animal Word Searches

CELER'S WORLD 2025-11-11

18 Items: Irunssevenhillshellostoryalways(I) amI livefriendsbig (masculine)friend (feminine)friend (masculine)the narrator's nameMONTIBUS on the hillsbelonging to me/mine (feminine)city where the story takes placekind of animal that narrates the story

Sukkah Word Search 2023-09-21

19 Items: schach must grow from thisschach must be _ from the groundschach can't become spiritually _animal _ can't be used for schachThe sukkah must be at least 10 _ tallThese must be put up before the sechachThe sukkah can't be higher than 20 _ tallThis must be put on the sukkah every yearThe sukkah must be at least _ tefachim wide...

Christmas words 2025-01-03

15 Items: white iceman in redfrozen waterholiday plantringing soundhang for giftsheavenly beingChristmas songslight in the skyround decorationfun gift for kidspresent for someoneanimal with antlersfigure made of snowlight for decoration

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

South America Funny 2025-07-03

15 Items: What does a lazy volcano do?What's a dancer's favorite dip?What grain is always feeling super?Where do mountains go for a spa day?What fruit says "Bonjour, bonjour!"?What do you call a dramatic pack animal?What fish writes the best scary stories?Where do super strong women like to shop?What animal is always dressed for winter?...

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

animals, animal noises and places where animals may live 2013-02-15

19 Items: catdogpigratliongoatbearbearbirdpumazebrahipposheeppolarmousebunnydonkeyanimalselephant

Noël 2024-12-13

28 Items: elftoystardollhollysleighcandlewreathturkeygarlandpresentchimneysnowmanornamentreindeerstockingYule logchildrenchampagnecandy canegingerbreadSanta Clausmulled wineChristmas treenativity scenestuffed animalChristmas carolChristmas market

Nature's Classroom Word Search 2023-11-15

58 Items: preysoilacidhikeadaptnymphbioticcanopyedibleexotichydriclichenmammalnativecenterabioticaquaticaquiferof preydiurnalecologyextincthabitatreptileboatingdomestichumiditymollusksomnivoresandhillsamplingsurvivalcompoundamphibiancarnivorecommunityecosystemelevationherbivorenocturnalcamouflagecrustaceanendangeredcrepuscularevaporationgroundwater...

Useless Word Search 2025-09-15

5 Items: Young at heartGood for nothingThe inside story?Blood vessels to the heartTusked animal of the far North

Angora Goats 2025-11-27

20 Items: A young angora goatA group of angora goatsThe coat of an angora goatA type or kind of livestockThe standard of mohair fibreSomeone who raises angora goatsIndustry that uses mohair fibreSending mohair products overseasThe grassy area where goats grazeHow goats feed on grass and plantsFarm animals raised for production...

Guinea pigs! 2025-06-15

19 Items: An orange vegetableThe act of eating faecesAn animal that eats plantsTerm for a male guinea pigThe technical name for pooTerm for a baby guinea pigTerm for a female guinea pigA type of hay from oat grassCaused by a lack of Vitamin CA type of faeces to be consumedThe genus guinea pigs belong toA breed known for their spiky fur...

How Well Do You Know Your Wife? 2024-07-18

15 Items: shoe sizemiddle namefavorite coloriloveyousomuchdream pet animalcantwaittoseeyoufavorite NBA teamanniversary monthmy favorite smellwhere is my home?boil favorite foodhow many kids do i wantfavorite sibling ( my own )favorite wingstop wing flavormy favorite color hair on myself

Dog Word Search 2024-10-17

10 Items: A soft and independent pet that enjoys lounging and purring.An aquatic animal that lives in water, typically kept in an aquarium.food Special food made for pets like dogs, cats, and other domestic animals.A legless reptile that slithers, sometimes kept as a unique pet in terrariums....

Yukki x Yuno 2025-08-19

11 Items: Chipmunkfavourite animefavourite mangafavourite animalcommon spiritual goalwhat you hate me sayingphrase I hate you sayingour favourite board gamelanguage learning togethermax number of kids we havingfavourite thing to watch together

SAMPLE GRIDLOCK 2025-08-08

15 Items: An expression of happinessA vehicle that runs on tracksA piece of furniture to sit onThe natural satellite of EarthA large natural stream of waterA plant with a trunk and branchesAn animal with feathers and wingsA white liquid produced by mammalsA staple food made from flour and waterOrganized sound that is pleasant to hear...

Animal Word Search #1 2013-08-13

5 Items: DogCatBatElephantKangaroo

Domestic Animals — "Animal Wonderland!" 2025-04-17

5 Items: DogCatCowDuckRabbit

Food Web 2025-11-06

13 Items: only eats plantseats plants and animalsonly eats others animalspretend version of somethingan animal that hunts and eats other animalsa living thing that eats other living thingsmany different food chains found in one placethe movement of material through an ecosysteman animal that is hunted and eaten by other animals...

Ecology 2023-04-20

13 Items: Organism that only eats meat.Organism that only eats plants.Animal hunted by another animal.Plants use _____ to make energy.______ eat dead and/or decaying matter.Organism that eats both plants and animals.______ break down dead and decaying matter.All of the energy on earth begins with the ____....

Girlfriend, Word Search 2025-02-12

10 Items: be my?I'm yourhugs'n'kissesfavorite Leif songa kiss from my babecode for I love you!dreamy forest animalfavorite Tyler Childers songwhere we found the best sandwichA warm gesture, often involving arms

Flower Word Search 2023-04-17

5 Items: a animala plant that growssomething to write witha place where kids learnwork given to do at home

Really? 2025-01-10

22 Items: What fruit is slightly radioactive?What is Cookie Monster's real name?What animal sleeps with one eye open?One in 18 people have this extra body part.What were chainsaws originally invented for?The speed of a computer mouse is measured in?What is the hashtag symbol technically called?What is the most shoplifted food in the world?...

Diabolical Word Search 2024-08-06

69 Items: PigCowAntSkiCoolAuntKingBakeNeffQuickThumbProudShareLemonPlazaJesseSecretAnimalDonkeyAntlerMelodyZipperBasketMizzouTrumanGalenaTigersFaroutNoxiousPopcornMinimumDogwoodLibraryCornellHearnesColumnsRespectMissouriProofingBlushingInfringeFootballHospitalColumbiaHawthornLafferreMountainsGarrulousRelevanceTranslateAmbiguitySouthwestDiscoveryDiabolical...

Republican and Democratic Parties Animal Symbols Cross Word 2025-10-08

13 Items: nastpanictweeddonkeythomassymbolharperlincolncartoontammanyelephantcampaignpolitical

Rainbow Word Search 2025-09-16

6 Items: HorseGod's sign to NoahPost Office purchaseAn old-time record playerA sneaky gift to Troy (2 words)A make-believe animal with a horn

Seagrass October 2025-09-05

18 Items: aliveeatingenigmavisitorfriendlyneeds helpon our ownsandy shoremidday mealhairdressingwhere we swimanimal friendscity just norththe state we're inplace for social hourfor playing hand and footwhere ocean meet the sandnearby large body of water

French Word Puzzle (Casse-tête de mots en français) 2024-11-27

22 Items: The number 30The verb to be?The verb to go?What do you read?The verb to like?Where do you live?What animal barks?What animal meows?The verb to speak?First month of the yearWhat is a high landform?Where do you go to learn?What do you drive on the road?What is the light of the night?What do you drink to stay hydrated?...

Evolution of plant-based meat - October 2 2023-09-18

6 Items: another word for "delicious"a person who does not eat meat or fishthe soft part of an animal or a bird that can be eaten as fooda great source of vegetarian protein that was invented in Indonesiaa soft white food that was invented in China and is made from soybeans...

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

CR Amex team 2022-09-29

17 Items: teamsureLDA's petpuntarenasCR capitalmarried manmommy to beproud to beSaprissa' petwhite last namebreakfast to goCosta Rica lifestylead dealers main functionseasonal fruit 2mil el Keveryones fav college drinkCr most exported fruit 2019unexpected animal that joins zoom meetings

Cat Word Search 2022-09-15

6 Items: dog's enemyMan's best friendthe king of the junglebiggest mamal in the worldhave white and black list furdangerous animal ini the world

Ben’s Giant Animal Word Search 2022-08-25

6 Items: catlionzebrahippoelephantMan's best friend

Animal Assisted Therapy & OT in Acute Care 2025-04-19

10 Items: BalanceBenefitsEnduranceFineMotorMotivationEngagementPrecautionsFunctionalTasksPatientCenteredOTInterventions

Pig, oink! 2025-12-13

10 Items: a pink tribe...The animalWant a sprite?...Mircusfan81First challenge!Ghosty merge tribe!Something that pigs sayFirst boot of the seasonOne of the oink variants,Could mean a trolls protagonist, or a Dandy's world starter!

First Stuffed Animal Word Search 2025-11-16

6 Items: ToySteiffElephantMargareteSeamstressPincushion

Pros y contras de tener una mascota 2025-06-02

9 Items: Valor que debe tener para hacerse cargoDesarrollo de lazos emocionales; vínculo fuerteBeneficio físico y mental que puede aportar una mascotaSensación de no estar solo, especialmente con un perro o gatoPuede presentarse si el animal hace ruidos o destruye objetosReacción que puede tener la gente ante la presencia de una mascota...

Welcome to Dr. Puzzleverse's Word Search Puzzle - Animal Edition (#1) 2025-01-17

27 Items: OwlFoxLionWolfBearZebraTigerPandaKoalaSharkEagleWhaleSnakeParrotRabbitMonkeyTurtleGiraffeDolphinPenguinCheetahLeopardOctopusElephantKangarooFlamingoCrocodile

Animales del bosque 2024-08-22

15 Items: Mamífero elegante con grandes astas, que habita en bosques y montañas.Predador canino, símbolo de fuerza y unidad familiar en la naturaleza.Mamífero salvaje de gran tamaño, conocido por sus colmillos y su fuerza.Ave nocturna con grandes ojos, conocida por su sabiduría en la mitología....

unit 16 2024-04-24

12 Items: roughnot bendingto get alongextinct animalto stuff tightlycapable of growingto take upon oneselfsomething that protectsan action that is wrongto supply with furniturea person of the same ageto expose to injury or harm

David Word Search 2024-10-20

14 Items: Who annointed David?Who was David's father?Who was David's best friend?What instrument did David play?Who was David's great grandmother?What King wanted to have David killed?What animal did David tend for his father?Who was the Philistine that David went to battle?Who was the woman David saw taking a bath on a roof?...

A WORDS 2024-02-01

73 Items: asatactaddageagoairallandanyarmartaskablealsoareaawayaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistassumeattackauthorabilityaccountaddressagainstalreadyanotherarticleactivityactuallyalthoughamericananalysisanythingapproach...

trs23 ver2 u12 2022-11-25

10 Items: 100use your teethopposite of thina big, scary fishopposite of lighta yummy thing to eatcan lift heavy thingswill make you feel scaredtry to run and catch somethingthe outside of an animal or person

Payton's Clue Week Day 2 2025-10-12

10 Items: Your big's star signYour big's cat's nameYour big's dream careerYour big's favorite foodYour big's first concertYour big's favorite colorYour big's favorite movieYour big's favorite flowerYour big's favorite animalYour big's favorite holiday

Wedding Wordsearch 2025-02-18

20 Items: Luke's best manLuke's middle nameLuke is Stacey's...Stacey's maiden nameStacey's maid of honourStacey/Here comes the...Luke & Stacey's last nameTheo and Arthur are the...Mollie and Chloe are the...Luke & Stacey are 'Just ...'what type of animal is Bun-Bun?The name shared by the most guestsWhat type of animal watched Luke propose?...

Vet Med Term Word Search 2025-12-01

32 Items: WartsFat tissuePain (suffix)Dead on arrivalAbsence of teethA newborn animalA neutered male rabbitLacking normal muscle toneSoftening of tissue (suffix)A complete joint dislocationDull, depressed, nonresponsiveThe cause or origin of a diseaseThe way an animal moves or walksA tumor made of mucus-like tissueLethal dose (amount that can kill)...

Les mots de Bibracte 2020-04-10

73 Items: fermurrueabriansearmeboiscireclefclouepeehaieminemiremontorgeparcsitearbreautunaversbijoucesardomusecoleeduenelevefleurforgeforumfoyerhachehetrerepasanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedessindoliumfauconreleveamphorearverneatelierbeuvraycollegecollineconcertcouventassiettebatimentbibracteboucliercervoise...

School 2020-11-30

72 Items: catdognotteatenrunfunbigsunfoxcowjimlionpenstimewithsaidmilknoonmoonwolfgolfkiwidocsnotszebrahippomathsbookspaperbikesbreakfruithorsetrackafterclassdriveanimalinsideplayedchromeminutepeoplehitingsitingpersonaroundgooglewritingreadingmoaningteacherarguingplayingoutsidepencilsmorningfriendscartonsrunningchickenstudentelephantlearningfightinglistening...

Biology Terms 2025-08-26

75 Items: DNARNACellGenePreyBirdFishLipidClassOrderGenusNicheBiomeVirusPlantAlleleGenomeEnzymePhylumFamilyFungusAnimalMammalNucleusVacuoleProteinHormoneOsmosisKingdomSpeciesEcologyHabitatArchaeaProtistReptileRibosomeLysosomeMembraneCellWallMutationTaxonomyPredatorBacteriaCytoplasmOrganelleAminoAcidDiffusionEvolutionCommunityEcosystemBiosphereSymbiosis...

2nd Grade Practice 2025-11-30

72 Items: ouroldanyskytrynewairfourintobothkindmostgiveonlyalsoweekdoeslongwellpartlandgoodyearcityliveknowshowmoveoverabledoorworkroomthingtheiraftersmallthinktodayrightplaceunderwhichagainlargelearnworldfoundhousesoundgreatmeansalmostchangefollowpeopleacrossanimalbecomebeforebehindletternumberaroundschoolanotherpicturethoughtthroughanythingsomething...

Les mots de Bibracte 2020-04-10

73 Items: fermurruevueabriansearmeboiscireclefclouépéehaiehouxmiremontorgeparcurnevertarbreautunaversbijoucésardomusécoleéduenforumhêtremeuleoutilanimalargileatriumbaladebassinbriquebronzecasquecentrechaumechenetchevalclochedoliumamphorearverneatelierbeuvraycollègecollineconcertcouventtruelleassiettebâtimentbibracteboucliercervoisechantierchapellechaudron...

September 21st 2024 2024-07-02

20 Items: The officiant's name?What soroity was Taylor in?What month did George Propose?What is Taylor's new last name?Who was Taylor's only Prom date?what is Taylor's first degree in?What is Taylor's favorite animal?What is the couple's favorite sport?Who was George's favorite Prom date?What sport did Taylor do in college?...

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Noah's Ark: Genesis 6-9 2023-07-15

14 Items: Who loved God? (page 27)What covered everything? (page 31)The people _____ about God. (page 26)What did God put in the sky? (page 33)What did the dove bring back? (page 33)What animal did Noah send out? (page 33)What did God tell Noah to make? (page 28)Noah and his family _______ God. (page 33)How did Noah and his family feel? (page 32)...

Animal Word Search Puzzle Book: Fun & Challenging Brain Games 2025-03-12

14 Items: lionzebrahipporhinohyenababoonjaguargiraffecheetahgorillaleopardelephantkangarooantelope

Posties Big Read 0212 2024-01-22

6 Items: doubting that something is true or usefulsolid waste that comes from the bottom of a person or animala large, black and white animal that lives in forests in Chinaa soft, wet substance made from wood, which is used to make papera tall plant with hard, hollow stems, often used for making furniture...

How well do you know me? 2025-09-09

15 Items: biggest fearfavorite foodfavorite musicfavorite animalMy favorite colormy height is 5’_”what makes me laughfavorite pizza placeLeast favorite colorMy moms maiden name isfavorite pair of shoesFavorite family membermorning or night personDream vacation is in the…how many places I’ve lived

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

Decifrando a Páscoa 2023-03-16

6 Items: Semana...Alimento do coelhoLugar onde se guardam os ovosAnimal que representa a PáscoaDia da Páscoa no calendário semanalProduto que são feitos os ovos de Páscoa

Sight Words 2016-03-10

72 Items: OhEyeAweOweBuyDieLiePieTieByeLyeDyeRyeLoseLoveMoveAcreIsleGloveProveShoveTasteWasteWholeCrepeHasteNicheWhoseWomanWomenAmongPastaAngelWatchCelloHeartMinutePoliceHonestRemoveBeautyPrettyAnimalDebrisDoubleTripleSubtleChangeEngineOfficeRecipeGarageOrangeMachinePromiseApproveComradeImproveSomeoneCroquetColonelTroubleImagineStrangeLibraryHandsomeMosquito...

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

Wicked 2024-12-07

61 Items: OzHatCryBoqManWandGoodShizRoseCityBickbandBroomNessaGlindaUplandThroppWickeddragonCoddleElixirWizardFiyeroGalindaPfanneePopularElphabaGravityAnimalstornadoGlassesmonkeysShenShenGoodnessMorribleslippersBallroomDefinishOutuendoDulcibearDillamondScarecrowBraverismGrimmerieWickedestRejoicifyprofessorsWheelchairSwankifiedWizomaniacHideoteousGalindafied...

Trick Words 2025-06-10

74 Items: wonsonbothfulltalkpullwalkdonegoesusedknowsureonceknewawayheadloseJulyonlymoveshallagainoftengreatreadywhoseearlyoceanpiecelaughyoungplaceworldearthlearnhouserightprettypleaseanimalalwaysMondaycousinboughtenoughAugustcoupleanswerfathermotherschoolagainstcountryTuesdaybroughtJanuaryspecialtroublepicturebrotherthoughtAmericafavoritetomorrowThursday...

The Great Christmas Wordsearch! 2025-12-19

74 Items: sixiceelfboomapsnowcoldtreestarbellclapheroplugwiretreeleafrootseedstembirdfishdiettimesevenfrostsantaelvescarolpartypantostagecheermagicfairypowerplantriveroceanglobeshapewintersleighbaubletinsellightsprinceenergysocketswitchfloweranimalmammalforestnumbersnowmanchimneycurtainvillainbatterycircuitreptilehabitatreindeerpresentsstockingaudience...

Cat Word Search 2023-05-02

10 Items: Wild dogLand Sea horseMan's best friendWomans best freindKing of the junglesomething you sleep onworlds largest land mammalpineapples don't belong on _____Animal with stripes in the savvanahthe old way of transportation without cars

Good Word Search 2024-04-30

7 Items: bonroi des animauxdire quelque choseplanete qui a beaucoup d’eauanimal grands et fin qui rampesentiment quand tu perds ton perefruit rouge qui tombe des arbres d’après Newton

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

me and janae 2025-01-04

11 Items: kiss?my fav snackwhat you aremy fav animalanother word for gayhow you make me feelanother word for lovewhat i call you (sweet)what we call each otheryou call me this adjectiveanother thing i call you (p)

Word saerch page 21 ANIMAL BABYS 2015-07-21

7 Items: POTROPICHÓNOZESNOBECERROCORDEROCACHORROBALLENATO

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

ANIMALS AND ITS BODY PARTS 2025-11-12

15 Items: CatDogDeerLionFishhippoParrotOctopusElephantit's got a beakit's got long neck and it's yellowit's got black stripes and it's whiteBig animal, it's got big teeths and it's brownit's got long neck and it's white; it's a birdit's got a tail and it's brown; it lives in the jungle

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

How well do you know Aisha? 2025-10-06

10 Items: Her favorite showThe Inni loves mostThe place she hatesHer favorite chocolateThe only meat she eatsThe subject she studiedThe place she grew up inHer favorite Indian snackThe animal she can’t standHer favorite travel destination

Evolution Unit 2024-12-05

9 Items: father of evolutiona permanent change in the DNAgradual change in a species over timetype of coloration for when an animal blends in with its backgroundorganism has the best chance to survive, reproduce, and pass on traitsis a trait that makes it very hard to see an animal in its natural habitat...

Animales - Colores - Emociones 2023-03-02

4 Items: someone who's happy (male)the color of Colombia's flagsomeone who's excited (female)big animal that throws water at you

Spanish 2023-04-28

27 Items: seazoocitylaketreebearbirdplacemuseumanimalmonkeystadiumtheatermonumentto learnto visitto sunbathenational parkto go boatingamusement parkplay (theater)country, nationto ride a horseto buy souvenirsto rest, to relaxto scuba dive/snorkelatracción, attraction, attractions

Can You Finish This 2023-09-05

76 Items: asatbyaddageagoairallandanyarmartaskbadbutbuycanablealsoareaawaybabybackcalladmitadultafteragainagentagreeaheadallowalonealongamongapplyarguebeginbringbuildaffectagencyalmostalwaysamountanimalansweranyoneappeararoundarriveartistbeforebehindbudgetcameraabilityaddressagainstalreadyanotherarticlebrotheractivityactuallyalthoughamericananalysisanything...

3000/2 2025-02-22

78 Items: ahAMageagoaidaimairallandanyaideAIDSallyalsoafteragainagentagreeaheadalbumaliveallowalonealongalteramongangerangleangryapartappleapplyagencyagendaalmostalwaysamountanimalannualansweranyoneanywayappealappearagainstairlineairportalcoholalreadyamazinganalystanalyzeancientanotheranxietyanybodyanymoreappointaircraftalliancealthoughAmericananalysis...

trs23 ie2 u6p2 2023-02-07

10 Items: Not the same.Green thing with leaves.E.g. chicken, pork, beef.E.g. bread, rice, noodles.E.g. milk, cheese, yoghurt.E.g. sardines, tuna, salmon.E.g. lettuce, carrot, potato.E.g. apples, bananas, oranges.E.g. lion, dog, crocodile, mouse.Some food between two pieces of bread.

애완동물 Word Search 2024-09-08

25 Items: nowfishyardbabya petchickhouselatermotherfatherto dieto liketo livetogetherapartmentto be sadto be bigdog, puppyto grow upto be goodto be rightmiddle schoolto hate, disliketo hear, to listen toto raise, to grow animal

The World at Night 2025-10-16

10 Items: Having two equal or matching halves.Extremely interesting or captivating.The measure of how hot or cold something is.Active at night and sleeping during the day.An animal that is hunted and eaten by a predator.An animal that hunts and eats other animals for food.A small mammal with sharp front teeth, such as a mouse or rat....

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Les mots de vocabulaire 4e classe 2022 *** 2022-01-13

77 Items: mairatétéjourjuinchatnoirgrisbleumarsaoûtloupvertoursmoismauvenagerlapinchienannéejeudilaverrougehiverblancverbelundimardivachejaunevoleravrilmarroncochonsouriscachersaisonparlerrenardchevalsamedianimalsauterrampertomberorangevioletmangeroiseauautomnecouleurbrilleroctobresemainejanviertrouverjuilletfévrierpoissonchassercreusermarcheranimauxchercher...

2nd Grade Fundations Trick Words 2025-05-13

78 Items: wonsonuseJulyloseheadawaycitymoveonlyonceknowknewusedsuregoesdonewalktalkbothpullfulllaughpiecewhosewhosegreatlearnearthworldcarrynighteverylargeeightplacerighthouseoftenagainshallAugustenoughboughtMondaycousinschoolmotherfatheranswerfamilychangealwaysanimalpleaseprettyspecialJanuarybroughtTuesdayAmericathoughtcountrybrotherpictureagainstdaughter...

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

Across Word Search 2025-05-11

19 Items: downseedsacrossto heredityof cereal cropsgrain from chafffor storing grainused to kill pestsland for cultivationused to kill insectsgrain from the plantwaste used as fertilizerfor sowing seeds in rowsseeds of leguminous plantscrops to improve soil healthfor harvesting and threshingthat fix nitrogen in the soilscience or practice of farming...

trs23 ver2 u7 2022-10-19

10 Items: 365 dayslittle animalclean with watermeal at 12 o'clocksomeone in your familymake a picture with a pencilby yourself, just one personTomorrow I ____ go to school.You ____ to drink water every day.It is 4:20p.m. Class will finish ____.

Les mots de vocabulaire 4e classe 2021 2021-12-13

77 Items: mairatétéjourmoismarsjuinaoûtchatloupoursbleuvertnoirgrislundimardijeudisamdiannéeavrilchienvachelapinverbelavernagervolerrougejauneblancmauvehiveranimalchevalsourisoiseaucochonrenardsautercachermangerparlerrampertombermarronorangevioletsaisonsemainejanvierfévrierjuilletoctobreanimauxpoissonmarchertrouverchasserbrillercreusercouleurautomnemercredi...

Tricky Words 2025-11-04

78 Items: sawanywaswhywhoasksaidtheyloseonlyknowweremanyherewerehomewhatworkwomenafterlaughtheirbuildhouseabouteverytherewheregreattheseothercan’tdon’tcouldwoulduntilwomanwherebeforealwaysacrossmotherfathersisterschoolcousinthougharoundshouldfriendfamilycaughtpeoplereallyanimalboughtbelievealrightalreadybrotherthroughminutesanotherdecidedbecausethought...

Tricky Words 2025! 2025-12-02

77 Items: areherwasyouputsawanywhowhytwoouraskI’msaidveryhavewerethentheyherewhatwantsomeoverhomeyourlovemanysaysfourworkbabylastfastfindonlykindopenknowtalkwalktherewhereagainhousethreeaftertheseaboutgreattheircan’tdon’totherwatereverylaughfriendschoolmotherfathersistercousinfamilybeforedidn’talwaysanimalpeoplebrotherbecausethoughtanotherchildrencouldn’t...

Marine Animals 2025-01-06

8 Items: It is a mammal.It can sting you.It lives in a shell.It has got 8 tentacles.It has terrifying teeth.Patrick, from Sponge Bob.It walks from side to sideThe biggest animal in the world.

Afro Word Search 2025-11-19

10 Items: Animal que voa à noiteInseto com oito pernasDoces dados às criançasEstrutura óssea do corpoCriatura que bebe sangueMulher com poderes mágicosEspírito de uma pessoa mortaRoupa usada para se fantasiarLugar assombrado por fantasmasFruta laranja usada para decoração

Family 2025-11-25

12 Items: plural of footcheveux bouclésplural of mouseYour mother's sisteryour father's brotherMarge Simpson's husbandI am not small, I am...Prince William's brotherBrothers born on the same dayanimal de compagnie en anglaisCharles and Camilla are husband and...Fester Addams doesn't have any hair, he is...

Identify these objects 2024-09-20

10 Items: Pet that BarksSomething you readWater from the skyPet that chase miceA home built by birds.Animal that loves cheeseSomething you write withSomething you wear on your headTall plant with leaves and branchesA small container used for drinking