animal Word Searches

Random stuff im learning :D 2024-01-18

11 Items: live in a shellsad__ - adverb -slow__ - adverb -quick__ - adverb -5/7 - 2/3 = ? - simplify -2/3 - 3/8 = ? - simplify -6/7 - 2/6 = ? - simplify -4/6 - 4/8 = ? - simplify -4/5 - 2/3 = ? - simplify -an animal that unpollutes waterpeople were over harvesting them in Chesapeake Bay

From Tortoises to Parrots: A Fascinating Dive into Animal LifespansAnimalsBirdsDogsCatsElephantsTurtlesFoodDietHabitat 2024-06-03

16 Items: dogscatsfooddietsizebirdssafetyanimalsturtleshabitatthreatselephantspredatorsprotectionmetabolismenvironment

Benny's Exploration Journal 2024-10-24

12 Items: A secreted molecules that influences cells near where it is secretedA transmembrane protein channel that opens or closes in response to a particular stimulus.A type of intercellular junction in animal cells that function as a rivet, fastening cells together...

Florida Word Search 2025-09-07

10 Items: state treestate animalcapital of FLstate reptilecurrent governor of FLcurrent mayor of Tampacounty that Tampa is inland with water on 3 sidesFL city with the largest populationmajor FL city that is known for theme parks (Disney)

Unit 12 2024-02-26

12 Items: improperpoorly madea thin stripto agree withshowing no sorrowto stun or confusefit to be inspectednot taking any sidesa standard measurementto turn around a central pointa machine or tool used to do household jobsan animal or person that moves to different regions

Renaissance 2025-05-23

10 Items: basic rulemounted gunproceed towardunderlying basisgrow or develop healthilyexpert or student in astronomyrepresenting the sun as the centera carved figure of a person or animalagricultural laborers with low statusa continuous area or expanse which is free

Unforgettable Minds: Memory Marvels and Forgetful Friends in the Animal Kingdomelephantschimpanzeesoctopusesdogscatssquirrelsgoldfishguppiesantsmemorywater 2024-04-13

19 Items: dogscatsantswatertoolsfacesmemorytricksforgethidingguppiesgoldfishroutineselephantsoctopusessquirrelschimpanzeesintelligenceimpressively

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

All About Me 2025-05-30

20 Items: AgeBirthdateFirst NameMiddle Name1st Car ModelFavourite FoodFavourite FoodFavourite ThingFirst Dream CarFavourite FlowerFavourite ColourBusiness #1 NameBusiness #2 NameWhat I call myselfName of First ChildName of Second ChildFavourite RestaurantBest Month of the YearFavourite Animal on paperWhen I grow up I want to be...

Animals 2025-01-28

8 Items: purr... get it?has a long trunkMan's best friendhas colorful wingsking of all the animalshas a long neck and is spottedbig and gray animal that lives in Africa.does it have black stripes or white stripes?

Dolphin Word Search 2025-02-11

15 Items: The largest marine mammalA small marine fish with a horse-like headA small, schooling fish found in the oceanLION A large marine mammal related to sealsA marine invertebrate with a star-shaped bodyA gelatinous marine animal with stinging cellsA large, predatory fish known for its sharp teethA slow-moving reptile, some of which live in the ocean...

trs23 ver3 u4 2023-02-24

10 Items: A big cat.Really great.Not interesting.A kind of long pasta.Something you think up.Have fun doing something.#1. Better than everything else.A small animal that lives in trees.Ask someone to do something with you.A kind of chicken that makes noise in the morning.

Lion Word Search 2025-09-24

2 Items: A long wordAN African Animal

911 Dispatcher 2024-10-01

77 Items: samtomdoaadammarynorapaulxraybombloudtextybakerdavidoceanqueenunionyoungzebraalarmbreaksecurdrunkfightlaserpartyfraudwagonedwardrobertvictoralarmskidnapperarmdumpindisturdomestexplospermisharassperdwnpersusinvestweapondamageanimalpersonpersonshotguncharleswilliamtheftinpershotdomweapoverdosperwelfweatherinjuredbatteryrunawaylockoutcontrolofficer...

One Year Anniversary Search 2025-12-04

23 Items: LoveKoreaTexasKamrynOneyearLettersAirportSungjoonage we metInternationalMost made dishAnniversary datewhere we first metfirst official datemy nickname for himmost used app to callFirst holiday together200 day anniversary spotwhere we had our first kissFirst place traveled togetheranimal of keychain he gifted meeachothers favorite physical feature...

Joyeux Noël ! 2025-12-08

33 Items: elftoystardollhollyangelchildscarfsleighcandlewreathturkeygarlandpresentsnowmanchimneyreindeerstockingYule logsnow hatchampagnecandy caneSanta Clausgingerbreadmulled wineChristmas treeNativity scenestuffed animalChristmas carolAdvent calendarChristmas marketthe three wise menChristmas ornaments

Finding secret animals 2025-11-11

9 Items: Man's best friendDied and came back to lifeUsed to skateboard in the 90's but now he's too oldA helpful animal with a shiny bald head and kind eyesMan's second best friend who's honestly just using him for foodKind of like a kite but it lives underwater and killed Steve Irwin...

Tulip, rabbit, reptile words 2025-11-14

18 Items: A womanA baby catSet on fireMouse or ratMake believePut togetherA sweet treatEating outsideA little flowerMore than enoughLearner at schoolA doctor for teethThe opposite of goodBlood drinking monsterLong-eared hopping animalWhat you sing and dance toA breakfast food with syrupA salty, crispy breakfast food

Happy Birthday Bri! 2024-06-25

10 Items: Bri's favorite cake.Bri's favorite holiday.- Bri's favorite season- Bri's favorite color.Bri's favorite food - mmm crispy.Bri's favorite animal - think pink!Bri's favorite movie genre - amour.- Bri's favorite summer activity - not running!Bri's dream vacation destination - known for pasta....

sydney 2025-02-20

9 Items: indigenii aborigenio insulă din Australiamâncarea ursului koalao specie protejată de ursanimale cu marsupiu şi picioarecel mai vechi şi mai mare oraş dinactriţă australiană care săa făcutactor Australian care a jucat rolulanimal marsupial nocturn are trăieşte în

Gato Word Search 2023-03-03

20 Items: something people sleep onsomething people use to write ona very common house pet that meowsa very common house pet that barksa device people use to communicatea form of art people can listen tosomething people wear on their feetsomething people use to carry stuffa big gray animal with huge gray earssomething you open to get into a room...

10 minutes de détente 2023-03-16

30 Items: ville de papeville d'arènesérie du soirmaison du sudcolis du mardiévénement de 2024chevelure du liontriangle chocolaténagui y fait chantersoignant post mortemhéros de tes lectureshabitude du quotidienil peut être d'honneurton jeu de train préféréton jeu de carte préféréta boisson de la journéefumé italien que tu aimeston animal de compétition...

ww5 u 3 & 4 2024-03-07

29 Items: weaka choiceto leavetoo earlyvery largeto cover upto lose hopestrong windsto understandexact, correctno longer livingsavage or fiercea meat eating animalto make strong againa feeling of great joya longing for the pastnot exact but close enoughto break off or cut in twoa long journey by sea or spacean animal that is hunted for food...

US<3 2025-02-04

14 Items: kissesyour monthwhere we metyour fav gameyour fav personyour fav animalyour fav tv seriesone of your fav songsyou always crave thissomething we always sayyour fav comic charactersyou like this veggie a lotme to you,in your languagesomething you love more than me jk

Can you guess? 2024-10-09

16 Items: My gradeMy little <3My hair typeMy hair colorMy favorite foodMy favorite colorMy favorite seasonMy favorite animalMy favorite musicalMy favorite holidayMy favorite subjectSomething I'm directingShow I've been a part ofMy favorite disney princessI wear these most of the timeMy preferred color of jewelry

Puzzle #6. Palabras con A. 2024-05-24

80 Items: ajoalmaaltoanísaptoaquíarpaacosoajenoálbumaletaalzaranchoángelantesanualañejoapodoarenaardoralhajaalhelíaliciaaljibeacordeafilaráfricaagendaalarmaalemánalturaamargoamarseamasaranimalantojoañorarapenasarenalalianzaaclamaradentroafloraraisladoalambrealargaralcaldealondraaltavozaltitudamarraraméricaancianoanguilaapliqueapuradoarbustoarcillaárbitro...

Adv. Deutsch II Vögel 2 2025-05-11

30 Items: owlnutduckcrowwrenseedfinchstorkberrybroodthrushmagpieinsectto cawvulturesparrowto feedomnivoreto hatchwoodpeckerchiffchafffalcon, hawkdove, pigeonEuropean robinswallow (bird)to hunt, chaseto eat (animal)to tweet, chirpto shriek, screamfamily of birds including titmice, chickadees

Sopa de letras 2025-06-03

20 Items: Animal blanco con rayas negras.Brilla en el cielo por la noche.Instrumento musical con cuerdas.Se usan para cortar papel o tela.Herramienta que sirve para barrer.Utensilio para comer sopas o postres.Torre luminosa que guía a los barcos.Medio de transporte que va por rieles.Animal con concha que se mueve muy lento....

Puzzle Word Search 2025-11-13

22 Items: The gas we breatheA vast body of salt water.A mountain that erupts lava.An event with music and food.Often called man's best friendA person who travels in space.A colorful arc seen after rain.A place where you can find art.A sea creature with eight arms.The largest animal living on landA place full of books for reading....

English Word Search 2025-10-07

12 Items: place, time, moodbig idea of a storycategory of a storytop of plot mountainthe feeling of a storystory from imaginationintroduction of a storyperson, animal, or figureseries of events in a textcharacters that don't changeacronym for indirect characterizationtrue story using real characters and setting

Russia 2025-12-19

14 Items: beet soupfish eggsbiggest countrycapital of Russiaat war with Russiacapital of Ukrainepresident of RussiaSea south of Ukrainerare animal from Siberiadolls inside of each othersecond coldest place on earthclosest American state to Russiacountry with name like a US statesea that connects to the Black Sea

Vocabulary #22 2024-05-28

8 Items: a weak person or animalencouraging and nurturingto declare with convictionto believe something without proofwithout any doubt, very apparentlyto depend upon someone or somethingto propose as a candidate for electionsadness for what another is going through

Vocab word search 2024-04-26

12 Items: definition listening to ordersdefinition its like being treated crueldefinition to bark quick in a sharp tonedefinition something that supports wood for sawingdefinition a group of shelter like a bunch of tentsdefinition an inner voice bringing someone to rightness.Definition is when your crying and have tears in your eyes...

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Pit stop - Food 2025-09-11

84 Items: HotDogEggTeaSaltSoyaMeatCakeCrabMealCafeKidsSoupBeerWineForkRicePizzaOnionSnackBeansItalyFruitJuiceDrinkWheatBreadSugarHoneySweetWaterOliveLunchKniveSpoonBaconToastGravyCurryPastaSnakeSheepburgerChilliPepperRelishTomatoCheeseBananaDishesHungryPeanutButterCerealAnimalPicnicBarleyDinnerLizardPrunesOrangeCoffeeHaggisLocustToppingSausageKetchupMustard...

Animal Body Parts (Level 3 - Lesson 3) 2025-05-19

7 Items: catpawhornclawsteethtigerrhinoceros

Masculin Lettre A 2020-02-15

87 Items: anauâgeâgéairamiartabriaideangeaoutaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugle...

Masculin Lettre A 2020-02-15

83 Items: anauâgeâgéairamiartabriaideangeaoûtavisaccèsachatacieradieualbumamourangleappelarbrearrêtastreaucunautreavantavionavrilabsentaccordacteuradulteagneaualcoolancienanimalanneauargentaspectauteuraveniravironavocatabandonaccueilaffreuxaimablealimentamateuramusantancêtreanglaisappétitarrièrearticleartisanartisteatelierautobusautomneaveugleaccident...

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

Croton Polinators (some words are backwards) 2025-12-18

10 Items: Our town!Ruby throated…Inside of flowersIt’s in the title!A fluffy type of beePollinators Need it to live!A animal that’s terrified of bees…A flower in Croton that supports pollinatorsA place that’s Behind your house filled with flowersA special type of garden often used for different veggies

merry christmas 2025-12-08

10 Items: first datemy step sonyour step sona word to describe youan artist we both lovewhat i ask for the mostmy favorite thing to dothe dog in our relationshipthe animal you remind me ofplace where you said i love you for the first time

Lisa and Rob's wedding wordsearch 2025-06-02

14 Items: City we live inRob's middle nameRob's birth monthLisa's middle nameLisa's birth monthName of our pet catHazel's middle nameMatching tattoo animalSchool we both attendedLast gig we went to seeOur most watched TV seriesOur first holiday destinationBig nut that brought us togetherWhere we hung out together in our teens

Me & You 2024-06-19

11 Items: Our cityour best dateyour fave animalyour donut flavoryour fave Bee Gees songour shared home last yearyour silly little nicknamewhere we're getting marriedyour (alleged) favorite dessertthe gal we're gonna see in novemberthe band you started listening to after I forced you to branch out

Random Word Search 2024-01-11

6 Items: Man's best friendking of the junglean animal with great memorythe largest planet in our solar systemthe color of food that helps your heartthe football team that won 2023's super bowl

trs23 ver3 u8 2023-03-24

8 Items: A kind of flower.Wow! That is _________!A person who does magic.The clown does a magic _____.A kind of small, cute animal.Use this to keep your neck warm.Use this to keep your body warm.Use these to keep your hands warm.

To Kill a Mockingbird CH 24-25 Vocabulary 2025-04-09

11 Items: hesitationto find one’s waya thin surface layerconstant threat; coercionmoral or religious beliefssuspended until a later timesomeone who pretends to havefoul and repulsive; neglecteddevoted to divine worship or servicean undesirable animal, usually a scavengera device for blowing air on a flame in order for it to grow

Ben’s 25th Birthday Adventure Puzzle #1 2025-09-05

10 Items: Antlered animalThe big celebrationWhere the trails leadThe age you’re turningThe month of your big dayWarm glow under starry nightYour hobby with rods and reelsA small wooden home in the woodsA small boat powdered my paddlesWhere hidden treasures are waiting for you

OUR ENVIRONMENT 2025-06-16

10 Items: ,keeps us warm,we all live on this,most of these are green,only comes out at night,another word for person,your dog is one of these,look up, what do you see?,twinkle twinkle little _____,its all around us but we can't see it,fills up rivers, lakes, seas and oceans

The Actor Word Search Puzzle 2022-07-29

15 Items: ActorActorActorVideo EquipmentVideo EquipmentWilson's Main JobHenry Loves This AnimalJune Loves Creating ThisWilson Loves To Play This SportVideo Equipment (Use _ As Space)Henry's Main Job (Use _ As Space)June's Favorite Character To Play AsHenry's Favorite Character To Play AsWilson's Favorite Character To Play As...

Healing Power of Wolves 2025-10-23

10 Items: All the plants and grasses in an area.A body part that helps fish take oxygen from water.The total number of a certain kind of animal or plant in an areaThe natural home or environment of an animal, plant, or organism.A living thing, like a worm or mushroom, that feeds on dead material....

Agriculture Revolution & Development of Civilization 2025-08-18

14 Items: Growing or making somethingThe growing of plants or crops.A person who manages and works on a farm.The act of gathering food from wild plants.Rich in nutrients and good for growing plants.The practice of taming wild animals for human benefit.The large-scale planting and growing of a single crop.Husbandry The organized raising and caring of animals....

2 2025-02-07

10 Items: What kind of animal is Franklin?What famous comic strip is also the name of a food?What animal swore that one day he would kill Mowgli?Who is the youngest of all Winnie the Pooh’s friends?Who owned a hammer so heavy that only he could pick it up?What was the fourth word used in all the Harry Potter titles?...

Creativity Word Search 2022-05-25

5 Items: of great significance or valuethe ability to do something wellusing thought or rational judgmentUse of the imagination or original ideasthe existence of an individual human being or animal.

trs23 ver3 u3 2023-02-24

12 Items: Sound.Scared.Not loud.By yourself.Wow! I am ____!From sunset to sunrise.You turn it on so you can see.Sleep in this when you go camping.When you eat in the middle of the day.Noise you make when you are very scared.Dogs, elephants, mice, lizards, chickens.Place where you can borrow and read books.

Les larmes de l'assassin - chapitre 1-5 2024-03-06

12 Items: violenceserpentsimpressionnerNom de famille de PaoloLes ______ de l'assassinLe nom de la ville de Luis ?Animal donné à Paolo (p. 43)Auteur du livre : Anne-Laure _______Qui a gagné à la fin du chapitre 5 ?Nom du pays où se déroule cette histoireAngel utilise un _______ pour assassinerQu'est-ce qu'Angel a demandé à Paolo de cuisiner pour lui ?

trs23 ie2 u4p2 2022-11-16

8 Items: More good.A bird's mouth.Birds use them to fly.Go up a ladder or a tree.It is at the back of an animal.Picture made with pencils or crayons.Birds have them all over their bodies.A place you can go to see wild animals.

Jennifer and David 2024-01-21

20 Items: Where they metDavid’s Best ManJen’s first wordDavid’s middle nameJen’s favorite colorJen’s birthday monthJen’s favorite flowerJen’s Matron of HonorDavid’s favorite foodWhere they got engagedDavid’s birthday monthDavid’s favorite colorJen’s first pet’s nameDavid’s favorite candyJen’s favorite dessertDavid’s favorite drinkDavid’s favorite animal...

PMC Tech Week Word Search 2024 By Dr. Kristin 2024-09-06

22 Items: Our RescueWe work atClinic CatDogs are __PMC ManagerOur Pet StoreBlood SpinnerOur newest vet!Our CorporationWho’s that girl?Dr. Chuck’s breedThe OG technicianDr. Todd’s nemesisNot just a mustardSqueeze with caution!Heather’s favorite animalDr Kristin’s fabulous dog!Diabetic monitoring systemThe Great Pretender (dfdx)Dr. Kristin runs a lot of ___...

Emily's Birthday Word Search 2025-05-27

25 Items: sunteagameemilypartyall y'allcroissantbirthstonehair colormini colorzodiac signplace of birthwhat today is!!!____, emily ____animal i despiseupcoming vacation#1 lady of my lifefavorite breed of dog32 of these on a cakethe month of my birthfavorite kind of cakeband seen the most timescountry visited the most#1 fella of my life (RIP)...

unit12 2024-02-28

12 Items: to agreenot strongto zone outfit to be seento turn arounda standard scalea thin tiny stripnot taking any sidea helpful thing for work or your housean animal or person that moves non-stopnot feeling sorry about something you didhurting for no other reason than to do it for fun

united 2023-01-20

33 Items: leafsagemodemlaptopserverrouternutmegpenguinprinterwindowsdesktopcomputerdatabaseinternetfirewallhardwaresoftwarerosemarylavenderalligatorbandwidthcoriandertechnologyabsorptionthe study of mushroommain herb found in pestothe national spice of hungarythe main circuit board in a computerthe fastest land animal in the world...

Organization of Life 2025-02-04

82 Items: DNAFURDOGEGGKEYFOXLIFETREEFISHACIDTREECELLBEARSKINCLASSORGANPLANTFUNGIVIRUSGERMSTEETHORDERGENUSWHALECORALCLAWSAMOEBASYSTEMPHYLUMFAMILYSYSTEMENERGYDOMAINTISSUEARCHEAANIMALYOGURTDARWINTRAITSAVIANSSIMPLEKINGDOMSPECIESFLOWERSANTLERSMAMMALSBLOODEDCOMPLEXPROTISTBIOLOGYECOLOGYBLOODEDBACTERIAFLAGELLATAXONOMYLINNEAUSEVIDENCEREPTILESFEATHERSORGANISMBACKBONE...

Kipling Word and Symbol Search 2025-02-04

30 Items: WinterCub CubBat BearCity ClawKing Kitelair Lairrat RiverRock RockCave ChickDeep DholeEarth EchoHare HillsWolf CopperHunt Jungleleaf LeavesMang MonkeyMugger MuskRun SeeoneeTrain WaterCold CounselLost MammalsSunlight ThePanther PeaceSilence SnakeWhispers WildCouncil CoyoteElephants FangFootprints FrogOutcast Outdoor...

Christmas 2024-10-23

7 Items: Animal that pulls Santas sleighFrosty winter figure made of snowDecorated evergreen for ChristmasHung by the chimney for small giftsSantas little helper in his workshopWhat you give and receive on ChristmasJolly man who delivers gifts on Christmas Eve

Gatsby Vocab #2 2025-03-03

5 Items: a wild gatheringa plant or animal naturalized in a regiona slight suggestion or vague understandingcharacterized by extreme care and great effortcontented to a fault with oneself or one's actions

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Materials 2025-03-27

16 Items: A thick and stiff type of paper used for boxes.A strong, heavy metal used in buildings and tools.Dried plant stems used for animal bedding and hats.A soft, fluffy fiber used to make clothes and fabric.A hard, natural material found in rocks and buildings.A shiny, yellow metal often used for jewelry and coins....

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Draft 1 2025-09-03

94 Items: NPISKIDDMNDAESWSSAWESDDUFMMBUSPODSSURFZONEHOMECODEDISCKASSCADSOCHENRYSTUDYGAMESMOTORNURALOMEGAHANGARONTRACVISNAVCLARKEWALTONBEAUTYDIETFCDYSONGVACUUMANIMALMAXWELLJACKSONVILLAGELIBRARYCHAPMANCYCLONEJEMISONAIRWRAPFARMINGMOROCCOMAHJONGBIGBANDCONCORDETRAININGROEBLINGMALAYSIASECURITYHAMILTONGILBRETHAIRBLADEDELIVERYCLIMBINGROCKSTARBIRDCAGEISTANBULCHITOSAN...

DIET MEGA WORDSEARCH 2025-09-08

92 Items: DDMDDUNDANPISKIWESFMMMSCSSAPODSHOMEZONESURFBENGDISCMENGHENRYMOTORNURALOMEGAADSOCKASSCGAMESSTOMPSTUDYHANGARCLARKEWALTONANIMALONTRACVACUUMVISNAVBEAUTYDIETFCDYSONGCHAPMANLIBRARYJACKSONMAXWELLVILLAGEJEMISONAIRWRAPCYCLONEFARMINGBIGBANDMAHJONGMOROCCOCONCORDEMALAYSIAROEBLINGGILBRETHHAMILTONAIRBLADECHITOSANDELIVERYEMBEDDEDSECURITYCLIMBINGROCKSTARTINTAGEL...

Basketball Word Search 2025-04-04

89 Items: pianovideopotatotomatocamerabananaanimalcelerybicyclelibraryprivacyapricotvitaminladybugimagineanotherhistoryunhappybolognapajamasOctoberavocadobroccoliumbrellaenvelopetortillacomputerhospitallemonadecategorygiganticsandwichcoloringmagazinetomorrowSaturdayNovemberDecemberelevatormacaroniblueberryprincipalpiggybankpolicemantelephonebeautiful...

KERJAYA 2025-11-04

30 Items: DoulaActuaryShipbrokerProsthetistGeoscientistCIA LinguistFoley ArtistPuppet MasterHippotherapistEthical HackerCourt ReporterData DetectivePiano TechnicianWelding EngineerCity IoT AnalystVoice-Over ArtistWaterslide TesterMedical ScientistCreative CatalystForensic LinguistStunt CoordinatorAirplane RepossessorBlockchain ArchitectAnimal Control Officer...

Animales 2024-08-27

2 Items: Qué animal salvaje tiene un cuerno en su nariz y una piel gruesa.Qué animal salvaje es conocido por sus aullidos y pertenece a la familia de los cánidos.

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Spelling 5 2024-03-27

10 Items: opposite of badopposite of lastopposite of emptya running contestpast tense of takeround shape with no cornerssmall animal with wings and a beaksubstance on the ground where plants growan enclosure that usually contains pets like birdsto want something to happen or be true (root word with ing)

Clare's Big/Little Clue 3 2024-02-22

10 Items: What state am I from?What is my hair color?What sorority am I in?What color are my eyes?How many dogs do I have?Where do I do to college?What is my favorite movie?What music genre do I like?What is my favorite animal?What jewelry color do I like?

Medical Terminology C. 5 - The Body as a Whole 2024-11-13

10 Items: groinred blood cellblood productionpertaining to the tailpertaining to the extremitiesparalys of one or both eyelidsinflammation of the peritoneumdestruction of red blood cellscancer cells spreading to sites away from where they originatea minute microorganism that replicates only within a cell of a living plant or animal

2B Lesson 1-3: Make a Drum Set, The Animal Band, Musical Glasses 2025-12-15

30 Items: AddCanHitIanLidLowTapBoneDrumHighKikiKyleShowSoupBaronCarolFluteGlassGuessSoundTrunkBottomSingerDrumsetGlassesKitchenTrumpetDifferentDrumstickOrchestra

Animal Body Parts (Level 3 - L2) 2025-05-19

5 Items: necktusktrunkgiraffeelephant

Anniversaire 2024-03-24

13 Items: 1500Dans quel lieu ?Un point cardinalUne note de musiqueQui n'est pas encore mûreLà où le soleil se couchemettre à l'abri des regardensemble de pièces de monnaieAction de pour-suivre quelqu'un, un animalQui indique l'unité de début dans une sérieFaçon de s'exprimer, intensité d'une couleurCe qui guide dans une recherche, suivre une piste...

Wedding Wordsearch! 2025-07-06

9 Items: The best man's name.Toms favourite sport.Where they got engaged.Bec's favourite animal.The Man of honour's name.Where they had their first date.The best (men's) football team (according to Bec).The best (men's) football team (according to Tom).Who performed the song Bec walked down the aisle to.

#FINDINGDAHL - Matilda 2024-12-09

10 Items: Miss Honey's first name.The name of the librarian.Miss Trunchbull's real name.The name of Matilda's brother.The name of Miss Honey's father.Age when Matilda started reading.The name of Matilda's favorite author.The boy who ate Miss Trunchbull's cake.Animal that was in Miss Trunchbull's glass.A book full of mystery according to Matilda.

. 2025-05-13

10 Items: Bossa's mateNashville's hockey teamWe rode these around the netlove's trilogy water escapadeThe animal you petted at the zooPasta dish we helped my mom makeWe found an art _______ in a hotelWe are in a medium ____ relationshipHow we see each other while we're apartYour favorite veggie with lemon and honey

Autumn vocabulary 2025-11-15

10 Items: used to frighten birdsmade from autumn fruitlights in the night skyused to keep you hands warmused to keep your head warmused to keep your neck warmlight to help you find the wayan autumn fruit for making jamanimal which stores nuts in winterprovides heat at night near your tent

trs23 ver3 u2 2023-02-16

10 Items: Ha ha ha.Jump into water.Don't do something.Water that goes far down.Some water you can swim in.An animal that swims and jumps.What you get when you hit water.A colour between white and black.Between two corners. A dice has six.The place where you can walk across a road.

animales cual es el animal mas inteligente 2024-01-20

6 Items: catlionzebrahippoelephantMan's best friend

BESA Wordsearch 2025-07-21

10 Items: Which exec is Part V ENGSCI?What is Dharshan’s spirit animal?Which club was the Friendship Beads event in collaboration with?What is the surname of the exec with first name starting with ‘Y’?What popular game did Day 1 of the BESA Exec Retreat kick off with?Kevin, BESA’s Treasurer, loves which K-pop girl group (starts with L)?...

POSTIES 0325 BIG READ 2024-03-07

6 Items: very hota young catopposite of "strong"used a describe an animal that does not have a homea place where food and drink are served in a schoolto watch and check something carefully over a period of time

EMD Word Search Part 1 2025-12-02

6 Items: Pain Found on Card 1Type of Pain Found on Card 5Type of Attack Found on Card 3Type of Action Found on Card 4Type of Problem Found on Card 6Type of Reaction Found on Card 2

parkers manwuel amaral 2024-04-26

12 Items: a commandfront of buildinga line of soldiersdecent from ancestorsattach a boat to a ropeplants with shiny leavesa nose or jaw on any animalstand upright from the skina intense feeling of longing someonea word used when something is fallingsimple laws for any type of governmentsomething being stretched or mental pain

Word Search Qualifying worksheet 2025-07-23

15 Items: failureOpposite of fullOpposite of weakA huge water bodyOpposite of narrow- Opposite of liesPresident of India- capital of JapanNational animal of IndiaTop colour in Indian flagNatural flowing water stream- someone who governs a state- Father of Indian constitutionThe largest planet in our solar system...

Bats 2025-08-20

7 Items: Baby batsWhat bats like to eatA place where bats liveA name for bat droppingsSomething that bats do in the wintertimeHow bats find their way around in the darkWhen an animal is active at night and sleeps during the day

For you my sweet boy 2025-12-03

14 Items: What’s my nameWhen did we meetOpposite of grassI love ___ so muchYou ____ me obviouslyYour my favorite __________My favorite trip we’ve takenI hope you find this _______Let’s blow this ________ standI can’t wait to _____ you babyI put a lot of _______ into thisThe nickname I call you the mostDo you remember my favorite animal...

Word List 1 2025-12-05

7 Items: comfortable and warm: ______________comfortable and warm: ______________a type of person or thing: ______________to make or see a connection: ______________giving off steam due to being very hot: ______________the amount of time a person or animal has lived: ______________information that helps a person find, understand, or solve: ___________

13 2025-08-16

14 Items: A planned group ride or eventFemale members united as familyStrong bond between club membersA group of riders traveling togetherFaithfulness and devotion to the clubanimals killed on the road by vehiclesA line of motorcycles riding in formationA large gathering of bikers and enthusiastsa sum paid for killing or capturing a person or animal...

Spelling list 2024-01-08

9 Items: A lung diseaseTo attempt somethingBelonging to a collegeSomething men use to smell goodA fancy sparkling alcoholic drinkA pocket of puss on animal or humanA voice in your head to tell you what to doWhen you are torn between 2 different thingsA way of pronouncing words in different countries

jobs 2025-11-27

3 Items: DESERT MANGO PLANTSCITY SCHOOL BOOK SMILE MUSIC OCEAN RIVER FOREST SPACESPORT PEOPLE HILL BLUE CLOUD APPLE STARS WATER ANIMAL, HOUSE

Guadeloupe et Martinique 2025-05-12

9 Items: firecrackeron se déguise avecbeaucoup de personnes/gensil y a des chars dans un....c'est la période après le mariageun animal qui se bat avec les serpentsportée par les hommes pour etre éléganton les utilise pour observer les oiseauxon peut voir les tortues marines en faisant la ___ sous-marine

Animals 2024-04-28

20 Items: MilkShellTrumpetSlitherRibbit...Feline friendFast boi lionUgly pink fishyMan's best friendKing of the jungleStriped black and whiteGoldilocks and the threeGray dog with sharp teethBaby _____ do do do do do doGigantic semi-aquatic creatureSlowest animal stereotypicallyGiant reptiles that went extinctThey have wide heads/eyes with no lids...