fourth of july Word Searches

Names 2025-09-28

27 Items: MAYRAINJUNEJULYMARCHAPRILAUGUSTJANUARYFLOWERSOCTOBERFEBRUARYNOVEMBERDECEMBERFIREWORKSSEPTEMBERHALLOWEENCHRISTMASTHANKSGIVINGMOMSBIRTHDAYVALENTINESDAYSTPATRICKSDAYADAMSBIRTHDAYALEXSBIRTHDAYALEXKSBIRTHDAYSUMMERVACATIONTAYLORSBIRTHDAYKATELYNSBIRTHDAY

Love Word Search 2025-11-10

27 Items: MayLoveKissHugsDateJuneJulyOkraCakeKatyTrustHeartLemonCrumblSevensDonutsForeverPartnerRomancePassionPromiseCatfishTownInnLaughterTogetherSoulmateMemories

banana 2025-11-14

27 Items: sunMaynoonmoonJuneJulynightlunchMarchAprildinnerMondayFridaySundayAugustmorningTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbreakfastWednesdaySeptember

Bamidbar 5.0 2025-05-25

23 Items: “Mishkan”Hebrew, “Bamidbar”The Rosh of a man?Aaron’s firstborn.The son of Shedeur.Eleazar and IthamarThe chief prince of the Levites.The Levites belong to _________???This tribe numbered 41,500in the census.This tribe numbered 59,300 in the census.This tribe numbered 45,650 In the census.This tribe numbered 57,400 in the census....

National Bison Month Word Search 2025-07-14

10 Items: A baby bisonU.S. park where bison roamThe natural habitat for bisonThe national mammal of the U.S.Group of bison traveling togetherConservation status in some regionsDescribes bison's origin in North AmericaThis month celebrates the bison as a national symbolYou need this legal term to enter a protected bison habitat...

Mrs. McInroe's Fourth Grade Homeroom 2025-08-10

16 Items: iandrueellalaceywyatttessapaxtonellanilizzetaliviaparkerbarrettdesmondmadisyngabrielmichelle

Ch 4 The Muscular System 2025-04-20

24 Items: Inflammation of a fasciaArm or leg toward midlineArm or leg away from midlineExtreme slowness in movementAbnormal involuntary movementSurgical suturing of a muscleSurgical suturing of a tendonParalysis of all 4 extremitiesA condition of abnormal muscle toneAbnormally increased muscle activityLacking normal muscle tone or strength...

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciónhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

Dyslexia Field day fun.  2020-05-11

40 Items: fundayMayyouMrs.zoomflipgridmathMissfieldlexiaSammyChloeMikeyLujanfifththirdwordsAdamssixthcovidMikeyMarchBormansoundsTannerfourthschoolRobertslettersreadingMclartycursiveinstantRobertsdyslexiaalphabetistationSebastian

Unit 3 Vocabulary Word Search 2023-10-04

14 Items: number of protons in the nucleus of an atomuncharged, subatomic particle located in the nucleusunit of mass equal to 1⁄12 of the mass of a 12C atomaverage mass of atoms of an element, expressed in amuthe lowest energy state of an atom or other particle.positively charged subatomic particle located in the nucleus...

M2M 2024-02-04

12 Items: duom2mmayjulyMaritgirlsMarionMarionnorwaynorwaylorenskoglorenskog

Vayakhel 5.0 2025-03-15

16 Items: “Sh’mot”“Kippur”“Shittim””Yochanan”Son of BuziSon of Ahisamach“And he assembled”“To assemble together”Respond, sil vous plaitThe Holy One’s wedding ringHis name means, “In the shadow of G-d”to do, fashion, accomplish, to make, to build.This piece of furniture was made out of pure gold.The second piece of furniture made for the Mishkan....

Adoration, Word Search 2024-02-13

25 Items: a in acts 1c in acts 2t in acts 3s in acts 41st in 7 sacraments 82nd in 7 sacraments 93rd in 7 sacraments 104th in 7 sacraments 115th in 7 sacraments 126th in 7 sacraments 137th in 7 sacraments 14latin of Our Father 17communication with go 5tagalog of Our Father 18is an "action" of the whole Christ 151 of the 3 mysteries of faith starts with 7...

World History 2023-07-17

20 Items: 29 CE _____ _____ crucified.1299 CE Osman I established the _____ Empire.1799 CE _____ Bonaparte takes control of France.1215 CE John of England sealed the “_____ _____”.570 CE Prophet Mohammed (the founder of _____) born.1492 CE Christopher _____ discovered a route going to the New World....

HR 3B Crossword 2025-10-15

18 Items: LawWorthRightsRightsof LawEthicalJusticeJusticeContractLibertiesof PowersGovernmentParliamentand Balancesprocess of lawresponsibilityof the GovernedJudeo-Christian

July Word Search 2025-09-16

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-17

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

2A 2024-01-24

28 Items: lunchclassfirstthirdfifthsixthninthtenthsecondfourtheighthEnglishseventhto teachto studyart classmathematicsthe class ofthe schedulethe homeworkspanish classscience classsocial studiesthe calculatorto talk, to speakphysical educationtechnology/computersin the… hour (class period)

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

MT 115 Kinesiology Final Review 2023-03-27

16 Items: action of rectus femorisaction of fibularis brevisaction of the serratus anteriorcommon attachment of the hamstringsorigin of the forearm extensor groupaction of the psoas major at the hipreturns blood from the legs to the heartorigin at inner surfaces of lower six ribsmuscle belly between the gastrocnemius heads...

My best memory 2024-12-06

39 Items: dayatehadsawtripswimmeetmadesangwentbestmusicdramagradethirdfifthsportschorusplayedhikingmemoryfourthcleanedclimbedenjoyedfishingreadingcookingplayingjoggingceremonyfestivalmarathonshoppingwatchingfestivalvolunteerfireworksgraduation

Movie Day Word Search 2025-07-14

38 Items: FARMINDIASIXTHFIFTHTHIRDPHONECANADAFRANCEMEXICOFOURTHPAELLASOCCERBORROWTABLETSUMMERENGLISHSAUSAGEWEEKENDPICTURECAMPINGTINIPINGMOVIEDAYBASEBALLPRACTICEVACATIONBIKETOURAUSTRALIAFRIEDRICEBEEFSTEAKQUESADILLAWHEELCHAIRUNITEDSTATESTUNGTUNGTUNGGRANDPARENTSUNITEDKINGDOMVEGETABLEPIZZAKPOPDEMONHUNTERSBALLERINACAPPUCCINA

March Madness 2024-02-09

15 Items: UC Santa BarbaraBaylor UniversityUniversity of IowaUniversity of MiamiUniversity of TexasNC State UniversityCreighton UniversityPrinceton UniversityUniversity of AuburnTexas A&M UniversityUniversity of HoustonUniversity of IndianaUniversity of MarylandUniversity of MissouriUniversity of West Virginia

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

Cell cycle Rogan Ciesielski 2025-01-17

24 Items: the first stage of mitosisa series of events that take place in a cellthe stage of the cell cycle when DNA is replicatedthe process by which cells increase in size and massthe first stage of the cell cycle in eukaryotic cellsthe initial stage of the cell cycle phase called interphasethe final stage of cell division in both mitosis and meiosis...

Pr 1 2020 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksMondayFridaySundayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

CALENDAR 2021-12-15

28 Items: MAYJUNEJULYMARCHAPRILFIRSTTHIRDFIFTHNINTHSUNDAYMONDAYFRIDAYAUGUSTSECONDEIGHTHTUESDAYJANUARYOCTOBERTWELFTHTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBERBIRTHDATETWENTIETH

CREATION 6-21-19 2019-06-21

40 Items: FACEFISHFOWLGOODHERBKINDMADEMEATOVERSEASSEEDTHEMTREEUPONABOVEAFTEREVERYGIVENSHALLTHERETHINGCATTLEFOURTHHEAVENMOVETHSUBDUEWATERSBROUGHTCREATEDEVENINGGENESISMORNINGCREATURECREEPETHCREEPINGFRUITFULLIKENESSMULTIPLYFIRMAMENTREPLENISH

A S Word Quest 2024-04-11

23 Items: vailmovalDatesPatchtaurusFourthaustinmuffinTwelfthaxelradhoustonthievesFingersmarquisefacetimehoneybunteapiocathe WorldmcdonaldsEighteenthTwenty Fiveso smackablehe wanted to he would

High Frequency Words 2025-05-29

40 Items: doesoncesuresaysknowhourawayoftenagainwasteusingfoundmonthgreatfirstwritewaterrightbelowwhichaskedaboutfriendaroundpeoplealwaysfourthshouldbecomethroughbecauseremovedanotherthoughtbroughtwhereveranywhereimportantthroughouteverything

Altoona School 2024-05-20

37 Items: petabbfastmathscottlucasmeansfifthlunchpizzacerneygrouprgroupbcoachbofficehurleymagnusfourthrecessbrunchnachosschoolsydoniemrlovoymslovoyscienceozobotsfriendslockersaltoonaredrovericecreamcomputersfreezetagfieldtripssocialstudiessilversprings

Athletic training vocab 2024-03-06

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

BIO 345 Chapter 1 Word Search - MC 2025-09-05

20 Items: - A group of people- The cause of a disease- The physiology of altered health- Defects that are present at birth- A complication of signs and symptoms- Death rates for a specific population- A manifestation that is noted by an observer- Aggravation of symptoms and severity of the disease- The study of disease occurrence in human populations...

Weather Word Search 2024-05-06

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...

Athletic training vocab 2022-08-29

25 Items: Rotation to insideRotation to outsideRaising the shouldersLowering the shouldersPulling shoulders backBringing shoulders forwardMovement toward the midlineMovement away from the midlineTo decrease the angle of a jointTo increase the angle of a jointMovement around the axis of the bodyPointing the toes upward toward the knee...

months of the year 2024-04-07

6 Items: mayjunejulymarchjanuaryoctober

COLORING WORD SEARCH 2025-12-10

6 Items: JULYMINUSRULERAUTUMNCIRCLESPHERE

MONTHS OF THE YEAR  2020-05-21

6 Items: JULYAUGUSTOCTOBERNOVEMBERDECEMBERSEPTEMBER

Happy two months anniversary 2023-07-06

6 Items: twolovejulyhappymonthsanniversary

Phonics Pick 4- Week 3 2024-09-10

6 Items: JulyAugustOctoberNovemberDecemberSeptember

July Word Search 2025-09-18

6 Items: JulyAugustOctoberNovemberDecemberSeptember

Birthday month 2023-02-07

28 Items: fryjunejulyyearhometimegoodweekcokemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

Matilda's Word Search 2025-07-22

28 Items: sunhotpooljulysurfsunnygrassbunnybirdsfruitbeachoceansportsummeryellowflowerauguststitchcoconutrainbowpopsicleicecreamtropicalpalmtreepineapplebutterflywatermelonawesomeMarley

F+S 2024-11-18

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

FINAL GAME 2022-12-22

11 Items: Be QuickA JourneyBefore TwoCousins Dogs NameLong period of time(5x9)-(7x3) / (3x2)Jill's birthday monthWhere Aunt Kelly livesWhere the Bengals PlayNeeded to Enter an eventBig place that holds events

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

F+S 2024-11-17

30 Items: Where They MetGroom's Alma MaterGroom's ProfessionWhere Do They LiveBride’s Middle NameGroom's Middle NameHoneymoon DestinationGroom’s Favorite SportGroom's Birthday MonthGroom’s Favorite HobbyBride’s Birthday MonthBride's Favorite SingerCouple's Favorite StoreThe Month They First MetColor Of The Groom's EyesBride’s Favorite Cocktail...

fjahfahd 2023-01-23

6 Items: shyguyflywhycryjuly

das 2023-04-27

6 Items: junejulyapriljanuarynovemberfebruary

Reformation Word Search 2023-11-29

20 Items: VdietVIIIsectsTudorLutherCalvingenevaghettoCranmerof Trentof Avilatheocracyelizabethcanonizedof Loyolaindulgencewittenbergcompromisepredestination

Classic Literature 2025-10-03

27 Items: WARMANFANGTWISTCRUSOEISLANDGARDENBEAUTYMARNERMY CRYHOBBITMACHINEHATCHETKIDNAPPEDIT COURAGEOF THUNDERFERN GROWSFAHRENHEITCOPPERFIELDOF THE WILDTIME MACHINEFRANKENSTEINOF THE BEAVEROF TWO CITIESOF THE WORLDSFAMILY ROBINSONMAN AND THE SEA

Grace & Emmanuel 2024-06-10

28 Items: Groom's middle nameBride's birthday monthGroom's birthday monthThe bride's middle nameMonth the groom proposedLocation of their honeymoonBride & groom's go-to drinkLocation the groom proposedLocation of their first dateGroom's favorite kind of foodThe couple's favorite TV showBride's favorite wedding movieChildhood nickname of the bride...

Kelly and Jason 2025-11-26

25 Items: The father of the brideThe father of the groomThe mother of the groomThe mother of the brideThe grooms favorite beerThe sport the groom playsThe couples favorite foodThe profession of the brideThe first cat the couple gotThe birth month of the groomThe birth month of the brideThe middle name of the brideThe middle name of the groom...

The Roman Colosseum 2025-11-25

24 Items: RomeItalyTunnelsTourismAqueductChariotsGladiatorsExecutionsEternalCityWorldWonderAmphitheatreArchaeologicalMonumentHow long did contests last?What was the colosseum a symbol of?What the colosseum was built on top ofWho conducted the Colosseum's creation?The kind of amphitheatre the colosseum isThe flooded naval battles in the colosseum...

Periodic Trends 2024-12-09

16 Items: The most electronegative of - Cu, Au, AgThe largest atomic radius out of - Cu, Au, AgThe largest atomic radius out of - P, N, B, HThe smallest atomic radius out of - K, Fr, H, LiThe largest atomic radius out of - Cr, Ca, K, TiThe smallest atomic radius out of - Sc, Mn, Zn, FeThe largest electronegativity out of - C, Fe, Fr, Ga...

Word Search 2025-10-22

30 Items: naar iets of iemand verwijzeniets beoordelen of inschattenvooral; voor het grootste deelhoe je over iets denkt of voeltde betekenis van iets uitleggenhet eindresultaat of de uitkomstde houding of sfeer in een tekstiets dat je van plan bent te doende reden waarom iets wordt gedaaneen gevoel van zorg of bezorgdheidiets wat helpt of een voordeel geeft...

End Of Month Reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

M4 Vocabulary review 2024-09-02

15 Items: the energy of motionthe ability to do worktype of reaction A+B= ABtype of reaction AB= A+Btype of reaction AB+C= AC+Btype of reaction AB+CD= AC+BDmoves from areas of high to lowtype of energy stored in an objectreaction or process that takes in heatreaction or process that releases heatsubstances made from a chemical reaction...

Weather 2024-11-19

25 Items: Movement of airMeasures wind speedFrozen precipitationLiquid precipitationFrozen precipitationMeasures air pressureRotating column of airStudy of the atmosphereSound caused by lightningHigh-altitude wind currentRain, snow, sleet, or hailVolunteer weather spottersBoundary between air massesRadar technology for weatherPrediction of future weather...

Mr. Gerald's Flurry's FOT 2025 Message I 2025-10-10

32 Items: outlawjoyGodrockcrownpeaceZadoklightstonetruththronehastenof GodFlurryof hopeAdullamloyaltyAmaziahnobilityhappinessAntiochusof safetyArmstronggovernmentcommissionrevelationpreparationof the Agesking-priestspurificationrighteousness

Gases Word Search_S2b 2024-11-20

21 Items: The Kelvin scaleThe SI unit of pressureTending to vaporize easily.An instrument used to measure atmospheric pressure.Average distance a molecule travels between collisionsThe pressure due to any individual component in a gas mixture.An instrument used to determine the pressure of a gaseous sample,...

2020 PR 1 & 2 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksSundayMondayFridayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

Word Search - colours, weather, food, months 2021-01-19

28 Items: sunhotrainwindbluepinkjulyjunecakecorncloudgreenblackwhiteyellowpurpleaugustcheeseorangeweatherrainbowjanuarychickendecemberfebruaryseptemberwatermeloncauliflower

Unit 1 2023-05-29

23 Items: bagoldfromjulythreeseveneightclockclasstwelveapril;augustsixteenerasersjanuaryfebruarynovemberthirteen;seventeentwenty-fourtwenty-ninetwenty-threetwenty-eight

Summer vacation 2023-06-17

28 Items: sunfunbaypoolpondheatjulyriverbreakboatsgiftssummerbakingtubingfamilyvermontfriendsvacationnoschoolglampingsixflagspopsicleicecreammarylandbirthdaycamperamasummercamprollercoaster

arachne med 2023-08-05

28 Items: elleasyabaravallzizijulyrheyfayegiyasshaelsysasadiluclaunageniepiksinaevaindribillalyviaqeyrawintermatchanoelledanielmerrlynarielera

Bride Word Search 2024-02-29

28 Items: guscakewifelovejulykissveilvowsbridegroomringsdressfamilycouplegartertuxedoguestshusbandforeverflowersweddingfriendsmackennamarriageceremonyhoneymoonreceptioncelebration

Attic Word Search 2023-02-24

25 Items: the surface of a room that you walk onthe surface of a room that you walk ona window built into a roof to allow light inthe structure that covers or forms the top of a buildingthe part of a roof where the sloping sides join at the topbaked clay used for building walls, houses and other buildings...

Chapter 11 Word Search 2024-05-02

37 Items: water in the form of a gasthe distance above sea levelthe most outer layer with no endThe third layer of the atmospherea device that measures temperaturewhat wind speed can be measured withwinds that blow over short distancesthe way Earth's rotation makes winds curvethe amount of mass in a given volume of air...

July Word Search 2025-07-30

9 Items: SALESTOWERMEETINGBARBECUETEAMMATECANADIANNATIONALDISCOVERYMARKETING

End of month reminders - July 2025-07-25

6 Items: CIIAuditCQIMeetingHAZCleaningLogWasteAreaInspectionPharmacyCleaningLogMyLearningTrainings

The Deluge Wordsearch 2025-03-25

20 Items: GOD"Man of the soil"Made of gopherwoodThe cause of the floodNoah's age when he diesAbundant on the big boatThe symbol of the promiseThe stop to Noah's big boatLasted 40 days and 40 nights2 pairs of this on the big boat7 pairs of this on the big boatAn agreement between God and NoahThe young one whom Noah had cursedThe years of Noah after the Flood....

Onix Middle Names 2024-08-10

18 Items: pegasus’ first namethe ruler of MordorDeveloped the PokédexRank 14 in classic WoWthe act of electrocutionthe most photogenic hourName of the gang in KantoName of generation 1 HeroName of Generation 1 RivalName of Dietrich’s brotherthe hardest mineral on earthReleased alongside Gold versionthe plateau of champions in gen 1...

BASIC TERMINOLOGY USED IN ATHLETIC TRAINING 2022-08-25

35 Items: broken bonelying face uplying face downblood in a jointpooling of bloodabove or head endcause of an injurytoward the mid-lineswelling with a jointback it sorsal aspectconnect muscle to bonefront or ventral aspectstretch or tear of ligmentbelow or away from head enddecrease in size of body partbruising or crushing of tissue...

Gases Word Search 2024-09-20

21 Items: The Kelvin scaleThe SI unit of pressureTending to vaporize easily.An instrument used to measure atmospheric pressure.Average distance a molecule travels between collisionsThe pressure due to any individual component in a gas mixture.An instrument used to determine the pressure of a gaseous sample,...

Terraria Bosses 2024-09-02

17 Items: BeeLordGolemSlimeSlimePrimeTwinsFishronCultistof LightPlanteraof FleshDeerclopsof WorldsDestroyerof Cthulhuof Cthulhu

Bethlehem's Significance 2023-10-18

21 Items: innholylandstarjudeaHerodfieldcensuslineageWisemenmessiahJourneyof Davidbiblicalof Breadnativityof JosephEphrathahbirthplacepropheciespilgrimage

BUSHONG REVIEW 2025-01-21

20 Items: Energy in motionThe ability to do workAnything occupies spaceUnit of radiation exposureProduct of mass and velocityWhat is the SI unit of force?Electron in the outermost shellRemoval of an electron from an atomAbility to do work by virtue of positionThe force that keeps an electron on orbitSame atomic number but different atomic mass...

CHONDRICHTHEYES 2025-04-14

26 Items: shark.fields.sharks.mother.mother's body.changes in water pressure.The family of rays, also known as eagle rays.The tail fin of a shark or ray, used for propulsion.The family of carpet sharks, including the wobbegongs.A compound found in the liver of sharks, used for buoyancy.The superorder of cartilaginous fish that includes all sharks....

Presidents: James Monroe - Word Search 2024-10-10

27 Items: WarArmyJulyJamesLawyerMonroeUnitedBattlesCollegeHarmonyTrentonWilliamWoundedAmericanDoctrineFeelingsPoliticsProjectsVirginiaExpansionPresidentUniversityContinentalColonizationIndependenceWestmorelandRevolutionary

THE MARIES 2025-02-12

29 Items: AMMAJULYJUNEJULYLUNAPINKMUSICPRIDESILOHSONNYUSHERAUGUSTKAMILIMALANIMOVIESSTOKESCINEMARKCONCERTSFEBRUARYDEFREITASTHEMARIESHARRISBURGTWOROBBERSNIFTYFIFTYSJANELLEMONAEPHILADELPHIASUNSETSOCIALSHIRLEYTEMPLEJAZMINESULLIVAN

Unit 5 Vocabulary 2024-12-10

28 Items: TERMIMAGESLOPEANGLEANGLESSIMILARVARIABLEDILATIONFUNCTIONVARIABLEROTATIONCLOCKWISECONGRUENTOF CHANGEINTERCEPTREFLECTIONTRANSLATIONTRANSVERSALRELATIONSHIPOF EQUATIONSOF A DILATIONCORRESPONDINGTRANSFORMATIONTO AN EQUATIONTRANSFORMATIONINTERIOR ANGLESCOUNTERCLOCKWISEOF TRANSFORMATION

greek gods 2024-02-02

10 Items: messengergod of wargod of firegod of the seagoddess of lovegoddess of huntthe king of godsgod of underworldthe god of archerygoddess of harvest

Unit 4 Vocab 2025-10-22

15 Items: PowersymbolsInverseSquaredSimplifyExponentsexpressionParenthesisof equalityproperty of additionproperty of equalityproperty of equalitySubstitutionpropertyproperty of multiplicationproperty of multiplication

united 2023-03-08

22 Items: swedennorwaypolandicelandfinlandnetherlandsthe sunshine statecity in central floridathe third planet from the sunthe sixth planet from the sunthe second planet from the sunthe fourth planet from the sunthe eighth planet from the sunthe seventh planet from the sunA highway that goes around a city.the 7th largest country in the world...

Jesus Word Search 2024-12-30

15 Items: LordRockJesusChristSaviorMessiahEmmanuelRedeemerThe WordTrue VineSon of GodLamb of GodGood ShepherdBread of LifePrince of Peace

Climate and Natural Resources Word Search 2024-11-08

31 Items: to form a crystal structurePollutants released into the airTrapping of heat near planet's surfaceGradual increase in average temperatureThe average annual conditions of an areaChange Sudden or gradual change in climateRate Number of people born per 1000 individualsRate Number of people who die per 1000 individuals...

Word Search for Fourth Class 2024-05-27

15 Items: nabiduharasulbenardustaempatsunahwajibtabligkitmannabawiansharpiagammunafikfarduain

Ms. Saa's Fourth Grade Class 2025-08-18

16 Items: TJLeulJacobKhloeTaimaErrolMs.SaaLaurynAdysonBrileyStellaVioletZabrielAmeenahRajveerLincoln

May The Fourth Be With You 2023-05-04

35 Items: sithyodajediforceewoksdroidanakinwookieobiwancheweyempiregalaxykylorenpadawankylorenpadawanhansoloalderaanalliancebobofettrepublicyounglingchewbaccadeathstarrebellionbattleshipdarthvaderlightsaberresistancemandalorianstormtrooperprincessleialukeskywalkermillenniumfalconmaythefourthbewithyou

May The Fourth Be With You 2025-04-29

20 Items: YodasithWwokRogueJabbaforceempireRebelsObiWanHansoloandroidPadawanTatooineSpaceshipDeathstarDarthVaderlightsaberGeorgeLucasPrincessLeiaLukeSkywalker