food Word Searches

WW4 U15 2024-09-12

17 Items: clearto think about carefullyeasily broken or damagedto be about; to interestto swoop down on and seizeof a time just before the presentof increased strength or thicknessgiving total attention to somethingquick; without too much time passingsomething that stands for something elseto focus all one's thoughts or efforts on...

Frederick Douglass Vocabulary 2025-08-25

17 Items: to remember.broken apart or split.real, true, or genuine.all-powerful; able to do anything.rude or disrespectful; not polite.extreme dislike; something hateful.to echo or spread out like ripples.a lot of something; more than enough.full of energy; always changing or moving.powerless; unable to make something happen....

Molar Mystery III 2025-11-29

5 Items: What are the wires on teeth that help make them straight?What are the big, strong teeth in the back of your mouth called?What is in your mouth that helps you taste food and should be brushed too?What shape should you make with your toothbrush when you brush your teeth?What is the best drink for your teeth that helps wash away sugar and germs?

aless food 2024-04-23

1 Item: Salmon rio pyramids rice fries pancake music spotify chalk chocolate beabadoobee swing fruit plate cat

stuff to find in a house 2026-03-02

1 Item: table ,pets, pantry, couch, food , stove, television,

Superbowl wordsearch 2026-01-14

1 Item: quarterback blocker rusher offence defence party food

Wants Word Search 2026-03-04

19 Items: Video conferencingThese are the needs for personalA multilingual online dictionary.It always begins with an equal sign.Combinations of operand and operators.This is the amount of interest given to aBuyer and seller relationship that buildsTravel guide that provides information ofPersons who purchase products or services....

Chapter 7 2025-09-30

14 Items: Vinegar is a _________________ that tastes sour.It is _________________ to wash your hands before eating.The nurse will _________________ the vaccine into your arm._________________ was one of the first antibiotics discovered.Malaria is a dangerous _________________ spread by mosquitoes....

Food Chains and Food Webs 2023-02-09

1 Item: predator foodweb decomposer omnivore herbivore carnivore

Food that are healthy with "whole wheat" in the title. 2024-01-07

4 Items: breadcerealtortillacrackers

All About Pete 2022-12-04

16 Items: The dog's "last name".Most common noise the dog makes.The dog's most frequent activity.The dog's current brand of dog food.Color of the dog's first & only toy.What Chad often instructs to dog to go do.Other water-based activity the dog despises.Popular crossbreed not recognized by the AKC.Arguably, the smallest part of the dog's body....

Animal Word Search 2025-11-16

12 Items: star-nosedmicroscopic “bears” in “water”three hearts, blue blood, and a beakunderwater crop circle artists and balloonistsmammal with the longest gestation (around 22 months)a bear with transparent fur (hollow hairs) and black skinmammalian architects whose creations can be seen from space...

POSTIES 1104 BIG READ 2024-10-15

6 Items: another word for "bugs"food that has not been eaten at the end of a mealMany people are afraid of black soldier flies because they think they _____.a substance that is spread on the land or given to plants, to make them grow wellThe black soldier fly larvae can also be used to make compost, _____ or animal feed....

IT'S CORN 2025-10-18

12 Items: The small seed part of a corn cob.The science and practice of farming.The layer of earth where plants grow.The tall, sturdy stem of the corn plant.A person who grows crops or raises animals.The center part of the corn where kernels grow.The process that helps corn plants make new seeds.The process by which plants make food from sunlight....

Water safety 2023-11-23

16 Items: important sea safety hintnice sea view by the seasideuse it to dry up your wet bodyprotects your head from the sunan activity we all enjoy at seais the main component of the seaa virtue you must have by the seasidethe name of a garment you wear to swimwhen ever in doubt about where to swimdangerous objects buried under the sand...

Vocabulary review! 2025-11-18

16 Items: when you want to cry.when you want to sleep.they come from chickens.you use it in Geography class.you use it to do maths quickly.you can put in salads or sauce.shoes you wear for sport or running.you press buttons with letters to write.when you think something bad can happen.when you are very happy about something....

Forces & Motion/Energy Transformation 2024-10-22

16 Items: Push or Pull on an objectEnergy in the form of heatA source of chemical energySpeed in a specific directionA change in position over timeEnergy that comes from the SunThe force produced by a moving objectThe ability to do work or cause changeEnergy that comes from motion or movementAn object's tendency to resist changes in motion...

Vietnamese food 2024-11-11

1 Item: pho xoi beef pork lamb omelet salmon chef knife dish menu chew consume dairy protein fruit vegetables grains

aless food 2024-04-23

1 Item: Salmon rio pyramids rice fries pancake music spotify chalk chocolate beabadoobee swing fruit plate cat

Food Groups 2022-10-01

1 Item: Carbohydrates Carrot diet Eggs Fats Food Fruits Health Legumes Malnutrition Meal Menu Nutrients Nutrition Nuts Oils Orange Protein Staples Vegetables

POSTIES 0519 COVER 2025-04-17

6 Items: A _____ novel is long story told in comic book format.In Lam's culture, sharing food is how people show ____.a person or thing that is the reason why somebody creates somethingLam moved from Hong Kong to the United States when she was _____ years old.a type of literature that describes imaginary people and events, not real ones...

Switcheroo Word Search 2024-04-13

24 Items: Bertle _____Aussie cowboy hatOne main characterWhite trunked treesJool's mum's recipeAn inhospitable regionThe station competitionHayley's New York hobbyThe other main characterOne of the station ownersThe nickname given to HayleyChantelle got fired from hereSlugger's favourite lunch foodHis girlfriend nicknamed him this...

Sara and Daniel 2024-10-25

26 Items: Danny's shoe sizeSara's birth monthDanny's birth monthDanny's middle nameDanny's favorite showSara's favorite colorSara's favorite hobbyDanny's favorite foodSara's favorite drinkDanny's favorite colorWhat Danny does for workSara's favorite MLB teamDanny's favorite NFL teamWhere Danny proposed to SaraThe school Sara graduated from...

Brendan & Taylor 2024-12-16

25 Items: Best man’s nameColor of Groom’s eyesThe Bride’s occupationThe couple’s dog’s nameBride’s favorite dinnerThe groom’s birth monthThe Groom’s middle nameThe Bride’s middle nameThe month Brendan proposedMother of the Bride’s nameThe matron of honor’s nameThe couple’s college mascotThe couple’s favorite liquorBride’s favorite dipping sauce...

gen alpha test 2025-09-03

20 Items: – Talking way too much– Flirty charm or smooth talking– Meme word for weird, cursed things– Something average or disappointing– Opposite of rizz; fails at flirting– Robotic or background character behavior– Doing something perfectly or confidently– Delusional, living in fantasy (but funny)– Nonsense meme trend with toilet characters...

¿Qué te gusta hacer? 2025-11-24

50 Items: TVorbutbiketimewithfoodmorealsowaterfruitjuicepizzaafterto eatto buyto runsportsguitarcookiebeforeschoolto restto drawto ridefriendsto playto workto drinkto studyto watchto spendactivityice creamto prepareDo you likeI like (to)to practiceFrench friesto skateboardto learn Spanishto write messagesrefreshment, sodato listen to musicto go for a stroll...

My Kitten 2026-01-27

21 Items: Our first date spotOur first road tripOur (fake) cats nameYour nickname for meOur anniversary dateOur alternate reality cityOur nickname for each otherOur fav food ever (shortened)The free sport we do togetherWhat I want to do to your faceOur first solo concert togetherOur favorite alcoholic beverageThe expensive sport we do together...

B&C 2026-02-13

35 Items: My degreeMy real nameOur pet nameMy birthplaceOur future dogOur future catOur first filmOur universityYour full nameOur uni streetThe city we metYour future jobThe night we metYour nearest cityMy favourite foodAnniversary monthYour favourite catYour favourite dogMy main instrumentOur birthday monthYour real (nick)nameOur first city break...

SPANISH EN EL VECINDARIO 2026-03-10

22 Items: where bread is madewhere you get moneywhere you go to eatwhere you copy stuffwhere you go to playwhere you to get helpwhere you go for medswhere you go for booksplace to get a sandwichwhere you go for a ringwhere you go to buy foodwhere you go to get toolswhere you go to buy thingswhere you go to see the judgede correo where you go for mail...

Think Ahead 2 - Module 5 - Word Search 2026-03-13

20 Items: Use something again [R _ _ _ _]Make a place tidy [C _ _ _ _ U _]Not use something well [W _ _ _ _]Use less of something [R _ _ _ _ _]You dry your body with it [T _ _ _ _]Break or harm something [D _ _ _ _ _]Give something and get money [S _ _ _]Heats food quickly [M _ _ _ _ _ _ _ _]Make air or water dirty [P _ _ _ _ _ _]...

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Gabrianna & Krystoffer 🥰🔒😘 2023-06-18

15 Items: first date togethermost common food we eat 🐷Something that describes usLocation of are first kiss😘My fav song I stole from my baby🤤Are favorite color and fav hobby🌲😂Something we do alot since cherries …🪱Place we get pizza deleivered to alotttFavorite show we watched together so farstate you want to take me to on vacation...

HLTAHA049 - Lesson 1 revision 2024-04-28

10 Items: ability to move quickly and easilywhen blood is pumped throughout the heartObserves a rapid measurement of oxygen saturation levelsWhat is the purpise of conducting 715 health assessments?Instrument used to by practioners to test deep tendon reflexesoffers food and nutrition advice to improve health and well being...

Identifying Abuse 2025-04-01

10 Items: excessive or unjustified use of a drug.reducing the risk of future harm for DV patients.type of violence that patients above the age of 65.signs of bruising, cutes, burn marks, and swelling.failing to provide adequate care or support to a individual.identifying signs of abuse in patients upon initial encounter....

May 2025 Safety 2025-05-10

10 Items: There is no “one size fits all” ____________.Keep _____ food items in designated areas only.Have an _________ protocol for contagious patientsAlways wash your hands after and between ________ patients.When in doubt, consider a sick patient __________ and use PPE.Use proper PPE when handling a pet with no, or outdated, _______ history....

AGRICULTURE TRANSFORMATION AND RURAL DEVELOPMENT 2025-11-12

10 Items: What does palm oil expansion cause?Agrobank provides ( F ) for farmers.For who government keep the food price low?Why do small farmers need organization and assistance?Who divided large estates into small farms and cooperatives?Integrated Development objectives is important to national ________....

AGRICULTURE TRANSFORMATION AND RURAL DEVELOPMENT 2025-11-12

10 Items: What does palm oil expansion cause?What Agrobank provides for farmers?For who government keep the food price low?Why do small farmers need organization and assistance?Who divided large estates into small farms and cooperatives?Integrated Development objectives is important to national ________....

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

just about every word 2023-10-01

158 Items: ashiifinnoonupandantbigbutbedbancatcanendelffryfanfatforgetgodhowlowmommannapnewpanpadvetwetyesyumbendbandboatboltcastcasecopydowndumbdoneeasyfirefoodgamegoodhelphandhoophosehowliowajumpjunejulylionlesslumpmoonmissmalemallnoonoverohioridereadstepslamsongsendtimetestundowordwhatwildxrayyarnyoyozoneaprilblamecrapecloneflamefloorfryergummygoosehello...

Garthbrooks Word Search 2025-01-17

20 Items: Years together (5 letters)Kiah’s birth month (3 letters)Maid of Honors name (6 letters)Couples favorite food (5 letters)The month he proposed (9 letters)First concert together (11 letters)Kiah’s favorite dessert (9 letters)Couples favorite artist (9 letters)Who said I love you first? (4 letters)Kiah’s favorite wildflower (6 letters)...

Wedding Wordsearch 2025-02-18

20 Items: Luke's best manLuke's middle nameLuke is Stacey's...Stacey's maiden nameStacey's maid of honourStacey/Here comes the...Luke & Stacey's last nameTheo and Arthur are the...Mollie and Chloe are the...Luke & Stacey are 'Just ...'what type of animal is Bun-Bun?The name shared by the most guestsWhat type of animal watched Luke propose?...

happy two years baby 2026-01-29

20 Items: What is Amy’s MBTI?How much do I love you?Where was our first date?What is Amy's favorite sauceWho is Amy's favorite person?What is Amy’s favorite flowerWhat is Jacobs favorite food?What is Amy's favorite color?Who is Jacob's favorite person?Who is Amy’s favorite character?What is Jacob's favorite Pokemon?What is Amy’s favorite wild animal?...

B&C 2026-02-13

35 Items: My degreeMy real nameOur pet nameMy birthplaceOur future dogOur future catOur first filmOur universityYour full nameOur uni streetThe city we metYour future jobThe night we metYour nearest cityMy favourite foodAnniversary monthYour favourite catYour favourite dogMy main instrumentOur birthday monthYour real (nick)nameOur first city break...

Vocabulary Review: Units 6 & 7 2025-11-15

22 Items: a score of zero in sportsa machine that makes a room warma long stick used in golf to hit the balla cold cupboard that keeps food and drinks fresha machine that moves air to make a room feel coolera small machine that heats and browns slices of breada machine that washes plates, glasses, and cutlery for you...

Feelings- Adjetivos-Animals 2023-03-02

20 Items: Its night so it isSpanish word for dog.Its winter so the outside isThe opposite of entertainingThe fact wasn't true so it wasA feeling when someone is cryingThis is a good neighborhood so it isHe is mad, another feeling word for madEveryone is so---of her accomplishmentsA feeling,she is scared around new people...

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

People in the Bible 2025-03-03

25 Items: built the arkkilled Goliathwalked on waterwas laid in a mangerwas healed of leprosyhelped an injured manrefused to leave Naomiwanted to eat pig's foodwas raised from the deadwas thrown in a lion's dentold Naaman to go to Elishaclimbed a tree to see Jesushad a baby when they were oldhad a baby when they were oldsaid Jesus was the Son of God...

Occupational Word Search 2025-03-23

20 Items: What is Ellee afraid of?What is Ellee's school mascot?What is Noah's sibling's name?What is Noah's favorite candy?What is Ellee's sibling's name?What is Noah's favorite soccer team?What is Ellee's favorite music group?What was the name of Ellee's hedgehog?What is Noah's favorite ride at Disney?What is Ellee's favorite ride at Disney?...

Unit 1 and 2 2025-11-12

20 Items: Close sessionLook for informationMake a simple drawingApply a special effectDisplaying data on the screenHurt yourself or someone elseOrder food from a mobile devicePut something special to a pictureWhen a lot of water covers the landA big fire that spreads through treesSearch for information on the internetWhen your mouth pushes air/to move air...

17 SQN Wordsearch 2025-11-28

28 Items: Flight 4I in CCCIHolds badgesThe W in CWDControls yawRed in the ____The A in DRSABCsRank above PLTOFFAnnual fundraiserA sign of respectDirection of travelTraditional camp mealA special date in AprilThe body of an aircraftPrinciple explaining liftThe way the belt tail goesThe first camp of the yearN of the phonetic alphabetWhat an altimeter measures...

Secondary Economic Activities 2024-11-15

25 Items: – MNC stands for.– where rubbish is burnt.– Is an example of a light industry in Cork.– consists of inputs, processes and outputs.Alumina – Example of a heavy steel industry in Shannon.- What primary activity involves catching fish and other seafood?- What is the process of extracting minerals from the earth called?...

A Dog of Flanders pgs. 73-79 2023-09-11

20 Items: What is the miller's name?Who were they paintings of?I have been ______ to that boy.Let's lie down _______ and die.What did Patrasche do at dinner?Who should have won the contest?Who did Nello draw in his drawing?Who wouldn't eat any food at dinner?Where in Antwerp did Patrasche go to?The boy and the dog then fell ______....

913's Quiz for Annie 2025-04-27

20 Items: 大學的社團(8)喜歡的季節(6)喜歡的口味(6)當助教的科目(8)近期愛戴的(11)想從事的職業(7)喜歡喝的飲料(6)收集的物品(11)正在學的語言(6)想買的汽車品牌(8)近期喜歡的顏色(5)想養的寵物品種(7)最近想嘗試的酒(7)期待考過的證照(3)大學讀的科系(27)近期愛的衣服種類(5)最近想買的物品(17)天氣好會做的事(15)最近想花錢用的app(7)favorite food 麥當勞(11)

Ahola Word Search 2025-10-23

34 Items: Remy's MomEnjoys animeFormer bikerMrs. MuffinsWorked at IBMFormer teacherLoves year end!Really likes catsHas an orange catOwns a food truckObsessed with golfDie hard Disney fanHer son attends JCUEnjoys highland cowsLoves to go to playsFather-Daughter teamUsed to be a stylistOwns a yellow MustangAhola's resident bakerRuns 5ks with his wife...

Vacay 2026-01-25

161 Items: napspafoodmaskpoolrobesandbeachgrilllobbyoceanphonescarfshoessockstowelvillaankletbrunchcameradaybeddiningharborislandjetlaglagoonlaptoploungeluxurymarinamiddaymirrorresortshoressiestasunsettabletwetbagarrivalbalconycuisinedaypassfirepitgetawayhammockhorizonjacuzzijournalleisurelipbalmmassagemorningretreatsceneryseasideseaviewsunriseterracebackdrop...

Chemistry, Physics, and Energy Word Search 2023-05-22

20 Items: The unit of mass.? = Distance/Time.The unit for work.? = Force x Distance.The unit of frequency.The type of energy that food is.He created the 3 laws of motion.A horizontal row on the periodic table.A vertical column on the periodic table.The type of energy stored inside an object.The type of reaction where heat is released....

Lauren & Brad 2024-06-09

32 Items: Lauren's nicknameBrad's middle nameLauren's first carLauren's middle nameBrad's height: 6'__"Brad's college mascotBrad's favorite movieLauren's college mascotBrad's favorite cuisineLauren's favorite hobbyLauren's favorite singerBrad's degree in collegeBrad's astrological signLauren's favorite TV showBrad's favorite video game...

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Word Search 2024-11-10

150 Items: hasdogmandidhatkeyteaflyboxtwoendsunrunairwayeatyesboyusesatmayrancattophowdidwhobadmissdarkthanheadwindgoodfeetbeencoldroomtooklotsgaveboatoverknowmanylongeyesmosttolddoorduckkeepbestevenwellgoneworktelltreewishfishfoodwantstopparksoonsnowneedonlygrowawayhomelastbearplayeachtakebookfindmoregirlmustfellfoundbirdscriedlooksroundeveryotherthingright...

Liana & Geffrey 2025-03-12

27 Items: groom's hometownBride's last namegroom's dream carbride's dream doggroom's birth placebride's birth placeWhere the couple metHoneymoon destinationgroom's favorite colorthe bride's birth monthcouple's favorite hobbythe chore the groom doeswho said I love you firstWhere the couple got engagedthe month the groom proposedcut of bride's engagement ring...

May Word Search 2025-07-22

25 Items: first dateJosh loves thesenumber of niecesJosh's workplacenumber of nephewsMaggie's professionMaggie's Godson's nameMaggie's favorite hobbythe name of Maggie's dogwhere Maggie and Josh metwhere Maggie and Josh worknumber of siblings Josh hasthe name of Maggie's schoolnumber of siblings Maggie hasfood that Maggie and Josh like...

Back to School Crossword Puzzle 2025-08-18

22 Items: The teacher's last nameWhere to place your backpackApp used for class communicationFollow directions the ______ timeThe subject of this class is ______Daily activity at the start of classThe shows materials needed for classBe in your ______ before the bell ringsAssignments must be turned in on ______Points are earned toward a class ______...

Word Search 2025-12-15

20 Items: App for short videosSweet ring-shaped treatSuperhero movie universeSport played with a hoopTakeaway food with toppingsPopular casual or sports shoesPlaying video or computer gamesWhat you hold to play most gamesUsed to listen to music privatelyThe part of a car that makes it runOnline game where users create games...

RileyM200's Song Titles 2025-10-25

30 Items: The TheSatan BoxReal TimesFinally FreedVictory ValetBirthday NamesQuick DecemberKind FriendshipThe Glorious SongGrammar "Gremmer"Everything is GoodaThe Helicopter SpinLocking Up My HeartDid All The Work NowPlease Help Me FocusNo Power, Life PausesAntarctica, the DesertFintry's Food DeletionJelly and Peanut ButterWhy Would You Assume That?...

Yellowstone Word Search 2026-01-24

30 Items: Bride's favorite movieGroom's favorite movieDylan's favorite drinkBride's favorite colorGroom's favorite colorDylan's first employerJessica's favorite actorDylan's favorite actressBride's favorite dessertGroom's favorite dessertJessica's favorite drinkBride's favorite flowersJessica's first employerFavorite song as a couple...

Child Rights Word Search 2024-11-15

15 Items: A safe place to live and grow.Being free from danger and fear.Children must be kept safe from harm.Every child should feel valued and respected.Every child deserves to go to school and learn.A loving group to care for and support children.Treating every child with kindness and fairness.The right to be cared for and live a healthy life....

Canadian cities 2025-06-14

28 Items: - Retirement paradise where gardens bloom and wallets empty- Car manufacturing town that puts wheels on Canadian dreams- Medieval fortress city that somehow ended up in North America- Cottage country gateway where city folk pretend to be outdoorsy- The center of the universe, according to everyone who lives there...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

Vocabulary Review: Units 6 & 7 2025-11-15

22 Items: a score of zero in sportsa machine that makes a room warma long stick used in golf to hit the balla cold cupboard that keeps food and drinks fresha machine that moves air to make a room feel coolera small machine that heats and browns slices of breada machine that washes plates, glasses, and cutlery for you...

La comida 2026-01-08

35 Items: Sinónimo (synonym) de zumo.Toda la comida del mar (sea).Té frío con mucho hielo (ice).¿Cómo se dice "to eat dinner"?Mi tía llora cuando ella pica _____.Sinónimo (synonym) de sabroso y rico.El guacamole es hecho (made) con _____.Para hacer un omelet necesitamos _____.A la chica le gustan las _____ coladas.Las personas vegetarianas no comen _____....

Anatomy & Physiology: I 2026-02-12

27 Items: Also know as inhalationResponse of tissue to injurySuperior portion of the hip boneLoss of ability to control micturitionInsufficient blood flow to the tissuesPosteroinferior portion of the hip boneEntire life cycle of a cell, excluding mitosisPlant polysaccharide injected to determine GFRTaking food into the GI tract through the mouth...

How to Survive a Tornado 2024-10-08

13 Items: The shape of a tornadoAnother word for a tornadoWhat can a tornado sound likeWhere should you go to survive a tornado?what type of air can be a sign of a tornadoWhat is the name of the tornado we talked aboutif stuck outside, where is the safest place to hideThe most important thing to focus on during a tornado...

Personal Protective Equipment 2025-12-29

13 Items: Safety is everyone's responsibilityProtect your head from unwanted bumps.Shield your hands from cuts, burns, and hazardsHigh visibility saves lives; be seen to be safe.Guard your face; keep the air you breathe cleaner.Prevents the hair from falling onto your food, ewww.Wear them now, or later you’ll be asking “HUH? WHAT?!”...

Ancient Egypt Word Search 2025-09-02

18 Items: very oldmany godsPeople who come from Egyptplanting seeds in the fielda sticky glue found inside plantsA rich or special group of peopleA group of people living togetherto stop something from going rottencollecting ripe food from the fieldsa place where a dead person is buriedgood for growing many plants and crops...

Environmental Science 2025-05-15

20 Items: ALBEDOTRAGEDYCONVECTIONCORALREEFSBIODIVERSITYWater that is safe to drinkCost-benefit analysis involves ___ assessmentDeepwater ___ spill made front page news in 2010Storing rainwater is one method to ___ freshwaterthe transfer of energy as heat through a materialLakes that create an abundance of nutrients are __...

Halloween Fun 2025-10-09

19 Items: Undead bloodsuckerSpirits from the beyondThis is the witching hourCreatures in The Walking DeadBoard game that tells fortunesThis song is a graveyard smashA large pot for brewing potionsThe author of The Tale Tell HeartA raven's quote or school for WednesdayThese creatures transform at the full moonThe most prolific horror author of our time...

Logan 2024-04-23

1 Item: dogs sports cars waffles pizza pancake pineapple watermelon cats

Jesus' Miracles 2026-03-08

14 Items: (See #7)(See #10)The Son of GodJesus raised the young man from the ___________________.Jesus ___________________ many people who were feeling ill.An unusual or wonderful event that is caused by the power of God.Jesus often made people who were ___________________ feel well again....

Posties Dec 18 - Big Read 2023-11-24

6 Items: another word for "rubbish"knives, forks and spoons, used for eating and serving foodable to be decomposed by bacteria, so that it doesn't pollute the environmentto be unable to breathe because the passage to one's lungs is blocked by somethinga sea creature with a body like jelly and long thin parts called tentacles that can give a sharp sting...

Dialogue: Word Search 2023-10-04

6 Items: ‘Chef’ and ‘Cook’ both words mean someone who prepares food.clause what do you mean when you wrote: “You got home and.”When a teacher and student are talking about his or her homework.A country with no laws and people can do what they want to do whenever they want to....

Dialogue Word Search 2023-10-05

6 Items: What do you mean when you wrote: “You got home and.”‘Chef’ and ‘Cook’ both words mean someone who prepares food.When a teacher and student are talking about his or her homework.A new classmate is very positive and seems to want to help people.A country with no laws and people can do what they want to do whenever they want to....

Pet Parade ( Cute and cuddly animals kids adore ) 2025-05-02

5 Items: Puppy: A young dog that loves to play, run, and wag its tail with joy.Kitten: A baby cat that is soft, playful, and loves to chase yarn or toys.Hamster: A small furry pet that runs on wheels and stores food in its cheeks.Turtle: A slow-moving animal with a hard shell that can hide its head and legs inside....

Beauty and the Beast pgs. 14-19 2023-10-11

18 Items: Who came to Beauty's dream?Where did the horse go to eat?What can she see in the mirror?Where did they find food inside?What were the cupboards full of?Who did the Beast walk right up to?When does her father need to leave?What animal did the Beast look like?What was everywhere in Beauty's room?Who found the way to the Beast's palace?...

Structure and Function of Plants 2023-12-05

9 Items: _______ help plants get what they need.The part of the plant that makes most of its food.Which plant part plays the biggest role in supporting the plant?Flowers contain structures that are responsible for _____________.An adaptation used by cactus to survive in a hot, dry environment is ________ ________....

Finding secret animals 2025-11-11

9 Items: Man's best friendDied and came back to lifeUsed to skateboard in the 90's but now he's too oldA helpful animal with a shiny bald head and kind eyesMan's second best friend who's honestly just using him for foodKind of like a kite but it lives underwater and killed Steve Irwin...

Dogs 2024-11-05

10 Items: What item is a chewy treat often given as a reward?What is commonly used to keep a dog from wandering off?What round object do dogs enjoy chasing and retrieving?What is a favorite outdoor activity for energetic dogs?What does a dog wear that has their identification on it?What is the loud noise dogs make to communicate or alert?...

Fish Word Search 2025-11-15

10 Items: – A small animal with a hard shell and two claws.– A soft sea animal with long stinging tentacles.– A large fish with sharp teeth that swims in the ocean.– An animal that lives in water and breathes using gills.– A smart, friendly sea animal that jumps and swims fast.– An animal with a shell on its back that can live in water....

WHI.1 Vocabulary Practice 2025-05-24

15 Items: more than necessary ________________________way of life of a society _____________________skilled craftspeople __________________________also known as the New Stone Age ______________________________also known as the Old Stone Age ______________________________way of life characterized by little movement _______________________________...

Dribbles Word Search 2026-01-19

15 Items: Stretched all the way out.In a way that is angry or unkind.In a careful way to not get hurt.Water ____ slowly from the faucet.Things that make a good combination.A person you know, but not very well.Signed up or officially written down.The sad, poorly dog had been _____ by his owner.Choosing carefully instead of picking everything....

Spelling & Vocabulary Wk. 10 2025-10-14

10 Items: every person.situated directly below something elsetake place; occur; find or come across by chance.almost certainly; as far as one knows or can tell.in spite of the fact that; even though; however; but.become fully aware of (something) as a fact; understand clearly.(noun)the liquid that comes from meat or other food when cooked....

Where We Live 2023-04-18

15 Items: costing a lot of moneysomeone who owns somethinga musical instrument with stringsto go to live in a different placesomeone who you invite to your homea small house, usually in the countrya machine that you use to dry your hairto have or use something with another personthe part of land by your house where you grow plants...

Good Deeds 2025-09-10

10 Items: Not a single person; no person at all.All the people in a group are included.When we mean any person at all, no matter who.Any object, idea, or action without being specificDescribes a place that is clean, neat, and well organised.An organisation or activity that helps poor or needy people....

ANI MY QARA Week - Crossword Puzzle Challenge 2025-11-11

10 Items: Who is responsible for quality?Which country does ANI MY distribute its products?What is theme of Quality and Regulatory Week of 2025?What product is NOT under the scope of Malaysia Milk Code?Abbott Quality Policy - My commitment to Quality changes________.What is the local Ministry that regulate Food safety and quality program?...

Ant Word Search 2025-11-22

10 Items: - A home where bees live together.- A place some insects build to keep their eggs safe.- A small creature like an insect that crawls or flies.- An insect like a butterfly but usually seen at night.- A tiny insect that lives in groups and works together to find food.- A small insect with two wings that can move quickly through the air....

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...

WHI.1 Vocabulary Practice 2025-05-25

15 Items: more than necessary ___________________skilled craftspeople __________________way of life of a society ____________________also known as the New Stone Age ____________________also known as the Old Stone Age _________________________way of life characterized by little movement _________________...

Olentangy Model UN Word Search 2026-02-16

17 Items: Most Popular UK FoodClosest US State to AfricaLargest country in the worldWhat is the capital of Jamaica?Number of months an Ethiopian year hasWhat is the largest desert in the world?Which country is also called The Netherlands?What country does the Rhine River run through?What is the least spoken language in the world?...

Life Science 2025-03-25

1 Item: Trait, Instinct, learned behavior, Producer, consumer, decomposer, ecosystem, food web, food chain, adaptation, structure, function, desert, savannah, forest, ocean, arctic, apex predator, consume, fungi, sunlight, plants, people, animals, organism, offs

Encuentra las palabras 2025-08-08

1 Item: steeet Food, cheese, bacon, Wings, sabor paralelo, New York, caprichosa, cariñosa