberwatermeloncauliflower

Unit 1 2023-05-29

23 Items: bagoldfromjulythreeseveneightclockclasstwelveapril;augustsixteenerasersjanuaryfebruarynovemberthirteen;seventeentwenty-fourtwenty-ninetwenty-threetwenty-eight

Summer vacation 2023-06-17

28 Items: sunfunbaypoolpondheatjulyriverbreakboatsgiftssummerbakingtubingfamilyvermontfriendsvacationnoschoolglampingsixflagspopsicleicecreammarylandbirthdaycamperamasummercamprollercoaster

arachne med 2023-08-05

28 Items: elleasyabaravallzizijulyrheyfayegiyasshaelsysasadiluclaunageniepiksinaevaindribillalyviaqeyrawintermatchanoelledanielmerrlynarielera

Bride Word Search 2024-02-29

28 Items: guscakewifelovejulykissveilvowsbridegroomringsdressfamilycouplegartertuxedoguestshusbandforeverflowersweddingfriendsmackennamarriageceremonyhoneymoonreceptioncelebration

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

March Madness 2024-02-09

15 Items: UC Santa BarbaraBaylor UniversityUniversity of IowaUniversity of MiamiUniversity of TexasNC State UniversityCreighton UniversityPrinceton UniversityUniversity of AuburnTexas A&M UniversityUniversity of HoustonUniversity of IndianaUniversity of MarylandUniversity of MissouriUniversity of West Virginia

Weather Word Search 2024-05-06

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...