and the blade Word Searches

Vocab 2B 2025-03-06

24 Items: signwoolsilktightstyleloosebrandcottonbrightbargainleatherentrancethe salethe exitto chooseshoe sizeto try onthe marketin fashiondark colorlight colorclothing sizecash registersynthetic fabric

List 13 2026-01-20

30 Items: meantlaunchcareervariousathletelaundryorchardpicturenoticedvisibleIndianadevelopgenuinecautiousdisguiseassemblywastefulqualifiedautographlibrariangreatnessvegetableauditoriumattendancesignificanta diffficult choicehelpful; producing gooda person who one knows only slightlythe layer of air surrounding the earth...

hi 2025-11-12

9 Items: – the killer’s last name– the people he targeted– where many victims were found– the investigators on the case– evidence that led to his arrest– his main mode of transportation– how he admitted to dozens of murders– the area where the crimes took place– what investigators worked to achieve

Christmas 2025-11-30

7 Items: globestoppersWreathsStockingsand baublesNutcrackersand garlands

Household chores 2023-04-04

8 Items: the dogyour bedthe tablethe tableyour roomthe plantsyour clothesout the rubbish

Word Search: Understanding the Winter Solstice and the Changing Seasons 2024-12-18

19 Items: SunSunFallTiltOrbitNorthSouthWinterSummerSpringVernalSeasonsEquinoxEquatorSolsticeAutumnalDaylightDecemberHemispheres

vocab 2026-01-22

10 Items: poorwind-blown(bonus2) big black birda farmer that shares landanother word for lonelinessword with over 189,000 lettersin the state of producing something(bonus) mars helicopter made by nasapresent in large quantities or amounts...

Mattot - Massei 2024-07-27

18 Items: מֹשֶהמַטוֹת“Neder”שְׁבֻעָהיִשְׂרָאֵלSon of Nun.Son of JephunnehHe died on Mt. Hor at age 123To grant pardon for an offense.Anyone who kills anyone may flee here.After leaving Ritmah, Israel camped here.You are not to pollute the land with this: ______“My house shall be called a house of ______ for all nations.”...

Food , Drinks and deserts 2023-12-21

138 Items: hammilkcrabporkPORKmushyamswaterlagerlattestoutgritssushicoffeefrappegrappaeggnogoolongbrandycognacshrimpwafersturkeyquinoapotatosalmonsalamifondueseltzerslushiechicorylobsterhotdogslasagnawafflesoatmealpumpkinmuttonsoxtailslemonadesmoothieiced-teaestragonabsinthepancakesporridgepigtailspopsiclemilkshakecherryadeorangeadeiced-beerroot-beergreen-tea...

WORD SEARCH 2025-10-09

7 Items: did I go with? Parentsdid I go for New Year? Zagrebdo my mom and I make? Cookiesis the god of beginnings? Janusis in the sky at midnight? Fireworksdo people say to each other? Happy New Yeardid the Babylonians celebrate New Year? Spring

TKAM CH 15-20 Vocabulary 2025-03-28

20 Items: tactless; boldappearance; facestrike out; erasestaggered; stumbledthe esophagus; throatintimidating; bullyingan unpleasant situationa particular course of actiondirect and unreserved in speechwashings; the process of bathinga feeling of resentment or ill-willwith great anger, hatred, or ill-willfamiliar; having personal knowledge of...

Danish Days of the Week and Months 2025-05-29

19 Items: MajJuniJuliMartsAprilMandagOnsdagFredagLordagSondagJanuarAugustTirsdagTorsdagFebruarOktoberNovemberDecemberSeptember

Magdy Yacoub Word Search 2025-08-07

10 Items: Being known by many peopleA doctor who does operationsA special hospital for heart problemsWanting to know or learn something newTo make (someone) want to do something.When someone gets a new heart from another personA person who is getting medical help from a doctorUsing new and smart ideas to do things in a better way...

BioMid Review 2025-12-09

31 Items: the study of cellsthe study of cells2nd phase of mitosis1st phase of mitosis3rd phase of mitosis4th phase of mitosiscondensed threads of chromatinDNA to RNA; occurs in the nucleusDNA enables life through this criteriaorganelle responsible for protein synthesisRNA to protein; takes place inthe cytoplasm...

Household jobs 2025-12-12

8 Items: assemblyhigh schoolmake the bedfeed the catset the tabletidy your roomblock of flatsvacuum the floor

Freedom 2025-02-12

9 Items: synonym for freedomantonym for freedomthe ability to choosethere is no freedom without _________one of the four freedoms related to securityone of the four freedoms related to expressionone of the four freedoms related to economic needsone of the four freedoms related to belief/religion...

Whole Word Search 2026-01-29

11 Items: – Feelings of failure or low self-esteem.– Sense of pride gained from mastering skills.Thinking – Logical thought based on real situations.Intake – Nutrient essential for bone and tooth development.– Adequate water intake to support energy and concentration.Protein – Foods that support muscle growth and tissue repair....

Dishwasher 2025-01-07

10 Items: Tough leatherKeenly astuteRevise or repeatMade a sibilant soundOne who provides shadeTopmost part of the bodyCrunchy garden vegetablesMoved with a rushing soundItems like plates and bowlsUnderworld in Greek mythology

VOCABULARY UNIT 5 2025-09-25

10 Items: FOODA DOGSOMEONEA FENCESHOPPINGTHE PLANTSTHE WINDOWSAFTER A CHILDSOMEONE A SEATUP THE RUBBISH

Bell Word Search 2024-01-27

9 Items: A band fastened around a horse’s belly that’s used to secure a saddle.Blanket A covering designed to fit your horse to keep them warm and dry.A rider’s seat, typically made from leather, that is fastened on a horse’s back.A head collar that fastens around the horse’s head and nose for leading or tethering it....

Marketing position & differentiation 2024-10-03

10 Items: a benefit of adding value #changing customer perceptionsbulk buying leads to reduced costshelps identify niches and gaps in the markethelps your product to stand out from competitorsadds value by allowing customers to personalise the producthow consumers see products or brand in relation to competitors...

Deluge Word Search 2025-10-27

15 Items: To move back or away from a previous position.A powerful tropical cyclone with violent winds.In a way that shows great energy, speed, or anger.Extremely large or great in size, degree, or extent.Scattered pieces of waste or remains after destruction.Walked heavily and slowly; worked hard and persistently....

pbs and full house 2024-10-07

7 Items: Disney is the Alexa in Disney resortsCameron is Mike seaver in growing painsMathews friend is miaya in girl meets worldbible is written by many of jesuses followerstanners catchphrase in full house is oh my lantamonster is a sesame street character that loves cookiesdoc is in and she fixes you up is from the doc McStuffins theme song .

Analyse Word Search 2025-12-15

45 Items: limit somethingchange something slightlynotice or watch carefullyexpect something to happenremove something completelyproduce or create somethingreact or reply to somethingchange something completelysuggest something indirectlyresist pressure or difficultyreplace one thing with anothersupport or keep something goingstrengthen an idea or behaviour...

Cause Word Search 2025-10-12

10 Items: a problemimportantnot wantedeasy to useabsent-mindedbrother or/ and sisterto achieve the desired aima careful study of a subjectto show that something is trueto agree that something is true

Christmas Wordsearch 2025-12-11

12 Items: giver of giftssanta's helpersKEVIN!!!! (movie)a pepperminty treatwhat pulls the sleighwhere does santa livea plant you kiss underwhat did the Grinch stealwhat Santa leaves under the tree𝄞do you want to build a _______𝄞it's shiny you wrap the tree in itput it on the tree to make it bright

Rosa Parks and the Montgomery Bus Boycott 2025-02-25

19 Items: heroseatbusesNAACPtrialRacismleaderAlabamaprotestboycottfreedomjusticeequalityarrestedpassengerRosaParksMontgomerysegregationinspiration

The Amazing human body: Structures and Functions 2026-02-11

19 Items: CellProcessOrganismBacteriaFunctionsHierarchyHumanBodyMoleculesOrganellesOrganLevelStructuresMicroscopeOrganSystemTissueLevelUnitsofLifeChemicalLevelCellularLevelPhysiologicalBuildingBlocks

Rivers and Lakes 2024-10-18

11 Items: Longest river in CanadaLargest lake in North AmericaLargest lake in South AmericaFLows through the Grand CanyonLongest river in North AmericaLargest river in North AmericaNation that Lake Maracaibo is inLongest river in the Western HemisphereWhich of the Great Lakes is the smallest?Furthest south of the large lakes in Canada...

LA 2025-01-23

11 Items: or play.represent the word.supported with evidenceexpression of a point of view about aThe task of combining sounds rapidly, to– A struggle between opposing forces in adifferent things to show the similarities.A comparison of the features or qualities of– The specified or clearly implied person(s)– An inclination or tendency towards an idea...

No Credible Threat 2025-07-03

35 Items: Who manages a spy?What is a secret code?What is a false identity?Who is an infiltrated spy?What did they squeeze past?What were cameras compared to?What aura did Ron Evans exude?What is short for intelligence?What is a captured communication?What is an origin of information?Who hurried alongside the lawyers?What is a pre-mission instruction?...

Crime Short Story 2025-11-10

15 Items: The grocery store ownerOfficer who caught the thiefBen took money from the _______Entering a building to steal somethingDamaging someone’s property on purposeOfficer Rivera was on neighborhood _______Ben smashed a _______ to get inside the storeBen said he wanted money to buy a new _______The story takes place on a quiet _______ afternoon...

FNL WORD SEARCH 2024-03-01

14 Items: Man's best friendIs patient and kinddealing with the mindIntended to be marriedNot a child or an adultchosen profession or occupationMay denote either husband or wifeA lot of different groups singingA serious disagreement or argumentThe largest planet in our solar systemAble to exist together without conflictrelating to society or its organization...

Unit 14 2025-12-02

13 Items: to bring aboutfollowing in orderhappening repeatedly(latin meaning “to run”)the way something is done(latin meaning “to step”)(latin meaning “to walk”)(latin meaning “to follow”)one that carries and delivershaving no effect or importancea policy involving slow, measured actionsto move away from the topic at hand; ramble...

Frog Word Search 2025-03-13

8 Items: Moving airWater falling from the skyThe atmosphere above the EarthThe time when it is dark outsideSomething that makes things visibleAt a great distance from the groundA small, shining point in the night skyA star at the center of our solar system

Aisle Word Search 2025-09-11

8 Items: The bride to beThe groom to beWalk down the ___A wedding cake often has many of theseMARS The couple’s first concert togetherTraditionally carried by the bride symbol of puritySomething old something new something borrowed something ___Location of the couple’s pre wedding photoshoot on the first page

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

3.Temperature Word Search 2025-07-14

27 Items: DownAdult cats have 30 designed for their carnivorous diet.HISSING Defensive vocalization warning others to stay away.TERRITORIAL Cats are animals that mark their space with scent.Used for balance and communication, containing 19-23 vertebrae.Indoor cats typically live 13-17 years, outdoor cats 2-5 years....

6th grade - Poem for My Librarian, Mrs. Long 2025-11-21

11 Items: a porch swinga condition or statea cabinet for clothesa machine that plays musica person who leads a churchthe actions of the governmentcausing shame or embarrassmentdespite what has just been saida building that has books to lendto take and use for a period of timea small device, such as a radio, that can be carried

SCHOOL 2022-10-23

39 Items: gottWORKknoxzayetreythirdfifthlexiaWORDSstoneschoolmartinmurrayraptorfourthDREAMSpiercehaywardpencilsenglishwritingsciencehistorytomlisonhomeworkphysicaldivisionadditionsandstoneIN SCHOOLcomputerseducationelementaryAND DONUTSvocabularyAND MUFFINSsubtractionkindergartenmultiplication

Authors Word Search 2025-03-18

34 Items: IdeaFactOrderCluesCauseValidIndexPrintInformEffectPurposeSummaryOpinionof ViewSynonymAntonymOpinionCaptionHeadingDiagramItalicsEvidencePersuadeFeaturesGlossaryInferenceEntertainSummarizeParaphraseSubheadingDescriptionof Contentsand Contrastand Solution

Evaporation Word Search 2025-11-02

3 Items: Water falls from the sky as rain, snow, or hail.Water changes into vapor and goes up into the air.Water vapor cools and turns back into tiny water drops.

Nationalities 2025-11-11

20 Items: from Iraqfrom Egyptfrom Japanfrom Chinafrom Nepalfrom Brazilfrom the UKfrom Turkeyfrom Francefrom Greecefrom the USAfrom Irelandfrom Finlandfrom Germanyfrom Senegalfrom Portugalfrom Pakistanfrom Palestinefrom Afghanistanfrom the Netherlands

List 12 2026-01-20

30 Items: sugarcozierhurriedtyphoonanalyzetidiesthydranta pilotchampionheaviestcirculardynamitefancifulcriticizeLouisianagymnasiumdifficultymissionaryvictoriousreputationthe resultpermissibleconversationencyclopediacongratulationsthe absence of prideto soak up or take inshowing complete agreementto get in the way of; to prevent...

A Wrinkle In Time Vocabulary Chapters 1-2 2024-04-18

15 Items: Angry and aggressive.Likely to do something.Cautiously or carefully.Thinly spread amount or supply.Without intention; accidentally.A state of being calm or peaceful.A state of uncontrolled excitement.The clearness of a person’s speech.A ghost or ghostlike image of someone.Feeling or showing open dislike or disrespect....

Argumentative Texts 2023-03-03

12 Items: factsclaimA statement that opposes the claim.Something that has been proven true.A personal view,belief,or judgement.To try to establish the truth or something.A piece or writing that focuses more opinionsthe main points made in your essay to justifyA proof that the author uses to backup a claim.a process of feelings towards a certain topic....

Spelling & Vocabulary Wk. 7 2025-09-09

10 Items: you personallyin opposition to.the day after today.destroy or obliterate.disappear suddenly and completely.an instance or manner of greeting someone.perceive the intended meaning of (words, a language, or a speaker).not the same as another or each other; unlike in nature, form, or quality....

Dylan Villacis Ch4 2025-11-12

10 Items: Large estateTo cancel a lawA representative to a meetingA crop mainly produced for saleThe quality or state of being freeTo refuse to purchase certain goods or servicesOne who opposes official or commonly held viewsA government in which the citizens hold the power to ruleA representative government in where citizens choose their lawmakers...

the best one 2025-11-12

10 Items: Large estateTo cancel a lawA representative to a meetingA crop mainly produced for saleThe quality or state of being freeTo refuse to purchase certain goods or servicesOne who opposes official or commonly held viewsA government in which the citizens hold the power to ruleA representative government in where citizens choose their lawmakers...

READING TUTOR 기본 CHAPTER10_REVIEW4 2022-09-19

12 Items: of or relating to the mindnot completed, not finishedto notice or pay attention to (something)to give (someone) a reason for doing somethinga feeling of nervousness that makes you unable to relaxa piece of work that has been given to someone, a job for someone to doan agreement between two or more people or groups that helps each in some way...

שמואל אי פרק ח 2024-01-15

13 Items: Shmuel's son #1Shmuel's son #2The Jews complained to himJews asked for this from ShmuelShmuel's sons settled in this cityWhoever says the sons of Shmuel sinned is ___A king could make their daughters ___ makersThe Jews weren't meant to be like the other __A king will take this much of the people's grain...

Present Simple Verbs 2026-01-15

14 Items: She (teach) English.She (kiss) her baby.He (brush) his teeth.He (jump) on the trampoline.John always (rush) to class.He (kick) the ball very well.She(cook) breakfast at 8:00am.Amelia (walk) to school every day.She (watch) tv before going to bed.The dog (push) the ball with his nose.The student (read) a book every night....

Spanish Vocabulary Practice 2026-02-13

14 Items: the result of winingthe final boss of gameswhere soccer takes placeyou shoot or dunk into itthe result of working outyou shoot a ball into thisyou wear this during a gamewhere basketball takes placeis used in the Tour de Francethe people who watch the gameused by fútbol americano playerssomething that protects your head...

Vocab 2023-03-03

10 Items: Something that has been proven true.A personal view,belief,or judgement.To try to establish the truth of something.A process of feelings toward a certain topic.A statement that the author is trying to prove is true.Reasons why the counter-claim is as valid as the claim.A statement that opposes the claim. Shows the other side....

Root words 2024-01-10

22 Items: to surrender.able to walk.to bring about.to slip away, go byfollowing in order.happening repeatedly.to casually walk awaycomplete failure and ruin.the way something is done.sweetly flowing or sounding.to make less heavy or serious.something given up or yielded.one that carries and delivers.having no effect or importance....

AI & Testing 2025-10-28

8 Items: A tool used for tracking and managing defectsAlgorithm type inspired by biological evolution.The field focused on building intelligent systems.A type of testing performed without executing codeMeasures how much of the code is executed during testsPertaining to network architectures inspired by the brain....

Fall Word Search 2025-10-28

8 Items: Common grounds' fall treatThe small nut of an oak tree.Common grounds' refreshing drinkA warm or cold drink made from pressed apples.A tree known for its fall leaves and sweet syrupThe traditional main dish at most Thanksgiving feasts.A crisp, juicy fruit that is used for dipping in caramel or making pie....

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

Winter Word Search 2025-12-18

24 Items: NOELXMASIGLOOQUILTEGGNOGLIGHTSUNWRAPWREATHGARLANDPRANCERSNOWMANTHERMALZAMBONIBLIZZARDHOLIDAYSKNITTINGOVERCOATVACATIONCHRISTMASANTARCTICA____ THE HALLSHAVE A _____ CHRISTMAS!_____ THE RED-NOSED REINDEERHAVE A HOLLY _____ CHRISTMAS!

Christmastree Word Search 2023-11-14

3 Items: thing you put on top od the treethe man who brings presents to kidsthe tree you decorate with lights and ornaments.

Friend Word Search 2026-02-06

10 Items: - to give or use things together- being nice and caring to others- doing something good for someone- a happy face shared with friends- showing love and concern for others- paying attention when a friend talks- someone you like, trust, and play with- having fun together with games or toys- being with friends and helping each other...

Dolphin Word Search 2025-02-11

10 Items: A highly intelligent marine mammalA crustacean known for its large clawsA marine organism that forms coral reefsA small fish known for its horse-like headThe largest mammal on Earth, living in oceansA large predatory fish found in oceans worldwideA gelatinous creature with tentacles that can stingA slow-moving reptile, some of which live in the sea...

Vocab Test 47-49 23/06/2025 2025-06-20

10 Items: With good judgment or sense.A false belief or impression.In a careful and unnoticeable way.Something that discourages or prevents.The act of putting off to a later time.In a way that shows careful good judgment.The act of taking away from the value or reputation of something.Feeling bitterness or indignation at having been treated unfairly....

MARCH EOS - HEART HEALTHY 2014-03-06

16 Items: andRedHeartBloodOmegaThreestrokelivingFitnessHealthyExercisePressureNutritionCholesterolAntioxidantCardiovascular

Sanya Vacation 2016-05-18

16 Items: FunBayMGMBarandFoodChinaOceanCoastSanyaHotelWaterGrillFishingDolphinVacation

Millie's camp word saerch 2025-08-06

16 Items: andfoxbigclipfoodfreetimeflingswingsleepclimebdinnerlslandcabinesphillipbreakfast

Unit 3 'a' - Focus Word Search 2026-02-15

16 Items: atamanmanbadhadDadmatsathasandbackthathavehandfamily

Hund Word Search 2025-04-22

16 Items: musandhundkattkaninrotteilderslangehamstermarsvinkyllinggullfiskpapegøyeparakittkanarifuglfugleedderkopp

Memory Verse Search 2025-12-29

18 Items: meinmemyandforyouaregodyourfivefiveGuidetruthteachsaviorPsalmstwenty

Unit 11 2022-11-28

12 Items: A minor official.Unbeatable, resilient.To swear off, renounce.Forcing others to obey.Breaking of a legal oath.Having to do with the law.Being most evident or apparent.To give credit or recognition to.Group of the most welthy and priveleged.To bring forth, especially through words.A government by a religiuos leader or figure....

Unit 11 Greek and Latin homework - Ainsley Haws 2024-11-10

12 Items: a minor official.unbeatable, resilient.to swear off, renounce.forcing others to obey.breaking of a legal oathhaving to do with the law.being most evident or apparent.to give credit or recognition to.to bring forth, especially through words.group of the most wealthy and privileged.a government by a religious leader or figure....

Greek and Latin Word Search Unit 14 2025-01-08

12 Items: able to walk.to bring about.following in order.happening repeatedly.to casually walk, stroll.the way something is done.one that carries and delivers.having no effect or importance.to move away from the topic at hand, ramble.a policy which involves taking it slow, measuredto go back to a less mature or less positive state....

Unit 16 2025-01-20

12 Items: rough likeness.to make hostile.to mimic, imitate.a fight or dispute.a change or modification.not able to be taken away.symbolic rather than literal.change in form, transformation.to conceal the truth, to deceive.a name that is not one’s true name.to go back and forth, change from one thing to another....

Unit 17 2026-01-21

12 Items: harmfulfull of life, cheerfulpreserve in memory foreverclear and sharp impressioncause extreme embarrassmentable to break down naturallyin a dying or death like stateharmful to physical or moral healthmutually beneficial to one another's lifethe act or process of bringing back to lifeto take an unhealthy interest in unpleasant things...

DOLCH SIGHT WORDS - List 1 2016-06-10

17 Items: aamanasatallandanyareaskateawayaboutafteragainalwaysaround

Dignity and Respect In Social Care 2019-01-20

18 Items: andcareCareEatingValuesDahliaRespectDignityCulturePrivacySupportQualitydrinkingPersonalPositiveMedicationIndependenceCommunication

U 1 2021-09-29

17 Items: hesheandnamefromlatemissunitgoodyoursorryhellogoodbyemorningestoniaamericaBritain

Massimo Find 2 2024-08-31

17 Items: ItManCanNapTapCatHatSatPatSadandkitsithavesaidLookschool

UFLI 35b HFWs 2025-01-17

17 Items: amanbamdamhamjamramyamandbancanfanmanpanrantanvan

Matthew 11:28 2025-08-03

19 Items: ItomeofallyouwhoandyouandareComegivewillrestheavycarrywearyburdens

Psalm 139:14 2026-01-11

18 Items: Iammyforandarethyandmadethatsoulwellworksrightknowethfearfullywoderfullymarvellous

weekly words 2026-01-13

17 Items: endandsendpickbothfastlastmustjustbaththatblackfamilyTuesdayJanuaryDecemberNovember

Library Database Terms 2026-01-29

17 Items: ORNOTANDReadHitsSortEBSCOQueryFilterKeywordBooleanDatabaseAdvancedCitationOperatorNOODLEToolsSearchengine

Evy wordsearch 2021-09-13

17 Items: anandlovehatemeanballchasehappyleaveweaverfleeceleavesunhappydislikeballoonsoftballbaseball

Philippians 4:19 2023-03-25

17 Items: mybyintohisallgodandneedyourgloryshalljesussupplyricheschristaccording

TASK ONE 2023-07-12

17 Items: weistoaretwoandyourmakeusingknowndangercomingcontacthundredwatchersthirteenyourself

Happy Holidays 2024-12-24

18 Items: ofinITandNewandyouSEEYearlotslove2025wishMerryHappyhealthhappinesChristmas

Week 1 Spelling Words 2025-09-12

17 Items: aasadandcanmanaskhadhaswasaddplanhandthanthatlaststand

Phonetic for fun 4 2025-12-23

17 Items: ANDAXEBADBEDENDGEMJAMMANMENPANPATPENPETBRADSANDSENDBREAD

4 MAJOR DATA COLLECTION METHODS 2023-01-26

4 Items: Real-time data collection and describes behaviours that are happening at the present momentMost widely used technique for collecting data in organisation design - can be done in groups or individualFixed-response queries about various features of an organisation and can be administered to larger amounts of people simultaneously...

From the Garden to the Cross 2025-04-01

9 Items: JUDAS (The man who betrayed Jesus with a kiss.)LOVE (The reason Jesus willingly bore suffering.)HOPE (A quality that sustains believers in dark times.)WATCH (What the disciples were urged to do while Jesus prayed)SACRIFICE (The ultimate act of sacrifice given by Jesus on the cross.)...

2.2 Motherboards 2025-08-03

12 Items: System MemoryBrains of the ComputerMemory integrated into CPUmechanical persistent storagesolid state persistent storageHarmful electro static discharge can damage componentsmicroprocessor optimized for rendering 2-D and 3-D imagesExpansion slots standard interface for modern adapter cards...

SWEtacular Word Search_3 2025-09-12

6 Items: Hosts an annual STEM conference for 100+ high school girls.Designs flyers, manages social media, and promotes SWE eventsEngages the broader community with STEM events and SWE volunteers.organizes events like shadowing, resume reviews, and mock interviewsRuns a 10-week coding program for middle school girls taught by SWE....

The One and Only Word Search 2021-01-15

14 Items: BobIvanRubyMackBossKimuSaraMayaJuliaRowdyStellaGeorgeKinyaniSnickers

Day 4 2019-11-30

16 Items: heheatbigandrunhimbuthasforwhatfourafterbrownblackstrong

Spelling Bee List 6 2024-06-02

15 Items: asiforsoandbutthanwhenuntilwherewhilethoughunlessbecausealthough

Sight Words 2025-03-23

16 Items: Imeupinseeandcantworunyouandbigplaylookfindfunny

Conjunctions 2025-10-05

15 Items: asiforsoforandnorbutyetaftersinceuntilwhilebeforebecause

Infectiousdisease Word Search 2025-08-27

14 Items: contact with blood or salivabites or stings pass on the diseasesmallest type of pathogen i.e. covidfrom ingesting infected food or watertiny living things that cause diseasetiny living cells i.e. food poisoningcan be passed from one person to anothercan grow on the skin or body i.e. ringwormthe process of regulating body temperature...

Mom's Birthday Word Search!!! 2025-12-23

14 Items: Your birthday teaDownton Abbey's last installmentGame we played with the Peloso familythe most haunted place you've visitedThe scary place we never want to visityou have been my biggest _____ this yearThe Tearoom where we have afternoon chatsthe musical we saw at ASU Gammage this yeara concert we invited you to on short notice...