animal Word Searches

All About Me 2025-05-30

20 Items: AgeBirthdateFirst NameMiddle Name1st Car ModelFavourite FoodFavourite FoodFavourite ThingFirst Dream CarFavourite FlowerFavourite ColourBusiness #1 NameBusiness #2 NameWhat I call myselfName of First ChildName of Second ChildFavourite RestaurantBest Month of the YearFavourite Animal on paperWhen I grow up I want to be...

Benny's Exploration Journal 2024-10-24

12 Items: A secreted molecules that influences cells near where it is secretedA transmembrane protein channel that opens or closes in response to a particular stimulus.A type of intercellular junction in animal cells that function as a rivet, fastening cells together...

Florida Word Search 2025-09-07

10 Items: state treestate animalcapital of FLstate reptilecurrent governor of FLcurrent mayor of Tampacounty that Tampa is inland with water on 3 sidesFL city with the largest populationmajor FL city that is known for theme parks (Disney)

From Tortoises to Parrots: A Fascinating Dive into Animal LifespansAnimalsBirdsDogsCatsElephantsTurtlesFoodDietHabitat 2024-06-03

16 Items: dogscatsfooddietsizebirdssafetyanimalsturtleshabitatthreatselephantspredatorsprotectionmetabolismenvironment

Unforgettable Minds: Memory Marvels and Forgetful Friends in the Animal Kingdomelephantschimpanzeesoctopusesdogscatssquirrelsgoldfishguppiesantsmemorywater 2024-04-13

19 Items: dogscatsantswatertoolsfacesmemorytricksforgethidingguppiesgoldfishroutineselephantsoctopusessquirrelschimpanzeesintelligenceimpressively

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Fun Animal Brain Games 2026-03-20

4 Items: LionTigerMonkeyElephant

Dolphin Word Search 2025-02-11

15 Items: The largest marine mammalA small marine fish with a horse-like headA small, schooling fish found in the oceanLION A large marine mammal related to sealsA marine invertebrate with a star-shaped bodyA gelatinous marine animal with stinging cellsA large, predatory fish known for its sharp teethA slow-moving reptile, some of which live in the ocean...

911 Dispatcher 2024-10-01

77 Items: samtomdoaadammarynorapaulxraybombloudtextybakerdavidoceanqueenunionyoungzebraalarmbreaksecurdrunkfightlaserpartyfraudwagonedwardrobertvictoralarmskidnapperarmdumpindisturdomestexplospermisharassperdwnpersusinvestweapondamageanimalpersonpersonshotguncharleswilliamtheftinpershotdomweapoverdosperwelfweatherinjuredbatteryrunawaylockoutcontrolofficer...

One Year Anniversary Search 2025-12-04

23 Items: LoveKoreaTexasKamrynOneyearLettersAirportSungjoonage we metInternationalMost made dishAnniversary datewhere we first metfirst official datemy nickname for himmost used app to callFirst holiday together200 day anniversary spotwhere we had our first kissFirst place traveled togetheranimal of keychain he gifted meeachothers favorite physical feature...

Joyeux Noël ! 2025-12-08

33 Items: elftoystardollhollyangelchildscarfsleighcandlewreathturkeygarlandpresentsnowmanchimneyreindeerstockingYule logsnow hatchampagnecandy caneSanta Clausgingerbreadmulled wineChristmas treeNativity scenestuffed animalChristmas carolAdvent calendarChristmas marketthe three wise menChristmas ornaments

Animals 2025-01-28

8 Items: purr... get it?has a long trunkMan's best friendhas colorful wingsking of all the animalshas a long neck and is spottedbig and gray animal that lives in Africa.does it have black stripes or white stripes?

trs23 ver3 u4 2023-02-24

10 Items: A big cat.Really great.Not interesting.A kind of long pasta.Something you think up.Have fun doing something.#1. Better than everything else.A small animal that lives in trees.Ask someone to do something with you.A kind of chicken that makes noise in the morning.

yuyi's word search 𖹭 2026-02-03

13 Items: what we are hehefirst date drinksgo to burger place!how much i love youwhat today is aboutour favourite animalfavourite hindi songwhat we should do todayour favourite drink placeour favourite shared animefavourite John legend songcheapest yummiest korean nammost expensive thing we ordered

Finding secret animals 2025-11-11

9 Items: Man's best friendDied and came back to lifeUsed to skateboard in the 90's but now he's too oldA helpful animal with a shiny bald head and kind eyesMan's second best friend who's honestly just using him for foodKind of like a kite but it lives underwater and killed Steve Irwin...

Your Spirit Animal For The End Of March 2026-03-20

10 Items: CatDogSwanSnakeRavenHorseJaguarMonkeyElephantButterfly

sydney 2025-02-20

9 Items: indigenii aborigenio insulă din Australiamâncarea ursului koalao specie protejată de ursanimale cu marsupiu şi picioarecel mai vechi şi mai mare oraş dinactriţă australiană care săa făcutactor Australian care a jucat rolulanimal marsupial nocturn are trăieşte în

Gato Word Search 2023-03-03

20 Items: something people sleep onsomething people use to write ona very common house pet that meowsa very common house pet that barksa device people use to communicatea form of art people can listen tosomething people wear on their feetsomething people use to carry stuffa big gray animal with huge gray earssomething you open to get into a room...

Tulip, rabbit, reptile words 2025-11-14

18 Items: A womanA baby catSet on fireMouse or ratMake believePut togetherA sweet treatEating outsideA little flowerMore than enoughLearner at schoolA doctor for teethThe opposite of goodBlood drinking monsterLong-eared hopping animalWhat you sing and dance toA breakfast food with syrupA salty, crispy breakfast food

Can you guess? 2024-10-09

16 Items: My gradeMy little <3My hair typeMy hair colorMy favorite foodMy favorite colorMy favorite seasonMy favorite animalMy favorite musicalMy favorite holidayMy favorite subjectSomething I'm directingShow I've been a part ofMy favorite disney princessI wear these most of the timeMy preferred color of jewelry

Adv. Deutsch II Vögel 2 2025-05-11

30 Items: owlnutduckcrowwrenseedfinchstorkberrybroodthrushmagpieinsectto cawvulturesparrowto feedomnivoreto hatchwoodpeckerchiffchafffalcon, hawkdove, pigeonEuropean robinswallow (bird)to hunt, chaseto eat (animal)to tweet, chirpto shriek, screamfamily of birds including titmice, chickadees

Happy Birthday Bri! 2024-06-25

10 Items: Bri's favorite cake.Bri's favorite holiday.- Bri's favorite season- Bri's favorite color.Bri's favorite food - mmm crispy.Bri's favorite animal - think pink!Bri's favorite movie genre - amour.- Bri's favorite summer activity - not running!Bri's dream vacation destination - known for pasta....

Sopa de letras 2025-06-03

20 Items: Animal blanco con rayas negras.Brilla en el cielo por la noche.Instrumento musical con cuerdas.Se usan para cortar papel o tela.Herramienta que sirve para barrer.Utensilio para comer sopas o postres.Torre luminosa que guía a los barcos.Medio de transporte que va por rieles.Animal con concha que se mueve muy lento....

Puzzle Word Search 2025-11-13

22 Items: The gas we breatheA vast body of salt water.A mountain that erupts lava.An event with music and food.Often called man's best friendA person who travels in space.A colorful arc seen after rain.A place where you can find art.A sea creature with eight arms.The largest animal living on landA place full of books for reading....

10 minutes de détente 2023-03-16

30 Items: ville de papeville d'arènesérie du soirmaison du sudcolis du mardiévénement de 2024chevelure du liontriangle chocolaténagui y fait chantersoignant post mortemhéros de tes lectureshabitude du quotidienil peut être d'honneurton jeu de train préféréton jeu de carte préféréta boisson de la journéefumé italien que tu aimeston animal de compétition...

ww5 u 3 & 4 2024-03-07

29 Items: weaka choiceto leavetoo earlyvery largeto cover upto lose hopestrong windsto understandexact, correctno longer livingsavage or fiercea meat eating animalto make strong againa feeling of great joya longing for the pastnot exact but close enoughto break off or cut in twoa long journey by sea or spacean animal that is hunted for food...

Lion Word Search 2025-09-24

2 Items: A long wordAN African Animal

Puzzle #6. Palabras con A. 2024-05-24

80 Items: ajoalmaaltoanísaptoaquíarpaacosoajenoálbumaletaalzaranchoángelantesanualañejoapodoarenaardoralhajaalhelíaliciaaljibeacordeafilaráfricaagendaalarmaalemánalturaamargoamarseamasaranimalantojoañorarapenasarenalalianzaaclamaradentroafloraraisladoalambrealargaralcaldealondraaltavozaltitudamarraraméricaancianoanguilaapliqueapuradoarbustoarcillaárbitro...

US<3 2025-02-04

14 Items: kissesyour monthwhere we metyour fav gameyour fav personyour fav animalyour fav tv seriesone of your fav songsyou always crave thissomething we always sayyour fav comic charactersyou like this veggie a lotme to you,in your languagesomething you love more than me jk

English Word Search 2025-10-07

12 Items: place, time, moodbig idea of a storycategory of a storytop of plot mountainthe feeling of a storystory from imaginationintroduction of a storyperson, animal, or figureseries of events in a textcharacters that don't changeacronym for indirect characterizationtrue story using real characters and setting

Russia 2025-12-19

14 Items: beet soupfish eggsbiggest countrycapital of Russiaat war with Russiacapital of Ukrainepresident of RussiaSea south of Ukrainerare animal from Siberiadolls inside of each othersecond coldest place on earthclosest American state to Russiacountry with name like a US statesea that connects to the Black Sea

Vocabulary #22 2024-05-28

8 Items: a weak person or animalencouraging and nurturingto declare with convictionto believe something without proofwithout any doubt, very apparentlyto depend upon someone or somethingto propose as a candidate for electionsadness for what another is going through

Vocab word search 2024-04-26

12 Items: definition listening to ordersdefinition its like being treated crueldefinition to bark quick in a sharp tonedefinition something that supports wood for sawingdefinition a group of shelter like a bunch of tentsdefinition an inner voice bringing someone to rightness.Definition is when your crying and have tears in your eyes...

Unit 10 Vocabulary 2026-01-23

12 Items: easily moved or carriedHaving to do with sight or seeinga ruler or leader who has total poweran animal hunted as food by another animala severe shortage of food over a large areato open up, make or grow larger; to developeasily broken, snapped, or cracked; not flexibleto do away completely with something; to put an end to...

Pit stop - Food 2025-09-11

84 Items: HotDogEggTeaSaltSoyaMeatCakeCrabMealCafeKidsSoupBeerWineForkRicePizzaOnionSnackBeansItalyFruitJuiceDrinkWheatBreadSugarHoneySweetWaterOliveLunchKniveSpoonBaconToastGravyCurryPastaSnakeSheepburgerChilliPepperRelishTomatoCheeseBananaDishesHungryPeanutButterCerealAnimalPicnicBarleyDinnerLizardPrunesOrangeCoffeeHaggisLocustToppingSausageKetchupMustard...

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Naomie Crosswolrd edition 2026-03-10

13 Items: : Crush prime: vu que t’es lele: très impolie même: Toi de time en time: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: camer du côté de tik tok: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

Croton Polinators (some words are backwards) 2025-12-18

10 Items: Our town!Ruby throated…Inside of flowersIt’s in the title!A fluffy type of beePollinators Need it to live!A animal that’s terrified of bees…A flower in Croton that supports pollinatorsA place that’s Behind your house filled with flowersA special type of garden often used for different veggies

Animal Body Parts (Level 3 - Lesson 3) 2025-05-19

7 Items: catpawhornclawsteethtigerrhinoceros

Masculin Lettre A 2020-02-15

87 Items: anauâgeâgéairamiartabriaideangeaoutaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugle...

Masculin Lettre A 2020-02-15

83 Items: anauâgeâgéairamiartabriaideangeaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugleaccident...

Me & You 2024-06-19

11 Items: Our cityour best dateyour fave animalyour donut flavoryour fave Bee Gees songour shared home last yearyour silly little nicknamewhere we're getting marriedyour (alleged) favorite dessertthe gal we're gonna see in novemberthe band you started listening to after I forced you to branch out

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

merry christmas 2025-12-08

10 Items: first datemy step sonyour step sona word to describe youan artist we both lovewhat i ask for the mostmy favorite thing to dothe dog in our relationshipthe animal you remind me ofplace where you said i love you for the first time

Lisa and Rob's wedding wordsearch 2025-06-02

14 Items: City we live inRob's middle nameRob's birth monthLisa's middle nameLisa's birth monthName of our pet catHazel's middle nameMatching tattoo animalSchool we both attendedLast gig we went to seeOur most watched TV seriesOur first holiday destinationBig nut that brought us togetherWhere we hung out together in our teens

trs23 ver3 u8 2023-03-24

8 Items: A kind of flower.Wow! That is _________!A person who does magic.The clown does a magic _____.A kind of small, cute animal.Use this to keep your neck warm.Use this to keep your body warm.Use these to keep your hands warm.

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

PALABRAS HOMÓFONAS 2026-02-26

14 Items: buenos diascomida en casaquien te comentobella del orienteese puesto es mioun animal rumianteestá el trabajo listoeso es en las plantasque marejada tan fuertela comida a los animalesuna puerta en casa de mi tíaestá hermoso tu portaequipajeya basta ríndete no sigas luchandoes una buena forma de conseguir la carne

A'lana 2026-02-10

15 Items: creepyto freefree timevery correctto hold downa big mistaketo set on fireto add more detailthings at/from hometo put in your own wordsto go after someone/somethinga plant or animal no longer alivesomething the same as something elsesomething that is better than something elsetrying to convince someone of something fake

2 2025-02-07

10 Items: What kind of animal is Franklin?What famous comic strip is also the name of a food?What animal swore that one day he would kill Mowgli?Who is the youngest of all Winnie the Pooh’s friends?Who owned a hammer so heavy that only he could pick it up?What was the fourth word used in all the Harry Potter titles?...

The Actor Word Search Puzzle 2022-07-29

15 Items: ActorActorActorVideo EquipmentVideo EquipmentWilson's Main JobHenry Loves This AnimalJune Loves Creating ThisWilson Loves To Play This SportVideo Equipment (Use _ As Space)Henry's Main Job (Use _ As Space)June's Favorite Character To Play AsHenry's Favorite Character To Play AsWilson's Favorite Character To Play As...

Ben’s 25th Birthday Adventure Puzzle #1 2025-09-05

10 Items: Antlered animalThe big celebrationWhere the trails leadThe age you’re turningThe month of your big dayWarm glow under starry nightYour hobby with rods and reelsA small wooden home in the woodsA small boat powdered my paddlesWhere hidden treasures are waiting for you

Valentine's Puzzle 2026-01-24

10 Items: Your favorite foodYour favorite drinkWhat do I call you?Your favorite animalYour favorite flowerYou love these with buldakA place where you fought a warA place we shared many glances everydayYour answer to "Will you be my Valentine"The month we first met in the train tracks

Word Search Puzzle 2026-03-06

12 Items: A tiny ant is the (small) ______ insect in the garden.The blue whale is the (big) ______ animal to ever live.A cheetah is the (fast) ______ land animal in the world.If you get 100% on your test, your score is the (good) ______.The person with the widest smile is usually the (happy) ______....

Agriculture Revolution & Development of Civilization 2025-08-18

14 Items: Growing or making somethingThe growing of plants or crops.A person who manages and works on a farm.The act of gathering food from wild plants.Rich in nutrients and good for growing plants.The practice of taming wild animals for human benefit.The large-scale planting and growing of a single crop.Husbandry The organized raising and caring of animals....

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

To Kill a Mockingbird CH 24-25 Vocabulary 2025-04-09

11 Items: hesitationto find one’s waya thin surface layerconstant threat; coercionmoral or religious beliefssuspended until a later timesomeone who pretends to havefoul and repulsive; neglecteddevoted to divine worship or servicean undesirable animal, usually a scavengera device for blowing air on a flame in order for it to grow

trs23 ver3 u3 2023-02-24

12 Items: Sound.Scared.Not loud.By yourself.Wow! I am ____!From sunset to sunrise.You turn it on so you can see.Sleep in this when you go camping.When you eat in the middle of the day.Noise you make when you are very scared.Dogs, elephants, mice, lizards, chickens.Place where you can borrow and read books.

Creativity Word Search 2022-05-25

5 Items: of great significance or valuethe ability to do something wellusing thought or rational judgmentUse of the imagination or original ideasthe existence of an individual human being or animal.

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

PMC Tech Week Word Search 2024 By Dr. Kristin 2024-09-06

22 Items: Our RescueWe work atClinic CatDogs are __PMC ManagerOur Pet StoreBlood SpinnerOur newest vet!Our CorporationWho’s that girl?Dr. Chuck’s breedThe OG technicianDr. Todd’s nemesisNot just a mustardSqueeze with caution!Heather’s favorite animalDr Kristin’s fabulous dog!Diabetic monitoring systemThe Great Pretender (dfdx)Dr. Kristin runs a lot of ___...

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

April 2026 Word Search 3 2026-02-18

20 Items: a baby ducka young cowa young sheepa young horsea young rabbitoutdoor play areawalking leisurelymelodic bird callsa fruit tree flowera young bird in nesta bell-shaped flowera two-wheeled vehiclean animal tunnel homerunning at steady pacea tubular flower spikea toy flown in the winda large fragrant blossoma pink spring tree flower...

unit12 2024-02-28

12 Items: to agreenot strongto zone outfit to be seento turn arounda standard scalea thin tiny stripnot taking any sidea helpful thing for work or your housean animal or person that moves non-stopnot feeling sorry about something you didhurting for no other reason than to do it for fun

trs23 ie2 u4p2 2022-11-16

8 Items: More good.A bird's mouth.Birds use them to fly.Go up a ladder or a tree.It is at the back of an animal.Picture made with pencils or crayons.Birds have them all over their bodies.A place you can go to see wild animals.

Les larmes de l'assassin - chapitre 1-5 2024-03-06

12 Items: violenceserpentsimpressionnerNom de famille de PaoloLes ______ de l'assassinLe nom de la ville de Luis ?Animal donné à Paolo (p. 43)Auteur du livre : Anne-Laure _______Qui a gagné à la fin du chapitre 5 ?Nom du pays où se déroule cette histoireAngel utilise un _______ pour assassinerQu'est-ce qu'Angel a demandé à Paolo de cuisiner pour lui ?

united 2023-01-20

33 Items: leafsagemodemlaptopserverrouternutmegpenguinprinterwindowsdesktopcomputerdatabaseinternetfirewallhardwaresoftwarerosemarylavenderalligatorbandwidthcoriandertechnologyabsorptionthe study of mushroommain herb found in pestothe national spice of hungarythe main circuit board in a computerthe fastest land animal in the world...

Organization of Life 2025-02-04

82 Items: DNAFURDOGEGGKEYFOXLIFETREEFISHACIDTREECELLBEARSKINCLASSORGANPLANTFUNGIVIRUSGERMSTEETHORDERGENUSWHALECORALCLAWSAMOEBASYSTEMPHYLUMFAMILYSYSTEMENERGYDOMAINTISSUEARCHEAANIMALYOGURTDARWINTRAITSAVIANSSIMPLEKINGDOMSPECIESFLOWERSANTLERSMAMMALSBLOODEDCOMPLEXPROTISTBIOLOGYECOLOGYBLOODEDBACTERIAFLAGELLATAXONOMYLINNEAUSEVIDENCEREPTILESFEATHERSORGANISMBACKBONE...

Our Word Search 2026-01-25

13 Items: Our artistWhat you areOur first mealOur love languageYour favourite animalHow I know you love meMy favourite place to beOur children's hair-typeWhat makes us feel betterMy favourite name you call meMy favourite feature about youThe first anime we watched togetherThe class I was in when we started talking

Biotic and Abiotic Factors Word Search 2026-03-18

23 Items: A single living thingNonliving parts of an ecosystemHow hot or cold an environment isAnything organisms need to surviveAn animal that hunts other animalsWhen organisms rely on factors to liveAn animal that is hunted by a predatorA factor that restricts population sizeIncrease in size or number of organismsAn abiotic factor essential for survival...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Christmas 2024-10-23

7 Items: Animal that pulls Santas sleighFrosty winter figure made of snowDecorated evergreen for ChristmasHung by the chimney for small giftsSantas little helper in his workshopWhat you give and receive on ChristmasJolly man who delivers gifts on Christmas Eve

R Word Search 2026-03-11

2 Items: dallas's fav animalthe boy sitting next to you

Basketball Word Search 2025-04-04

89 Items: pianovideopotatotomatocamerabananaanimalcelerybicyclelibraryprivacyapricotvitaminladybugimagineanotherhistoryunhappybolognapajamasOctoberavocadobroccoliumbrellaenvelopetortillacomputerhospitallemonadecategorygiganticsandwichcoloringmagazinetomorrowSaturdayNovemberDecemberelevatormacaroniblueberryprincipalpiggybankpolicemantelephonebeautiful...

KERJAYA 2025-11-04

30 Items: DoulaActuaryShipbrokerProsthetistGeoscientistCIA LinguistFoley ArtistPuppet MasterHippotherapistEthical HackerCourt ReporterData DetectivePiano TechnicianWelding EngineerCity IoT AnalystVoice-Over ArtistWaterslide TesterMedical ScientistCreative CatalystForensic LinguistStunt CoordinatorAirplane RepossessorBlockchain ArchitectAnimal Control Officer...

Gatsby Vocab #2 2025-03-03

5 Items: a wild gatheringa plant or animal naturalized in a regiona slight suggestion or vague understandingcharacterized by extreme care and great effortcontented to a fault with oneself or one's actions

Materials 2025-03-27

16 Items: A thick and stiff type of paper used for boxes.A strong, heavy metal used in buildings and tools.Dried plant stems used for animal bedding and hats.A soft, fluffy fiber used to make clothes and fabric.A hard, natural material found in rocks and buildings.A shiny, yellow metal often used for jewelry and coins....

Kipling Word and Symbol Search 2025-02-04

30 Items: WinterCub CubBat BearCity ClawKing Kitelair Lairrat RiverRock RockCave ChickDeep DholeEarth EchoHare HillsWolf CopperHunt Jungleleaf LeavesMang MonkeyMugger MuskRun SeeoneeTrain WaterCold CounselLost MammalsSunlight ThePanther PeaceSilence SnakeWhispers WildCouncil CoyoteElephants FangFootprints FrogOutcast Outdoor...

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Draft 1 2025-09-03

94 Items: NPISKIDDMNDAESWSSAWESDDUFMMBUSPODSSURFZONEHOMECODEDISCKASSCADSOCHENRYSTUDYGAMESMOTORNURALOMEGAHANGARONTRACVISNAVCLARKEWALTONBEAUTYDIETFCDYSONGVACUUMANIMALMAXWELLJACKSONVILLAGELIBRARYCHAPMANCYCLONEJEMISONAIRWRAPFARMINGMOROCCOMAHJONGBIGBANDCONCORDETRAININGROEBLINGMALAYSIASECURITYHAMILTONGILBRETHAIRBLADEDELIVERYCLIMBINGROCKSTARBIRDCAGEISTANBULCHITOSAN...

DIET MEGA WORDSEARCH 2025-09-08

92 Items: DDMDDUNDANPISKIWESFMMMSCSSAPODSHOMEZONESURFBENGDISCMENGHENRYMOTORNURALOMEGAADSOCKASSCGAMESSTOMPSTUDYHANGARCLARKEWALTONANIMALONTRACVACUUMVISNAVBEAUTYDIETFCDYSONGCHAPMANLIBRARYJACKSONMAXWELLVILLAGEJEMISONAIRWRAPCYCLONEFARMINGBIGBANDMAHJONGMOROCCOCONCORDEMALAYSIAROEBLINGGILBRETHHAMILTONAIRBLADECHITOSANDELIVERYEMBEDDEDSECURITYCLIMBINGROCKSTARTINTAGEL...

unit10-grade9 2026-03-30

20 Items: animal wastevery importantfood for plantsan animal's homevery interestingbalance in natureto damage or hurtspace beyond Earthto value somethingto watch carefullya shape of the landsomething dangerousextremely importantto go around a planetto influence somethinga protected natural arealand with a lot of grasschanges in weather over time...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

English Vocabulary Crossword 2026-02-27

87 Items: - Sky hue- Snow hue- Sun shade- Light red- Deep blue- Arm joint- Misty air- Feline pet- Earth tone- Shiny gray- Flower hue- End of leg- Moving air- Pack hunter- Liquid meal- Grass color- Night color- Grape shade- Taco origin- Ice pellets- Grows crops- Two-wheeled- Baked staple- Mixed greens- Grain staple- Joint in leg- Pyramid land- White flakes...

Animales 2024-08-27

2 Items: Qué animal salvaje tiene un cuerno en su nariz y una piel gruesa.Qué animal salvaje es conocido por sus aullidos y pertenece a la familia de los cánidos.

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

Mulan 2026-02-18

8 Items: Showing courage.A person who fights in battle.Mulan's loyal animal companion.The leader of China, who Mulan serves.Mulan disguises herself to become one.To change appearance to hide one's identity.Respect or good reputation, crucial to the story.The main character who disguised herself as a man.

Wedding Wordsearch! 2025-07-06

9 Items: The best man's name.Toms favourite sport.Where they got engaged.Bec's favourite animal.The Man of honour's name.Where they had their first date.The best (men's) football team (according to Bec).The best (men's) football team (according to Tom).Who performed the song Bec walked down the aisle to.

2B Lesson 1-3: Make a Drum Set, The Animal Band, Musical Glasses 2025-12-15

30 Items: AddCanHitIanLidLowTapBoneDrumHighKikiKyleShowSoupBaronCarolFluteGlassGuessSoundTrunkBottomSingerDrumsetGlassesKitchenTrumpetDifferentDrumstickOrchestra

Anniversaire 2024-03-24

13 Items: 1500Dans quel lieu ?Un point cardinalUne note de musiqueQui n'est pas encore mûreLà où le soleil se couchemettre à l'abri des regardensemble de pièces de monnaieAction de pour-suivre quelqu'un, un animalQui indique l'unité de début dans une sérieFaçon de s'exprimer, intensité d'une couleurCe qui guide dans une recherche, suivre une piste...

trs23 ver3 u2 2023-02-16

10 Items: Ha ha ha.Jump into water.Don't do something.Water that goes far down.Some water you can swim in.An animal that swims and jumps.What you get when you hit water.A colour between white and black.Between two corners. A dice has six.The place where you can walk across a road.

Jobs 2026-01-29

10 Items: Who works at a bank?Who works at a cafe?They work at a theatre.Who works at a hospital?Who uses a lorry at work?Who works for an airline?Who works at a flower shop?Who works at a meat market?Who works at an animal clinic?Who makes the food at a restaurant?

Animal Body Parts (Level 3 - L2) 2025-05-19

5 Items: necktusktrunkgiraffeelephant

Clare's Big/Little Clue 3 2024-02-22

10 Items: What state am I from?What is my hair color?What sorority am I in?What color are my eyes?How many dogs do I have?Where do I do to college?What is my favorite movie?What music genre do I like?What is my favorite animal?What jewelry color do I like?

Medical Terminology C. 5 - The Body as a Whole 2024-11-13

10 Items: groinred blood cellblood productionpertaining to the tailpertaining to the extremitiesparalys of one or both eyelidsinflammation of the peritoneumdestruction of red blood cellscancer cells spreading to sites away from where they originatea minute microorganism that replicates only within a cell of a living plant or animal

Amazing C 2026-02-11

15 Items: We sit on thisWe see the timeI's a sea animalWho lays the eggs?We drive with thisWe color with thisWho makes the milk?It is made of sugarRain falls from thisMouse's favorite foodRabbit's favorite foodIt's inside the schoolWe eat this on our birthdayWe wear this when it's coldWhat's the weather like in winter?