fourth of july Word Searches

Polish Verb Mieć 2025-11-04

24 Items: the form of "mieć" in past tense for "on" (he)the form of "mieć" in future tense for "ja" (I)the form of "mieć" in present tense for "ja" (I)the form of "mieć" in past tense for "ona" (she)the form of "mieć" in future tense for "my" (we)the form of "mieć" in present tense for "my" (we)the form of "mieć" in future tense for "oni/one" (they)...

Polish Verb Pić 2025-11-04

24 Items: the form of "pić" in past tense for "on" (he)the form of "pić" in future tense for "ja" (I)the form of "pić" in present tense for "ja" (I)the form of "pić" in past tense for "ona" (she)the form of "pić" in future tense for "my" (we)the form of "pić" in present tense for "my" (we)the form of "pić" in future tense for "oni/one" (they)...

Civics Word Search 2024-01-25

50 Items: lawvotelifebillflagpressloyalspeechsenatecivicsfreedomjusticelibertyreligionassemblycongresspresidentrepublicandemocraticrule-of-lawfifty-starsconstitutionindependencecivil-rightsfifty-stateswashington-dcwoodrow-wilsonvice-presidentabraham-lincolnthirteen-stripsnational-anthemfounding-fathersindependence-daygeorge-washingtondwight-eisenhower...

Months of the Year-wiyawapi 2024-04-24

26 Items: mayjunejulymarchaprilmonthsaugustjanuaryoctoberwiyawapifebruarywojupiwinovemberdecemberwasutonwiseptemberwaniyetuwiwiotehikawicannapopawicanpasapawicanwapegiwitahecapsunwicanwapekasnawiistawicayazanwiwihakaktacepapiwitinpsinlaitkahacwi

5th grade 2025-06-30

26 Items: LegSadJulyDoorHandEyessourMarchHappyMondayFridaySundayMotherFamilyCousinSpringSummerWinterbitterOctoberKitchenBedroomBrotherSeasonsexcitedBathroom

First Day of Fourth Grade: Get To Know Your Classmates! 2025-08-06

21 Items: MaxNgoNoeNoahEmelyAllanBaileyJeremyEisleyCooperOliviaAubreyKendaleBarrettPrestonBridgetBrooklynMcKenzieBerkleighCristhianKa'torious

Abrahamic Religions Word Search 2025-06-11

28 Items: Islamic ProphetHoly book in IslamWhere Muslims prayChristian holy textName of God in IslamHoly text in JudaismOldest Abrahamic ReligionSomeone who follows IslamSomeone who follows JudaismLeader of the Catholic ChurchOne of the two sects of IslamOne of the two sects of IslamPlace where Jewish people prayIn Christianity, the Son of God...

Catherine & Peter 2025-06-18

30 Items: Bride's CollegeGroom's FraternityBride's middle nameGroom's mothers nameBride's mothers nameMaid of Honor's nameLocation of proposalBride's Fathers nameGroom's Fathers nameGroom's brothers nameBride's favorite bandBride's college majorGroom's birthday monthBride's birthday monthMonth the groom proposedCity the couple lives in...

Polish Verb Być 2025-11-04

24 Items: the form of "być" in past tense for "on" (he)the form of "być" in future tense for "ja" (I)the form of "być" in present tense for "ja" (I)the form of "być" in past tense for "ona" (she)the form of "być" in future tense for "my" (we)the form of "być" in present tense for "my" (we)the form of "być" in future tense for "oni/one" (they)...

Polish Verb Jeść 2025-11-04

24 Items: the form of "jeść" in past tense for "on" (he)the form of "jeść" in future tense for "ja" (I)the form of "jeść" in present tense for "ja" (I)the form of "jeść" in past tense for "ona" (she)the form of "jeść" in future tense for "my" (we)the form of "jeść" in present tense for "my" (we)the form of "jeść" in future tense for "oni/one" (they)...

Polish Verb Iść 2025-11-04

24 Items: the form of "iść" in past tense for "on" (he)the form of "iść" in future tense for "ja" (I)the form of "iść" in present tense for "ja" (I)the form of "iść" in past tense for "ona" (she)the form of "iść" in future tense for "my" (we)the form of "iść" in present tense for "my" (we)the form of "iść" in future tense for "oni/one" (they)...

Appreciation week 2024-05-03

35 Items: artgymstemfirstthirdfifthmusictigerssecondfourthrespectempathyhonestycouragelibraryschnabelkindnesscollodoraevergreencommunitysolutionsexplorersengineersgratitudeinnovationimagineerscreativitycenterbasecooperationkindergartenexplorationsinvestigatorsperserverenceproblemsolversresponsibility

Ancient Greece Mythologies 2025-11-07

14 Items: UranosCity-statePhilosophy,god of the sky.Wealthy trade city,God of war and bloodshed.Capital of ancient Greece.Democracy rule of the people.God of the underworld and the dead.God of wine, festivity, and theatre.Sacred site of the ancient Olympic GamesQueen of the gods, goddess of marriage and family....

Señora York Dias y Meses Word Search (Days and Months) 2025-09-30

17 Items: Gobble, GobbleSpookiest monthThank God it's...Month of Labor DayFriday's Baby BrotherFirst month of SpringFirst month of SummerFirst month of schoolSt Patrick's Day MonthSanta's favorite monthFirst Month of the yearOur nation's Birth MonthLast full month of schoolShortest month of the yearFirst Day of the school weekCommonly known as "Hump Day"...

World Population Day (July 11) 2023-11-13

20 Items: poorrichbirthruralurbancensuscohortgendersurveypovertycommunityemigrationimmigrantsinequalitymetropolisdemographicdevelopmentantinatalismsustainablitystratification

Internalist July Word Search 2024 2024-07-06

34 Items: catgymvtfmboathousevtuberminingblocksbiomesnethershovelbattlecreeperbedrockpickaxepokemonpikachucraftingredstoneendermandiamondsobsidiansurvivalhardcorecreativeemeraldspokeballminecraftdurandmonvillagersadventureenchantinginternalistperrytheplatypus

Literature Word Puzzle - July Issue 2024-10-08

20 Items: MobyEpicPlathAustenBronteOrwellOdysseyQuixoteMagicalTolkienSonnetsDickensFaulknerMetaphorDystopiaAllegoryMythologySymbolismKafkaesqueShakespeare

Shemot 2025-01-12

24 Items: “Tov”“Puah”בַּיִתמֹשֶׁה“Shemot”Mitzrayim“Shifirah”Moses wife“to go out”ark, HebrewAdonai's son.Moses firstbornThe priestly tribe.Jochabed’s husband.Moses elder brother.The mother of Yeshuaan intentional untruth.The minister of Midian.The prophet of the Haftarah.The Redeemer of Abraham….HaftarahYeshua was born in this town in Israel....

Motivational Interviewing Word Search 2024-12-24

18 Items: Done with a purposeA form of drawing out information.Showing that you are doing something together.The second letter of PACE in the spirit of MI.Seeing a situation through another's point of view.The last letter of DARN that shows a ______ to change.The first letter of DARN that shows a ______ to change....

oo Spelling Words 2021-02-16

26 Items: putcookwoodpushbookJulypullhoodfullvinesoilwoofrootstoodshookbrookfruitbumpypulleysmoothbutcherplywoodbulletinelectionpresidentwoodpecker

Arreola Family 2022-12-16

26 Items: julykalimarcnomokenjimasonaubreyaugustcarsonfamilygerberkinseytravelarreolacampingfriendsgolfingjanuaryoctoberoquendobaseballdecembertaekwondoproconceptsvanmulliganlightthenight

SummerTime Word Find 2023-08-09

26 Items: hottanpooljunejulycamphikeswimboatsummeraugustpicnicfamilyshortsbonfirecookoutsandalsfishingfriendssunshinelemonadeicecreamvacationroadtripfireworkssunglasses

Miss Murphy's Fourth Grade Class! 2025-08-26

18 Items: AvaKyleRyanRowenKevinRykerCalebHarperRobertLillahJosephAdalynAmeliaDanielMadelynLillianBentleyStanley

Zeus Basics 2025-09-10

28 Items: food of the godsruler of the seadrink of the godstitles or nicknamestree sacred to Zeusruler of the underworldLocation of Zeus’ oraclebird associated with Zeusweapon of Zeus, forged by the CyclopesKing of the Gods, the lord over the Skyson of Zeus and Aegina and king of Aeginawas the King of the Titans and father of Zeus...

Semester 1 Review 2025-12-16

29 Items: Stored energyEnergy of motionHow shiny an object isElements that are malleable and ductileSum of all forces that act on an objectForce that pulls towards the center of massType of force that attracts or repels metalsThese elements are brittle and bad conductorsWhen energy is moved from one place to another...

U6 Homeostasis 1 Wordsearch 2022-11-15

21 Items: increase the speed of enzymesmolecule that an enzyme acts uponable to dissolve in other substancesThe energy needed to start a reactionsmaller pieces of something larger, that make it upa state of balance of the internal conditions of an organismenzymes are specific to the molecules in which they work upon...

Astronaut Word Search 2025-02-11

10 Items: The natural satellite of EarthA vehicle used for space travelA person trained to travel in spaceA small rocky body orbiting the sunA man-made object placed in orbit around a planetAn instrument used to observe distant objects in spaceThe fourth planet from the sun, often called the "Red Planet"...

Vocab 2A 2024-02-01

28 Items: artMathLunchclassfirstthirdfifthsixthninthtenthsecondfourtheighthEnglishseventhto teachto studythe class ofthe schedulein the… hourthe homeworkspanish classscience classto talk/speaksocial studiesthe calculatorPhysical EducationTechnology/ Computers

Vocabulary Vines 11-12 (Enright) 2025-09-11

13 Items: one rulerone, singlestudy of lifestudy of originsbelief in one godstudy of the earthspeech by one personstudy of the universemarried to one personspeech, study of, written wordstudy of ancient (first) peoplestudy of the distribution of waterwritten record of the time of events

The Komagata Maru 2025-12-16

19 Items: catMayJulyIndiaChinaJapanAprilRacismCanadaDockedJourneyVancouverCommunityChallengeRegulationPassengersGovernmentImmigrationMan's best ford search words (15)

Ch 4 Terms 2022-09-28

27 Items: study of tissuesstages of pregnancyhollow ball of cellsopening of the cervixthinning of the cervixanother term for the egg cellcell with half the chromosomesbeginning of new organ formationrelease of the egg from the ovaryinner mucous membrane lining of the uteruswhen the embryo lodges in the uterine lining...

Fourth Grade Geometry Vocabulary 2025-02-11

12 Items: angleacuterightvertexobtusesquarehexagonrhombuspentagonrectangletrapezoidparallelogram

July 2 Word Search 2024-06-28

14 Items: flatlanesyieldblinkerseatbeltpulloverspeedingaccidentcrosswalkacceleratedecelerateheadlightspedestrianintersection

Old Magcon and people associated abd things about them 2015-02-17

28 Items: JJMayNashJackMattJuneJulyVineHayesAaronShawnSammyJacobMarchCarterTaylorDillonAugustCameronOctoberYouTubeMahoganyDecemberDecemberFebruaryNovemberSeptemberSeptember

Word search Zulema 1. Find the words. Write a sentence for each word. 2023-05-05

26 Items: oldjulykickbearshipsafenosefieldyoungmousesharksheepsoundthrowcatchwristfrownsprettybounceweekendpeachesgiraffeevaporatecrocodilegrandmothergranddaughter

13 MIKMAQ MOONS 2024-01-24

26 Items: mayjunejulymarchaprilaugustkjikusjanuaryoctoberfeburarynipnikusnovemberapuknajitseptemberwikewikusdecemebergreatmoonsqoljuikuspeskewekusseiwkesikuspenatmuikuskesikewikuspunamujuikuswikumkewikuskeptekewikuskisikwekewikus

Word search 2024-11-27

26 Items: mayweekjunejulyfallmarchaprilMondayfridaysundayaugustMonthssummerspringwinterTuesdayjanuaryoctoberSeasonsthursdaysaturdayfebruarynovemberDecemberWednesdayseptember

The 12 Olympians 2023-12-10

12 Items: The god of warThe wife of zeusThe god of musicThe goddess of beautyThe goddess of wisdomThe leader of the GodsThe ruler of the oceanThe goddess of the huntThe messenger of the GodsThe goddess of the hearthThe goddess of the harvestThe god of fire and craftsmanship

Med Term 2024-09-09

20 Items: the microscopic study of tissuethe study of the functions of the bodystudy of disease; it’s nature and causesituated on the back/back part of an organcommonly known as the bellybutton or navelsudden and widespread outbreak of a diseasedirected towards or nearer the side of the bodyphysician who specializes in the care of toddlers...

Year 8 so far! 2023-05-24

21 Items: Gases in group 0Metals in group 1A circuit with one loopUnit of measurement for timeThe organelle that contains DNAUnit of measurement for distanceUnit of measurement for pressureA circuit with more than one loopA different form of the same geneThe solid or gas part of a solutionDrugs used to treat pain and disease...

Cells 2023-06-16

21 Items: contains DNAsites of photosynthesisan undifferentiated cellsites of protein synthesissites of aerobic respirationwhen cells become specialisedmovement low to high using energythe first stage of the cell cyclethe final stage of the cell cyclewhere chemical reactions take placecontains cell sap to keep cell turgidcellular process that releases energy...

Daniel & Sylvia 2025-01-26

24 Items: Years togetherPlace they metCouple's hotspotCity they live inWedding officiantDaniel's new hobbyCouple's Dog's nameDaniel's middle nameMaid of Honor's nameSylvia's birth monthMonth Daniel proposedHoneymoon destinationSylvia's middle namesWhere they got engagedSylvia's favorite foodSylvia's favorite drinkCouple's favorite store...

fourth grade 2023-10-18

6 Items: zevyyosefmichoelmordechaireuvenchaimmrsabramczyk

AGT KODI LEE 2023-10-20

26 Items: redsalagtherhatutaherictinajulybandgoalpianodancederekwaterkaylasimonyiyikusavantflutiemiraclelasvegasheckyeahbiblicalclassicaltwentyseven

World of words 2025-07-04

26 Items: CATDOGSKYBIRDCOLDHEATJULYHARDKILOLOVESOUNDFORTYHUMANGHOULWHAITSHIRTWomenWHEREDOUGHFRIENDREFORMPEOPLEPersonSHADOWSPIRITRUMBLE

All words 2025-09-22

26 Items: maydayjunejulyweekyearhourmarchaprilmonthmondayfridaysundayaugustminutesecondtuesdayjanuaryoctoberthursdaysaturdayfebruarynovemberdecemberwednesdayseptember

6th November 2025-10-17

24 Items: GuykingfuseplotJamesCecillordscellarFawkesCatesbyopeningtreasoncommonsremembergunpowderparliamentconspiracytolerationconfessionWestminsterassassinationunion-of-crownsfirst-of-Englandsixth-of-Scotland

Birthday party July handsome Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhWrapscripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

OP 2023-03-27

40 Items: BlindMugiwaraSogekingFirefistSkeletonSand ManIs a clownThe TyrantShadow manCat burglarDevil ChildIce BicycleDonut MakerThe PhoenixDonut EaterGiraffe Dude3 Sword StyleStealth BlackLeader of CP0God of SkypeaHeavenly DemonLuffy's #1 FanDouble CigaretteThe light admiralKing of the BeastsBlue Nosed ReindeerKing of the PiratesStrongest man alive...

Quarter 3 Benchmark Review 2025-02-25

21 Items: law of inertialength traveledchange of positionany kind of stored energylaw of action and reactionan object slowing over timethe force that opposes motionthe tendency to float in a fluidany kind of energy due to motionforce equal mass times accelerationrate of the change of distance over timerate of the change in velocity over time...

Chapter 11 Vocabulary 2023-04-17

37 Items: containing thermal energywater in the form of a gasthe distance above sea levela device that measures temperaturea device that determines wind speedwinds that blow over short distancesthe way earth’s rotation makes winds curveThe amount of mass in a given volume of airThe increased cooling that a wind can cause...

Y3 Christmas Word Search 2025-11-30

30 Items: MenStarGoldHopeJesusMyrrhGloryNightof GodMangerAngelsDonkeyStableFatherMessiahSaviourWorshipPromiseImmanuelRedeemerof PeaceShepherdof KingsNativityProphecyBethlehemShepherdsIncarnationof the WorldFrankincense

Step 5, High Frequency Words 2025-12-11

37 Items: sonwontondontsoonoughtthreebelowownerownedheartwomanwomenearlysinceboughtfourthbeforehousestowardprettypersonfathermothersisterfamilyalmostseveralthoughtbroughtbetweenlearnedbrotherdaughterfamiliesdifferentbeautiful

Birthday party July handsome Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

Birthday party July handsome Roisin 2023-07-02

45 Items: ginbbqMaryDaveTimesingbeerwinegoodnicefoodloveGlennNiamhWrapssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

International Friendship Day (July 30) 2023-11-13

20 Items: bondamigoamitycronymarrowpaisancompeerrapportaffinityalliancecompadreclosenesscompanionconfidantattachmentfellowshipcamaraderiecomradeshipacquaintancerelationship

World Chess Day (July 20) 2023-11-13

20 Items: windrawkingmatepawnrookcheckqueenbishopgambitknightmagnusdefenceendgameopeningblockadepositionpromotionstalemategrandmaster

frolicking brains july 2024 emotions 2024-07-06

33 Items: sadcalmhurtfreeboredangryproudbraveafraidjoyfulstronglovingamazedanxiousexcitedcuriouscontenthopefulfocusedpeacefulfrolickygenerouscreativeinspiredsurprisedsurpriseddelightedconfidentconnectedwhimsicaljudgementfrustratedoverwhelmed

G2.2 July Monthly Test Review 2025-07-21

32 Items: fatbunrulebodymeatleadarmytiredsweetsugarreachcrosssolveriderenergybattlesecondknightweaponwondermachinemillionpatientancientdumplingexcitingbreakfastcharacterwatermelonsuggestionvideo gamesimagination

bible 2025-11-18

20 Items: ruthpaulhagarrahabpetermiriamjosephpatirckdymphnaradegundphilomenaJoan of arccarlo acutisDominic savioPedro calugsodmary of nazarethfracis of assisihidegard of bingenElizabeth Ann setoncatherine of alexandria

War of 1812 2024-10-22

6 Items: What Treaty ended the war?What month did the war of 1812 end?What month did the war of 1812 start?Who was the president during the time of the war?"To prohibit trade with another country" is the definition of what word?"The practice of forcing people to serve in the Navy" is he definition for what word?

9/9/09 2023-10-16

27 Items: noemaysaulolgajulylovehoperamsciscofaithevelyndeniseperrisbudicefamilyanthonyoctobermissingfebruaryfranciscoyzarrarazseptemberriversidekingcobraapplevalleywillowparkhighnineninezeronine

The Shaws 2024-07-07

27 Items: shawrosejulytacocamplovekissringvowsgroomtonkabridemorgandurhamfamilypatrickbouquetweddingcupcakeforeverburgundyceremonykosiorekkayakingsunflowerseptemberhoneymoon

Important Word Search 2025-11-10

25 Items: MayMoonWolfMeltWormSnowJuneJulyshineTrailShapeNorthMarchAprilNativeSpecialHarvestQuarterJanuaryFebruaryNovemberDecemberImportantStrawberrySeptember October

Fatui Word Search 2025-04-09

16 Items: PierroDottoreSignoraCapitanoSandroneTsaritsaTartagliaPantaloneColumbinaArlecchinoPulcinellaScaramoucheReal name of DottoreReal name of CapitanoReal name of TartagliaReal name of Arlecchino

Spanish 1 2025-10-06

39 Items: pendaymaybookdeskyearweekjunejulymonthtodaymarchaprilfolderpencilmondayfridaysundayaugusttuesdayjanuaryoctobernotebooktomorrowthursdaysaturdayfebruarynovemberdecemberclassroomwednesdayseptemberteacher(male)student (male)sheet of paperwhat day is it?student (female)teacher (female)What is the date?Eselprimerode It’s the first of

Colorful Calendar Connections 2025-01-04

59 Items: MayPeaRedOpalJuneJulyRoseLilyAquaPinkRubyNavyGrayPearlTopazMarchAprilDaisyPoppyAsterGloryHollyGreenBrownGarnetAugustVioletCosmosPurpleOrangeSilverDiamondEmeraldPeridotJanuaryOctoberJonquilSeafoamAmethystSapphireFebruaryNovemberDecemberSnowdropPrimroseDaffodilHawthornLarkspurMarigoldRubyStoneTurquoiseSeptemberCarnationGladiolusNarcissusAquamarine...

First Form Lesson Thirty-one 2025-09-24

12 Items: 3rd prin. part of timeo3rd prin. part of valeo3rd prin. part of doceo3rd prin. part of teneo3rd prin. part of ardeo3rd prin. part of jubeo3rd prin. part of maneo4th prin. part of doceo4th prin. part of teneo4th prin. part of ardeo4th prin. part of jubeo4th prin. part of mansus

Government 2025-10-23

16 Items: lawsmayorrightsjudicialgovernorof rightof powercongressexecutivepresidentpresidentcompromiselegislativeconstitutionresponsibilityof representitives

Light - Reflection and Refraction 2025-04-22

31 Items: light-rayreal-imagefocal-pointconvex-lensray-diagramfocal-lengthincident-raylens-formulaconcave-lensstraight-linevirtual-imageconvex-mirrorreflected-rayrefracted-raypower-of-lensconcave-mirrorprincipal-axismirror-formulaoptical-centerimage-formationprincipal-focussign-conventionspherical-mirrorrefractive-indexlateral-inversionangle-of-incidence...

Couples wknd 2023-03-19

15 Items: Mr. FailsMr. HoldenMr. WillisMrs. FailsMrs. HoldenMrs. WillisMr. CrawfordMr. CatchingsMrs. CrawfordMrs. CatchingsSince Feb 1994Since Sept 1992Since July 1987Since July 1994Since June 1992

Onomatopoeia Word Search 2025-09-29

20 Items: An example of blendingCompounding break+fastAn example of compoundingAn example of foreclippingShortening the end of a wordStudy of the meaning of wordsTaking words from another languageA word borrowed from India (Hindi)Words that imitate sounds are calledCombining two words to make a new oneUsing part of a word to form a new one...

Basic EKG Terms 2025-07-08

19 Items: irregular heart rhythmtop chambers of the heartthe pacemaker of the heartbottom chambers of the heartheart rate of less than 60 bpmpertaining to the heart muscledemonstrates contraction of atriaheart rate of greater than 100 bpmatria quiver; high risk for strokeHeart is located on right side of chestmarks to evaluate size of cardiac complexes...

Darker than Black  2016-03-09

27 Items: HeiMaoYinBaiWeiJulySuouMakiMinaXiaoHuangAmberAprilHavocShionDollsBritaGeminiMisakiŌtsukaBerthaAmagiriHellsGateNovember11ContractorBlackReaperHeavensGate

fabric 2025-12-10

26 Items: MayDayJuneJulyFallTimeDateWeekYearYearMarchAprilMonthAugustSpringSummerAutumnWinterJanuaryOctoberWeekdayWeekendFebruaryNovemberDecemberSeptember

Guitar Word Search 2025-06-30

7 Items: LakeJulyBibleGuitarJoyfulPepperPinterest

Biology final review 2022-12-15

24 Items: Center of cellBasic unit of lifeNegatively charged ionsolute is dissolved inIndividual living thingconcentration of H ionsProduces hydroxide ionsSubstance that dissolvedforms H ions in solutioncontains one type of atomDiffer in number of neutronsEvenly distributed componentsSmallest functional unit of lifeElectrons are shared between atoms...

colors 12-word search 2023-03-15

12 Items: the color of nightthe color of grapesthe color of tangerinesthe color of a dandelionthe color of a snowflakethe color of strawberriesthe color of a tree's trunkthe color of lips of a babythe color of the Mediterranean Seathe color of a cloud during a stormthe color of the sky in good weatherthe color of leaves in spring and summer

MH1 - Rangtelwoorden 2023-11-28

17 Items: 1st2nd3rd4th5th6th7th8th9th10th11th12th13th14th15th19th20th

Catch! Teenieping 2025-03-18

37 Items: IanJunKyleSarahKoreanLalapingHappyingJoahpingMaskpingNanapingTruepingDrMonziuTrustpingLuckypingHeartroseJellypingSweetpingTangypingHeartKingGigglepingTeeheepingFluffypingShashapingHarmonyTownQueenStellaQueenBelitaTeenieCatcherOkeydokeypingSugarBerryPactEmotionsKingdomMysticHeartWingJewelHeartWingPhoneThe Teenieping of loveThe Teenieping of Hope...

Christmas Words # 2 2024-03-04

40 Items: joyonespinelovespellaromatreestreesClausseasonheartsmelodywarmthlightssmilesseasonlightsgivingsmilesessencefestivemagicalcinnamonfamiliesornamentserenitymemorieschristmasof givingmerrimentnostalgiaaffectionsnowflakesgracefullytraditionsenchantmentof Memoriesof nostalgiaof affectionof traditions

Important Word Search 2025-11-10

25 Items: MayMoonWolfMeltWormSnowJuneJulyshineTrailShapeNorthMarchAprilNativeSpecialHarvestQuarterJanuaryFebruaryNovemberDecemberImportantStrawberrySeptember October

the fourth stall 2023-05-17

8 Items: mactestcameratrixieschoolkjelsonbathroomdetention

The fourth stall 2023-05-17

8 Items: mactesttrixiecameraschoolkjelsonbathroomdetention

LS-4-1 Unit 3 Lessons 1-3 Evolution and Natural Selection 2023-10-24

19 Items: early pre-birth stage of development.total DNA present in the nucleus of each cellheredity changes in groups of living organisms over timeanything that has or once had the characteristics of lifecarbon compound joined by peptide bonds; building block of proteingroups of individuals of the same species that live in the same area...

Harry Potter Wordsearch 2023-09-26

16 Items: ronscarStonePotterMalfoyPrinceof FireHallowsKnow Whohogwartshermionegryffindordumbledoreof Secretsof Azkabanof the Phoenix

Gingivitis Word Search 2025-10-01

25 Items: An area of pathology.The study of disease.Medical term for a bruise.Inflammation of the tongue.Inflammation of the gingival tissue.Malignant tumor in epithelial tissueReferring to the area below the gingiva.Referring to the area above the gingiva.Closed cell or pouch with a definite wall.Malignant disorder of the lymphoid tissue....

DNA Structure 2025-03-10

16 Items: the scientist who took Photo 51the twisting ladder shape of DNAthe name of the sugar molecule in DNAthe abbreviation for deoxyribonucleic acidone of the bases in DNA that pairs with Adenineone of the bases in DNA that pairs with Guanineone of the bases in DNA that pairs with thymineone of the bases in DNA that pairs with cytosine...

Module 10 HMH Vocabulary 2025-02-01

23 Items: The 2nd VP of JacksonsNickname of the high tariff placed on importsThe creator of the Cherokee system of writingAn informal group of trusted(by Jackson) advisersThe practice of giving government jobs to political backersAn agency created to manage Indian removal affairs in western lands...

Science Vocabulary Word Search chapter 11 (Lin) 2024-05-07

37 Items: Water in the form of a gasThe distance above sea levelA device that measures wind speedA device that measures temperatureThe inner layer of the ThermosphereThe outer layer of the thermosphereWinds that blow over short distancesThe outermost layer of earth's atmosphereAn instrument used to measure air pressure...

Grandma's Birthday- Find the words to unlock your birthday surprise 2025-06-07

15 Items: After the factFour minus oneStay a short timeThe opposite of sadAn annual celebrationA place to come and goThe country Lauren livesA mode of transportationThe state in which you liveA device to carry belongingsThe seventh month of the yearA traditional game that involves diceThe absolute best feeling in the world...

Damanuel 2025-11-11

12 Items: The god of warThe god of loveThe god of fireThe god of musicThe god of the seaThe god of lightingThe god of celebrationThe messengers of godsThe god of war and wisdomThe god of animals and huntingThe gods of fields and farmingA person who can speak to gods

Word Search 2025-01-08

30 Items: Related to the sunThe planet we live onEarth’s natural satelliteA being from another worldThe sky above us after sunsetThe closest planet to the sunA ball of glowing gas in spaceA large object orbiting a starThe start of a rocket’s flightAn object that orbits a planetThe fourth planet from the sunA vehicle used for space travel...

Birthday puzzle 2025-06-14

6 Items: LesJulyTicketsWenesdaySixteenthMiserables

World War II Word Search 2025-02-11

18 Items: FDRAxisItalyJapanD-DayAlliesPattonNimitzAmericaGermanyNormandyArdennesMacArthurEisenhowerSoviet-UnionBattle-of-MidwayBattle-of-Iwo-JimaBattle-of-the-Bulge

Create your ideal setlist with the first 8 songs you see 2025-12-04

27 Items: IfIRunGrowHomeOhNoJulyAloneShameJosieAdoreCoverLetGoCologneAspirinCryBabyLavenderComeBackHurricaneIfIdKnownToBeAloneHoldingOnBrownEyesUpAtNightBreatheOutWannaBeYouLoveInTheDarkSaturdayMourning

Rachel & Matthew 2024-07-18

20 Items: THEIR OCCUPATIONTHE APP THEY MET ONBRIDE'S MIDDLE NAMETHEIR FAVOURITE FOODNAME OF THE BEST MANTHE NAME OF THEIR DOGCOLOUR OF GROOM'S EYESTHE MONTH MATT PROPOSEDTHE NAME OF THEIR STREETA SPORT THEY PLAY TOGETHERMASCOT OF THEIR UNIVERSITYTHE LOCATION OF THEIR HONEYMOONTHE LOCATION OF THEIR FIRST DATETHE MONTH THEY BOUGHT THEIR HOME...

Famous Landmarks Word Search 2023-04-14

20 Items: petrabig-bentaj-mahalcolosseumstonehengeeiffel-towermachu-picchugrand-canyontower-bridgeburj-khalifachichen-itzaniagara-fallsmount-rushmorepyramids-of-gizastatue-of-libertysydney-opera-housegolden-gate-bridgegreat-wall-of-chinachrist-the-redeemeracropolis-of-athens

Seasons, Months and Colours 2019-10-01

27 Items: mayredjunejulypinkgreybluemarchaprilwhitegreenblackbrownspringsummerautumnwinteraugustyellowpurpleorangejanuaryoctoberfebruarynovemberdecemberseptember

January Word Search 2023-11-19

27 Items: mytenageonetwohowyounamefivejunejulyninegoodpuppymarchthreeaprilsevenkittenaugustjanuaryoctoberbirthdayfebruarydecembernovemberseptember