animal Word Searches

Really? 2025-01-10

22 Items: What fruit is slightly radioactive?What is Cookie Monster's real name?What animal sleeps with one eye open?One in 18 people have this extra body part.What were chainsaws originally invented for?The speed of a computer mouse is measured in?What is the hashtag symbol technically called?What is the most shoplifted food in the world?...

Seagrass October 2025-09-05

18 Items: aliveeatingenigmavisitorfriendlyneeds helpon our ownsandy shoremidday mealhairdressingwhere we swimanimal friendscity just norththe state we're inplace for social hourfor playing hand and footwhere ocean meet the sandnearby large body of water

Flower Word Search 2023-04-17

5 Items: a animala plant that growssomething to write witha place where kids learnwork given to do at home

Republican and Democratic Parties Animal Symbols Cross Word 2025-10-08

13 Items: nastpanictweeddonkeythomassymbolharperlincolncartoontammanyelephantcampaignpolitical

French Word Puzzle (Casse-tête de mots en français) 2024-11-27

22 Items: The number 30The verb to be?The verb to go?What do you read?The verb to like?Where do you live?What animal barks?What animal meows?The verb to speak?First month of the yearWhat is a high landform?Where do you go to learn?What do you drive on the road?What is the light of the night?What do you drink to stay hydrated?...

Rainbow Word Search 2025-09-16

6 Items: HorseGod's sign to NoahPost Office purchaseAn old-time record playerA sneaky gift to Troy (2 words)A make-believe animal with a horn

Diabolical Word Search 2024-08-06

69 Items: PigCowAntSkiCoolAuntKingBakeNeffQuickThumbProudShareLemonPlazaJesseSecretAnimalDonkeyAntlerMelodyZipperBasketMizzouTrumanGalenaTigersFaroutNoxiousPopcornMinimumDogwoodLibraryCornellHearnesColumnsRespectMissouriProofingBlushingInfringeFootballHospitalColumbiaHawthornLafferreMountainsGarrulousRelevanceTranslateAmbiguitySouthwestDiscoveryDiabolical...

1223 2026-01-07

70 Items: SunFurDaySeeFunSkyIceHatSnowColdWarmHoleTailPawsEyesEarsTreeSignLookHideWakeLongCuteWaitTownTimeDarkWindCloudFieldGrassSleepEarlyShortFurrySmallBrownEarthWatchCrowdStoryTodayLightFrostScarfBootsShadowWinterSpringBurrowAnimalForestNatureInsideSeasonGroundLegendJacketGlovesWeatherMorningOutsidePredictComeoutHolidayFebruaryCalendarTomorrowGroundhog...

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

CR Amex team 2022-09-29

17 Items: teamsureLDA's petpuntarenasCR capitalmarried manmommy to beproud to beSaprissa' petwhite last namebreakfast to goCosta Rica lifestylead dealers main functionseasonal fruit 2mil el Keveryones fav college drinkCr most exported fruit 2019unexpected animal that joins zoom meetings

Ben’s Giant Animal Word Search 2022-08-25

6 Items: catlionzebrahippoelephantMan's best friend

Cat Word Search 2022-09-15

6 Items: dog's enemyMan's best friendthe king of the junglebiggest mamal in the worldhave white and black list furdangerous animal ini the world

Pros y contras de tener una mascota 2025-06-02

9 Items: Valor que debe tener para hacerse cargoDesarrollo de lazos emocionales; vínculo fuerteBeneficio físico y mental que puede aportar una mascotaSensación de no estar solo, especialmente con un perro o gatoPuede presentarse si el animal hace ruidos o destruye objetosReacción que puede tener la gente ante la presencia de una mascota...

Pig, oink! 2025-12-13

10 Items: a pink tribe...The animalWant a sprite?...Mircusfan81First challenge!Ghosty merge tribe!Something that pigs sayFirst boot of the seasonOne of the oink variants,Could mean a trolls protagonist, or a Dandy's world starter!

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

Movies 2026-02-15

7 Items: Pope selectionReligion done rightChalamat's magnum opusLost hearing watching imaxLittle boy made me breakdownAnimated animal movie with no dialogueTarantino movie with a part anime section

Animal Assisted Therapy & OT in Acute Care 2025-04-19

10 Items: BalanceBenefitsEnduranceFineMotorMotivationEngagementPrecautionsFunctionalTasksPatientCenteredOTInterventions

Word Search for Dementia Care 2026-03-10

10 Items: helps you seea round fruitlives in watera drink from cowsyou play with thisyou wash with thisa small pet animalyou listen to musicsomething fun to playyou wear on your feet

Clue 2 2026-03-23

13 Items: a colorur majorur allergyur fav showConnor Pennur fav movieour mascot animaldorm hall by DATCUa piece of jewelryur personality traitnot your talons familywhat you do at the gymwhat someone is called when they are crazy

Welcome to Dr. Puzzleverse's Word Search Puzzle - Animal Edition (#1) 2025-01-17

27 Items: OwlFoxLionWolfBearZebraTigerPandaKoalaSharkEagleWhaleSnakeParrotRabbitMonkeyTurtleGiraffeDolphinPenguinCheetahLeopardOctopusElephantKangarooFlamingoCrocodile

unit 16 2024-04-24

12 Items: roughnot bendingto get alongextinct animalto stuff tightlycapable of growingto take upon oneselfsomething that protectsan action that is wrongto supply with furniturea person of the same ageto expose to injury or harm

David Word Search 2024-10-20

14 Items: Who annointed David?Who was David's father?Who was David's best friend?What instrument did David play?Who was David's great grandmother?What King wanted to have David killed?What animal did David tend for his father?Who was the Philistine that David went to battle?Who was the woman David saw taking a bath on a roof?...

62) NOMBRES DEL REINO ANIMAL PARA BOSTON TERRIERS 2026-01-13

12 Items: RanaTopoLinceFénixCebraCarpaGorilaÁguilaDelfínGrullaHalcónBisonte

Dog and animal word search 2026-04-01

6 Items: catlionzebrahippoelephantMan's best friend

A WORDS 2024-02-01

73 Items: asatactaddageagoairallandanyarmartaskablealsoareaawayaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattackauthorabilityaccountaddressagainstalreadyanotherarticleactivityactuallyalthoughamericananalysisanythingapproach...

Wedding Wordsearch 2025-02-18

20 Items: Luke's best manLuke's middle nameLuke is Stacey's...Stacey's maiden nameStacey's maid of honourStacey/Here comes the...Luke & Stacey's last nameTheo and Arthur are the...Mollie and Chloe are the...Luke & Stacey are 'Just ...'what type of animal is Bun-Bun?The name shared by the most guestsWhat type of animal watched Luke propose?...

Vet Med Term Word Search 2025-12-01

32 Items: WartsFat tissuePain (suffix)Dead on arrivalAbsence of teethA newborn animalA neutered male rabbitLacking normal muscle toneSoftening of tissue (suffix)A complete joint dislocationDull, depressed, nonresponsiveThe cause or origin of a diseaseThe way an animal moves or walksA tumor made of mucus-like tissueLethal dose (amount that can kill)...

Animales del bosque 2024-08-22

15 Items: Mamífero elegante con grandes astas, que habita en bosques y montañas.Predador canino, símbolo de fuerza y unidad familiar en la naturaleza.Mamífero salvaje de gran tamaño, conocido por sus colmillos y su fuerza.Ave nocturna con grandes ojos, conocida por su sabiduría en la mitología....

trs23 ver2 u12 2022-11-25

10 Items: 100use your teethopposite of thina big, scary fishopposite of lighta yummy thing to eatcan lift heavy thingswill make you feel scaredtry to run and catch somethingthe outside of an animal or person

Payton's Clue Week Day 2 2025-10-12

10 Items: Your big's star signYour big's cat's nameYour big's dream careerYour big's favorite foodYour big's first concertYour big's favorite colorYour big's favorite movieYour big's favorite flowerYour big's favorite animalYour big's favorite holiday

Norway Polar Puffs Word Search 2026-03-02

11 Items: Oslo - The capital of NorwayFjordland - Norway's most famous natural gemSkiing - The popular winter sport credited to NorwayReindeer - Christmas's famous animal found in NorwayScandinavia - The European subregion where Norway is foundAurora Borealis - The natural phenomenon also known as "Northern Lights"...

Les mots de Bibracte 2020-04-10

73 Items: fermurrueabriansearmeboiscireclefclouepeehaieminemiremontorgeparcsitearbreautunaversbijoucesardomusecoleeduenelevefleurforgeforumfoyerhachehetrerepasanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedessindoliumfauconreleveamphorearverneatelierbeuvraycollegecollineconcertcouventassiettebatimentbibracteboucliercervoise...

School 2020-11-30

72 Items: catdognotteatenrunfunbigsunfoxcowjimlionpenstimewithsaidmilknoonmoonwolfgolfkiwidocsnotszebrahippomathsbookspaperbikesbreakfruithorsetrackafterclassdriveanimalinsideplayedchromeminutepeoplehitingsitingpersonaroundgooglewritingreadingmoaningteacherarguingplayingoutsidepencilsmorningfriendscartonsrunningchickenstudentelephantlearningfightinglistening...

Biology Terms 2025-08-26

75 Items: DNARNACellGenePreyBirdFishLipidClassOrderGenusNicheBiomeVirusPlantAlleleGenomeEnzymePhylumFamilyFungusAnimalMammalNucleusVacuoleProteinHormoneOsmosisKingdomSpeciesEcologyHabitatArchaeaProtistReptileRibosomeLysosomeMembraneCellWallMutationTaxonomyPredatorBacteriaCytoplasmOrganelleAminoAcidDiffusionEvolutionCommunityEcosystemBiosphereSymbiosis...

2nd Grade Practice 2025-11-30

72 Items: ouroldanyskytrynewairfourintobothkindmostgiveonlyalsoweekdoeslongwellpartlandgoodyearcityliveknowshowmoveoverabledoorworkroomthingtheiraftersmallthinktodayrightplaceunderwhichagainlargelearnworldfoundhousesoundgreatmeansalmostchangefollowpeopleacrossanimalbecomebeforebehindletternumberaroundschoolanotherpicturethoughtthroughanythingsomething...

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

Instructions 2026-01-14

32 Items: FastGo upHave toNot fastAfter thatAfter thatAt the endUse scissorsSave someoneIn a safe wayIn a soft wayWithout dangerLift somethingMake somethingPlace somethingMove on your feetBefore anything elseIt is a good idea toTry to find somethingPut something somewhereHold and take somewhereAttach with glue or tapeA tall plant with leaves...

Final Exam Review 2026-03-31

30 Items: Joint painItchy SkinYoung sheepWithout painRed blood cellTo remove hornsintact female catStudy of the skinWithin the muscleRefers to the backWay an animal movesReferring to two sidesPeriod after a seizureExternal portion of earMove towards the midlineImaging using sound wavesControls circadian rhythmTop of the head in equines...

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

Wicked 2024-12-07

61 Items: OzHatCryBoqManWandGoodShizRoseCityBickbandBroomNessaGlindaUplandThroppWickeddragonCoddleElixirWizardFiyeroGalindaPfanneePopularElphabaGravityAnimalstornadoGlassesmonkeysShenShenGoodnessMorribleslippersBallroomDefinishOutuendoDulcibearDillamondScarecrowBraverismGrimmerieWickedestRejoicifyprofessorsWheelchairSwankifiedWizomaniacHideoteousGalindafied...

Trick Words 2025-06-10

74 Items: wonsonbothfulltalkpullwalkdonegoesusedknowsureonceknewawayheadloseJulyonlymoveshallagainoftengreatreadywhoseearlyoceanpiecelaughyoungplaceworldearthlearnhouserightprettypleaseanimalalwaysMondaycousinboughtenoughAugustcoupleanswerfathermotherschoolagainstcountryTuesdaybroughtJanuaryspecialtroublepicturebrotherthoughtAmericafavoritetomorrowThursday...

The Great Christmas Wordsearch! 2025-12-19

74 Items: sixiceelfboomapsnowcoldtreestarbellclapheroplugwiretreeleafrootseedstembirdfishdiettimesevenfrostsantaelvescarolpartypantostagecheermagicfairypowerplantriveroceanglobeshapewintersleighbaubletinsellightsprinceenergysocketswitchfloweranimalmammalforestnumbersnowmanchimneycurtainvillainbatterycircuitreptilehabitatreindeerpresentsstockingaudience...

Les mots de Bibracte 2020-04-10

73 Items: fermurruevueabriansearmeboiscireclefclouépéehaiehouxmiremontorgeparcurnevertarbreautunaversbijoucésardomusécoleéduenforumhêtremeuleoutilanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedoliumamphorearverneatelierbeuvraycollègecollineconcertcouventtruelleassiettebâtimentbibracteboucliercervoisechantierchapellechaudron...

Noah's Ark: Genesis 6-9 2023-07-15

14 Items: Who loved God? (page 27)What covered everything? (page 31)The people _____ about God. (page 26)What did God put in the sky? (page 33)What did the dove bring back? (page 33)What animal did Noah send out? (page 33)What did God tell Noah to make? (page 28)Noah and his family _______ God. (page 33)How did Noah and his family feel? (page 32)...

How well do you know me? 2025-09-09

15 Items: biggest fearfavorite foodfavorite musicfavorite animalMy favorite colormy height is 5’_”what makes me laughfavorite pizza placeLeast favorite colorMy moms maiden name isfavorite pair of shoesFavorite family membermorning or night personDream vacation is in the…how many places I’ve lived

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

test4 2026-03-01

10 Items: fasttwo timesnumber to addman-made clothhole made by an animalMakes things from clayCrunchy snack or cookieA big land like India or USAthin threads, also a nutrienta sick person who gets medical care

Good Word Search 2024-04-30

7 Items: bonroi des animauxdire quelque choseplanete qui a beaucoup d’eauanimal grands et fin qui rampesentiment quand tu perds ton perefruit rouge qui tombe des arbres d’après Newton

Posties Big Read 0212 2024-01-22

6 Items: doubting that something is true or usefulsolid waste that comes from the bottom of a person or animala large, black and white animal that lives in forests in Chinaa soft, wet substance made from wood, which is used to make papera tall plant with hard, hollow stems, often used for making furniture...

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Year Word Search 2026-01-01

12 Items: not oldwhat we eata special daya bright colora light decorationa time of 12 monthspeople we live withbringing good thingsshows days and monthsanimal signs for yearsthe light in the night skyto make something not dirty

Decifrando a Páscoa 2023-03-16

6 Items: Semana...Alimento do coelhoLugar onde se guardam os ovosAnimal que representa a PáscoaDia da Páscoa no calendário semanalProduto que são feitos os ovos de Páscoa

Animal Word Search Puzzle Book: Fun & Challenging Brain Games 2025-03-12

14 Items: lionzebrahipporhinohyenababoonjaguargiraffecheetahgorillaleopardelephantkangarooantelope

Cat Word Search 2023-05-02

10 Items: Wild dogLand Sea horseMan's best friendWomans best freindKing of the junglesomething you sleep onworlds largest land mammalpineapples don't belong on _____Animal with stripes in the savvanahthe old way of transportation without cars

Lollapalooza Word Search 2026-02-14

7 Items: Our first dateHalloween dateOur old hang out spotOur nicknames recentlyThe month we got togetherWhere we had our our first kissThe name of our first stuffed animal

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

ANIMALS AND ITS BODY PARTS 2025-11-12

15 Items: CatDogDeerLionFishhippoParrotOctopusElephantit's got a beakit's got long neck and it's yellowit's got black stripes and it's whiteBig animal, it's got big teeths and it's brownit's got long neck and it's white; it's a birdit's got a tail and it's brown; it lives in the jungle

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Spanish 2023-04-28

27 Items: seazoocitylaketreebearbirdplacemuseumanimalmonkeystadiumtheatermonumentto learnto visitto sunbathenational parkto go boatingamusement parkplay (theater)country, nationto ride a horseto buy souvenirsto rest, to relaxto scuba dive/snorkelatracción, attraction, attractions

Can You Finish This 2023-09-05

76 Items: asatbyaddageagoairallandanyarmartaskbadbutbuycanablealsoareaawaybabybackcalladmitadultafteragainagentagreeaheadallowalonealongamongapplyarguebeginbringbuildaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistbeforebehindbudgetcameraabilityaddressagainstalreadyanotherarticlebrotheractivityactuallyalthoughamericananalysisanything...

3000/2 2025-02-22

78 Items: ahAMageagoaidaimairallandanyaideAIDSallyalsoafteragainagentagreeaheadalbumaliveallowalonealongalteramongangerangleangryapartappleapplyagencyagendaalmostalwaysamountanimalannualansweranyoneanywayappealappearagainstairlineairportalcoholalreadyamazinganalystanalyzeancientanotheranxietyanybodyanymoreappointaircraftalliancealthoughAmericananalysis...

Hannah's Word Search 2026-04-08

78 Items: dodogredtandueboxpinpenbedartgymballformlinebluepinkbowldoortimefirenameselfbookhookwallokaynotegluestemvalueshapespacecolorpaintgreenblackbrowntrickpaperboneslightwhiteclockwheelshelfnightstandtablepapermusicorangeyellowpurpleletterflowerspongerecordanimalnumbersimplepersonpencilmarkercrayonpencilstickysquishytexturecrystalcoloredblenderspecial...

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

Evolution Unit 2024-12-05

9 Items: father of evolutiona permanent change in the DNAgradual change in a species over timetype of coloration for when an animal blends in with its backgroundorganism has the best chance to survive, reproduce, and pass on traitsis a trait that makes it very hard to see an animal in its natural habitat...

Word saerch page 21 ANIMAL BABYS 2015-07-21

7 Items: POTROPICHÓNOZESNOBECERROCORDEROCACHORROBALLENATO

Valentine Day Word Hunt 2026-02-10

10 Items: My zodiac signOur first tripOur lucky numberYour favorite barWhere we first metYour favorite animalWhat was our first dateWhere we said I love youOur favorite fast food restaurantWhat country we want to travel to

How well do you know Aisha? 2025-10-06

10 Items: Her favorite showThe Inni loves mostThe place she hatesHer favorite chocolateThe only meat she eatsThe subject she studiedThe place she grew up inHer favorite Indian snackThe animal she can’t standHer favorite travel destination

Animales - Colores - Emociones 2023-03-02

4 Items: someone who's happy (male)the color of Colombia's flagsomeone who's excited (female)big animal that throws water at you

trs23 ie2 u6p2 2023-02-07

10 Items: Not the same.Green thing with leaves.E.g. chicken, pork, beef.E.g. bread, rice, noodles.E.g. milk, cheese, yoghurt.E.g. sardines, tuna, salmon.E.g. lettuce, carrot, potato.E.g. apples, bananas, oranges.E.g. lion, dog, crocodile, mouse.Some food between two pieces of bread.

애완동물 Word Search 2024-09-08

25 Items: nowfishyardbabya petchickhouselatermotherfatherto dieto liketo livetogetherapartmentto be sadto be bigdog, puppyto grow upto be goodto be rightmiddle schoolto hate, disliketo hear, to listen toto raise, to grow animal

Across Word Search 2025-05-11

19 Items: downseedsacrossto heredityof cereal cropsgrain from chafffor storing grainused to kill pestsland for cultivationused to kill insectsgrain from the plantwaste used as fertilizerfor sowing seeds in rowsseeds of leguminous plantscrops to improve soil healthfor harvesting and threshingthat fix nitrogen in the soilscience or practice of farming...

The World at Night 2025-10-16

10 Items: Having two equal or matching halves.Extremely interesting or captivating.The measure of how hot or cold something is.Active at night and sleeping during the day.An animal that is hunted and eaten by a predator.An animal that hunts and eats other animals for food.A small mammal with sharp front teeth, such as a mouse or rat....

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

Tricky Words 2025! 2025-12-02

77 Items: areherwasyouputsawanywhowhytwoouraskI’msaidveryhavewerethentheyherewhatwantsomeoverhomeyourlovemanysaysfourworkbabylastfastfindonlykindopenknowtalkwalktherewhereagainhousethreeaftertheseaboutgreattheircan’tdon’totherwatereverylaughfriendschoolmotherfathersistercousinfamilybeforedidn’talwaysanimalpeoplebrotherbecausethoughtanotherchildrencouldn’t...

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Les mots de vocabulaire 4e classe 2022 *** 2022-01-13

77 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachejaunevoleravrilmarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterrampertomberorangevioletmangeroiseauautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercreusermarcheranimauxchercher...

2nd Grade Fundations Trick Words 2025-05-13

78 Items: wonsonuseJulyloseheadawaycitymoveonlyonceknowknewusedsuregoesdonewalktalkbothpullfulllaughpiecewhosewhosegreatlearnearthworldcarrynighteverylargeeightplacerighthouseoftenagainshallAugustenoughboughtMondaycousinschoolmotherfatheranswerfamilychangealwaysanimalpleaseprettyspecialJanuarybroughtTuesdayAmericathoughtcountrybrotherpictureagainstdaughter...

trs23 ver2 u7 2022-10-19

10 Items: 365 dayslittle animalclean with watermeal at 12 o'clocksomeone in your familymake a picture with a pencilby yourself, just one personTomorrow I ____ go to school.You ____ to drink water every day.It is 4:20p.m. Class will finish ____.

Encontra a palavra: TEMA JOANA 2026-01-09

7 Items: A minha cor favoritaO meu animal favoritoA minha comida favoritaUma viagem que gostava de fazerA minha estação do ano favoritaA minha marca de chocolate favoritaUma das áreas que acho interessante

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Tricky Words 2025-11-04

78 Items: sawanywaswhywhoasksaidtheyloseonlyknowweremanyherewerehomewhatworkwomenafterlaughtheirbuildhouseabouteverytherewheregreattheseothercan’tdon’tcouldwoulduntilwomanwherebeforealwaysacrossmotherfathersisterschoolcousinthougharoundshouldfriendfamilycaughtpeoplereallyanimalboughtbelievealrightalreadybrotherthroughminutesanotherdecidedbecausethought...

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

Marine Animals 2025-01-06

8 Items: It is a mammal.It can sting you.It lives in a shell.It has got 8 tentacles.It has terrifying teeth.Patrick, from Sponge Bob.It walks from side to sideThe biggest animal in the world.

Afro Word Search 2025-11-19

10 Items: Animal que voa à noiteInseto com oito pernasDoces dados às criançasEstrutura óssea do corpoCriatura que bebe sangueMulher com poderes mágicosEspírito de uma pessoa mortaRoupa usada para se fantasiarLugar assombrado por fantasmasFruta laranja usada para decoração

Random stuff im learning :D 2024-01-18

11 Items: live in a shellsad__ - adverb -slow__ - adverb -quick__ - adverb -5/7 - 2/3 = ? - simplify -2/3 - 3/8 = ? - simplify -6/7 - 2/6 = ? - simplify -4/6 - 4/8 = ? - simplify -4/5 - 2/3 = ? - simplify -an animal that unpollutes waterpeople were over harvesting them in Chesapeake Bay

Unit 12 2024-02-26

12 Items: improperpoorly madea thin stripto agree withshowing no sorrowto stun or confusefit to be inspectednot taking any sidesa standard measurementto turn around a central pointa machine or tool used to do household jobsan animal or person that moves to different regions

 2026-03-11

12 Items: : Crush prime: vu que t’es lele: Personnage de jeu: très impolie même: vu que je suis animal: vu que t’es ivoirienne: comme t’es une mundibu: vu que je suis un fruit: quand t’es sous mini jupe: mon pain version congolais: onomatopé ivoirien sur nous: parle bien des cheveux de Ndoyi

Family 2025-11-25

12 Items: plural of footcheveux bouclésplural of mouseYour mother's sisteryour father's brotherMarge Simpson's husbandI am not small, I am...Prince William's brotherBrothers born on the same dayanimal de compagnie en anglaisCharles and Camilla are husband and...Fester Addams doesn't have any hair, he is...

UAE Animal Word Search List 2026-03-17

5 Items: A graceful desert-dwelling animal.A critically endangered sea turtle species.The national bird of the UAE, used for falconry.A marine mammal found in the UAE’s coastal waters.A rare and endangered big cat found in the mountains.

Renaissance 2025-05-23

10 Items: basic rulemounted gunproceed towardunderlying basisgrow or develop healthilyexpert or student in astronomyrepresenting the sun as the centera carved figure of a person or animalagricultural laborers with low statusa continuous area or expanse which is free

Identify these objects 2024-09-20

10 Items: Pet that BarksSomething you readWater from the skyPet that chase miceA home built by birds.Animal that loves cheeseSomething you write withSomething you wear on your headTall plant with leaves and branchesA small container used for drinking

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....