and the blade Word Searches

Tetzaveh 5.0 2025-03-01

13 Items: Mishkan“Mitzvah”Our Kohen Gadol.Aaron’s firstborn“You shall command”Aharon’s youngest son.Hide it under a bushel, NO!His name means “He (G-d) is my father”his name is not mentioned in portion Tetzaveh.“I regret having made ______ king “, —The Holy OneWhat kind of oil was used in the menorah for the light....

Earth and Its Neighbors 2025-12-18

11 Items: our planetthe star of our solar systemsomeone who travels in spaceis the closest to planet eartha vehicle used to launch somethingthere are 9 of these in our solar systema device used to see things that are far awaycollection of planets that revolve around a suna force that moves something quickly and powerfully...

Ghost Town at Sundown Chapter 5 2023-06-05

10 Items: What is the cowboy's job?What is the sister's name?What is the cowboy's name?What is the brother's name?Who stole all the mustangs?What is the horse's real name?What nickname does the cowboy give to Jack?What nickname does the cowboy give to Annie?What is the name of the horse that Annie gave?...

Do you really know us or did you get your invitation card through connections? 2025-01-30

10 Items: / where did the couple meet?/ what profession is the groom?/ What is the bride's favorite food?/ Where was the couple's first date?/ how many years has the couple dated?/ How may years is the groom's dreads?/ Which month did the couple get engaged?/ what is the name of the bride's business?/ which month is their dating anniversary?...

Vet Med Term Word Search 2025-12-01

32 Items: WartsFat tissuePain (suffix)Dead on arrivalAbsence of teethA newborn animalA neutered male rabbitLacking normal muscle toneSoftening of tissue (suffix)A complete joint dislocationDull, depressed, nonresponsiveThe cause or origin of a diseaseThe way an animal moves or walksA tumor made of mucus-like tissueLethal dose (amount that can kill)...

Sabotchick - English Honors 9 & 10 2025-04-10

30 Items: nothingeagerlyunderstandsharp; painfulstrong, healthybecame ashen or palehave dealings; tradeattack with a lawsuitwretched, evil conductclever, shrewd, craftydiscredited or disgracedto avoid answering directlywidely and unfavorably knowndeny; ignore; pretend not to seelacking legal or moral restraintsaffected by witchcraft; in a spell...

FIND THE 60 PLACES AND WORDS 2014-03-06

72 Items: NewNewCityYorkRomeDukeFordFiatTexasExcelUriahRileyMiamiParisItalyGothsChevyDodgeFriscoTunnelMobileJerseyLondonBerlinFranceGreeceRussiaMexicoCanadaLakersSaintsFranksChurchKansasAlabamaGeorgiaRedGoatAtlantaMemphisSpringsFloridagonolesEnglandGermanyPrussiaUkraineFinlandCowboysPackersLincolnMercuryBeatriceCrossingRollTideArkansasScotlandVirginia...

Perseus and the Gorgon Week 1 2020-04-24

27 Items: seabagZeusmythcaveZeusCetusswordGorgonMedusashieldspearsguardspriestPerseusCepheusscattercoweredleatherwitcheseyeballPoseidonappalledAndromedavillagerssacrificePolydectes

Sermon on the Mount (and more) 2023-02-18

43 Items: hidjotmeekcityhillfoolfiremournmercyhappylightworldshineworksleastteachgreatangryhungerthirstheavenrewardbushelcandlefulfiltittledangerkingdomblessedrejoiceglorifydestroyscribesmercifulcomfortedphariseespersecutedpureinheartpeacemakerscandlestickpoorinspiritcommandmentsrighteousness

Harry Potter and the Philosopher’s Stone 2023-08-08

20 Items: tykecloaknoblesternbundlehedgesseizedshrillastridecraninghoodlumproddedrattledfalteredpeculiarslinkingshudderedgrudginglyvigorouslyexasperated

The Perfect Woman and A Princess 2015-02-09

20 Items: loveZeusHerabullstonecarveCreteshorepolishCyprusEuropaEuropeGalateaOlympusjealoussculptorprincessPygmalionAphroditeperfection

ARTISTS OF THE 60s AND 70s 2024-01-02

21 Items: thewhobenkingbobdylanthebyrdsraycharlesthebeatlestheholliesthemonkeestherascalsotisreddingthesupremeselvispresleysteviewonderthebeachboysarethafranklinthejacksonfivethetemptationstherollingstonessimonandgarfunkeltheeverlybrothersthejimihendrixexperience

Jack and the Beanstalk - Character Search 2024-05-08

23 Items: zekejackjillmamapapalucyanniedixiepollypropsharleyeloiseflossiesetcrewartistscostumesmusicmakerolddantuckerstagemanageroldladytuckermissboobooheadmissboobootailstrumalongcassidy

The Gilded Age and Progressive Era 2024-05-21

25 Items: trustsreformstrikesgildedagejacobriisthejunglemonopoliesmuckrakersjaneaddamsimmigrationlaborunionsprohibitionrobberbaronsurbanizationsocialreformtrustbustinguptonsinclairprogressiveerawomenssuffragepoliticalreformindustrializationtheodorerooseveltcaptainsofindustrytemperancemovementshermanantitrustact

"The Honeymooners" (Fácil) "Ralph and Alice" 2024-08-17

20 Items: busYorkRalphAlicehoneyjokeshumorNortonanticsiconicfamilydrivercomedysitcomKramdenmoonersclassiclaughtertimelesstelevision

The Destruction of Sodom and Gomorrah 2025-04-27

22 Items: lotsinsonlordfiresalttentgateburnsarahsodomcrowdangelspillarcaananabrahamgomorrahgreavousbrimstoneblindnessmountainstownsquare

The Art of Suspense and Tension 2025-05-01

25 Items: StakesPacingReaderWriterClimaxTensionSubtextDilemmaEmotionSuspensePalpableEscalateConflictThrillerNarrativeCatharticVicariousPlotTwistHitchcockAntagonistProtagonistWithholdingUncertaintyStorytellingForeshadowing

The Birth of Rock and Soul 2025-05-27

20 Items: RNBJazzSoulBluesGospelDooWopRhythmCountryRocknRollBoDiddleyRebellionChuckBerryDistortionWorldWarIIJohnnyBGoodeAmericanDreamElectricGuitarGreatMigrationAmericanTeenagerDionandtheTeenIdols

Violence and Harassment in the Workplace 2025-10-22

30 Items: AGEEFAPRACECOLOROFFENDREPORTDEGRADEASSAULTPROTECTTHREATSVIOLENCEBULLYINGANCESTRYRELIGIONESCALATEDPREVENTIONINTIMIDATEHARASSMENTINVESTIGATECOMMUNICATEHUMANRIGHTSDEESCALATIONDOMESTICABUSEGENDERIDENTITYDISCRIMINATIONMARIATALSTATUSMENTALDISABILITYPSYCHOLOGICAlHARMSEXUALORIENTATIONPHYSICALDISABILITY

Saints and Women of the Bible 2025-11-17

20 Items: MaryAnnePaulPeterJosephCeciliaDeborahPatrickTacisuisBathshebaPriscillaJoanofArcQueenEstherCarloAcutisAngesofRomeMariaGorettiMaryMagdeleneFrancisofAssisiThereseofLesieuxElizabethAnnSeton

Health and Safety in the workplace 2025-12-08

53 Items: RiskFireExitSignSafeTidyTeamDutyTaskAlarmDrillCleanOrderRulesLearnAlertFocusSafetyHealthHazardDangerInjurySecureSystemPolicyReportRecordListenFollowComplyIllnessWarningProtectControlManagerObserveRespectCarefulSuccessAccidentFirstaidStandardIncidentEmployeeTrainingPreparedWorkplaceEmergencyProcedureChecklistInductionEvacuationSupervisor

Find the words and learn them 2025-12-14

57 Items: eyeearlipwifesinkwildsofahandkneeshelfcurlyonionsheettowelshareeventmirrorleaveshikingfridgegarliccarrottonguewolvesbrowseuniqueglovesmincercommonexpectseasonusefulweatherjoggingsciencecabbagespecialoutsideillnessceilingbelieveexplaineveningexcitedwardrobeelephanttomorrownowadayscolorfulyesterdaydifferentyesterdayrelativesmountainsadventure...

Find the words and learn them 2025-12-14

90 Items: fogviabandcoalwavyhailplotlackvastjudgestorefrankcarvewastesharplakesmeagerlyricsturnoncustomalmosttinselinvainlyricscottonbridgelookupputoutcinematakeonlookinloathenearbytightslookfornaughtywhereasbesidesworshipsupportdroughtleatherbesidestakeoffputawaybicycleEverestthirstyviolentqualityleisureharmfulmiraclesteppesmoreovertakeawayreliableprevious...

Minerals and Rocks in the Geosphere 2026-01-06

29 Items: corelandironrockCrustsolidinnerouteroceanFieldcycleMantleplatesnickleBasaltOceanicmineralcrystalorganicElementssedimentcurrentsgeologistkilometerconvectionlithosphereContinentalTemperatureasthenosphere

The wedding of Micheline and Grant 2026-02-10

33 Items: NatuMamaCakeIvanCarsGroomBrideSmithRosesMusicRingsDanceEltonPartyGiftsGrantFamilyBeautyOrchidFriendsOsawaruMiracleBouquetRichardJustinaMohammedEmmanuelVictoriaMillicentHoneymoonPrincejoeGroomsmenBridesmaids

Breaking Barriers: A Celebration of Women in Business 2024-10-27

6 Items: ceiling is the invisible barriers that prevent women from advancingabout women’s roles can lead to biases in hiring, promotions, and evaluations.gap results in women earning less than men for the same roles and qualifications.includes unequal pay, biased hiring practices, and lack of promotion opportunities based der....

Tomb Raider 1 Levels + Unfinished Business 2025-11-04

19 Items: CavesCisternAtlantisThe HiveColosseumLost ValleyPalace MidasNatla's MinesTomb of TihocanCity of KhamoonReturn to EgyptTomb of QualopecSt Francis' FollyThe Great PyramidTemple of the CatCity of VilcabambaObelisk of KhamoonAtlantean StrongholdSanctuary of the Scion

Ancient Egypt 2023-11-23

16 Items: rivertombsviziernoblespharaohtemplesscribespyramidskhepreshcleopatracraftsmendynastiestutankhamunhieroglyphicsmummificationbook of the dead

Bilbo Word Search 2022-11-10

33 Items: elfringgoldazogkilifilibilboShirebeornsmaugdwarfwargsWorldthorinelrondbombarhobbiteaglesCreditgandalforcristgoblinsspidersfantasyJourneyMountainthe CallMountainsglamdringrivendellthe MentorTo AdventureFirst Threshold

Animals Word Search 2023-12-03

20 Items: owlfishbearhorsesnaketigerkoalapandaturtlerabbitgiraffepenguindolphinkangaroobutterflyWho loves fishesKing of the jungleBiggest land animalPeople's most trust worthy companionLoves to live on the Branches of the trees.

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

1G words 2022-10-21

60 Items: iaittobemyatisofdoinupmegoamonnoanweshewhyseebighadforyesandyoutheallwhoarethewasonehascangetlikedownlookwantlovethatwithcomesaidlotsthistheywantherelivewentwillhavetherecan'twherelittle

Appointment Word Search 2023-02-08

33 Items: 15AnneMikeCoopyearlandHutsTexasRatesHasslewitnessof AgentDistrictevidenceinformalon TaxesTrue Taxestimatesneighborsand Alikestructureassessmentcomparableexemptionsto ProtestarbitrationcollectionscalculationsequalizationObsolescenceimprovementsthe panel ruleyour Neighbors

Moses Word Search 2025-05-29

44 Items: GodbushFirenameMosesIsaacJacobHorebEgyptStaffSignsVoiceCanaangroundPlagueEldersBeholdSurelyAbrahamPharaohHivitesSandalsDeliverWondersWorshipcallingPromiseHittitesAmoritesCovenantProphecyHolinessJebusitesSacrificeObediencePerizzitesAfflictionOppressionRevelationRedemptionof the LordTaskmastersAM THAT I AMof milk and honey

HFW 2025-09-23

56 Items: aIamathetowemyupdoofhadseethewasandforoneshearebuytooyououreatwhohowoutputdayflygoodmadelikethisfindjustmanythensaidwilllivewhatwithyourmakelooktheyhavefirstwritewantsabouttakeseverylittle

His Word Search 2025-10-19

61 Items: hisheryouandthebighashimusesaycarcowtoyboyyourwantwhatwithlookdownfaststarparkfarmgirlbirdcoinsoilpullbookfootbushdrawwalkballtallroarforkballhairsmallnursemousebrownhouseprawnsaucewaterhorseboardwatersharechairlittlepurplesisterdoctoraugustsquareteachertractor

IEJ Word Search 2025-12-02

11 Items: resident bakerofficial momagertreasury loves thiswhose birthday is it?we campaign against thiswhere we apply for leavenewest member of the IEJbest committee at the IEJour favourite biweekly activitywhy so many late nights with DIRCO?something we eat and fill in forms for

Solar system 2026-02-04

7 Items: blue planetNearest starlargest planetoutermost planetsNearest and smallest planetbrightest planet in the skyplanet with many satellites

Good education 2023-03-11

9 Items: richimaginevery bigunkind and hurting othersa child whose parents are deada servant who looks the whole housea woman who teaches children in their homea person who works for people in their houseschool a school where students live and learn

Cell Word Search 2022-09-02

10 Items: Cells that have a nucleus.Cells that do not have a nucleus.The smallest unit or subunit of life.Membrane The flexible “skin” of all cells.A structure in all cells that makes proteins.Wall A rigid “shell” that covers certain types of cells.The liquid inside of a cell. It is made mostly of water....

2.02 Regulate & Protect Vocab_2 2025-10-01

8 Items: A fee charged on imported goods at the borderStudent/senior discounts for the same movie or serviceAfter-tax money from a paycheck that you can spend or saveGovernment-run services such as schools, police, and sanitationBusinesses like local gyms, shops, and startups (not government)A company pays to put another brand’s logo or idea on its product...

Respiratory System 2022-09-12

28 Items: chestblood clotsuffocatingtaking in of airnormal breathingvocal apparatus of larynxanother name for windpipeinflammation of the lungsinflammation of the larynxair or gas in chest cavityplastic surgery on the nosemembrane surrounding each lungtemporary absence of breathinganother name for auditory tubelabored or difficulty breathing...

Garthbrooks Word Search 2025-01-17

20 Items: Years together (5 letters)Kiah’s birth month (3 letters)Maid of Honors name (6 letters)Couples favorite food (5 letters)The month he proposed (9 letters)First concert together (11 letters)Kiah’s favorite dessert (9 letters)Couples favorite artist (9 letters)Who said I love you first? (4 letters)Kiah’s favorite wildflower (6 letters)...

Containformation: Word Search 2025-09-11

13 Items: A type of malware that attaches to a program or file andThe use of digital devices to harass, threaten, or humiliate someone.Negative or unfavorable feedback from customers about a product or service.False or inaccurate information that is spread without the intent to cause harm....

Sporting Firsts 2025-09-14

20 Items: Inventor of basketball in 1891Winners of the first FIFA World Cup in 1930First horse to win the U.S. Triple Crown in 1919English town where the game of rugby was inventedHost of the first Olympics held in the USA in 1904First city where the World Series was played in 1903Arsenal’s stadium before the Emirates opened in 2006...

Year 3 Term 2 Wk 2 Homework 2024-05-05

24 Items: DramaAn accidenta situation4 letter wordjoyful emotionsomething organisedPrecious to someone1st Month of the yearto won of give somethingorganising something nowOut in the bush on holidaysa crunchy red or green fruitEarth, Mars, Jupiter are theseTo get from one place to anotherA place where you go to get moneyNot perfect or excellent just.......

Conjuctions 2023-08-10

25 Items: veorifamaandbutveyayanioysaeğerthusfakatçünküya...dahoweverbecausewhereasthereforedolayısıylaother wordshem...hem..deboth...and...ne...ne..de...either...or...neither...nor...

Unit 3.2 2025-11-23

29 Items: a religious buildingcausing great sadnesstogether to meet sociallyfree from outside controlto organize or have an eventa fight between armies in a wara planned public or social occasiona place where dead people are buriedout to remove something from a placea period of heavy rain in parts of Asiathe time in your life when you are a child...

Alice's Adventures in Wonderland pgs. 28-33 2024-01-31

14 Items: How did the animals feel?What prize did Alice get?What sound did Alice hear?Who was the very large bird?What did Alice use to cool down?What must Alice give to everyone?Who arrived to take the animals home?What did Alice start doing in the lake?What did Alice see more of in the lake?How did Alice become as she fanned herself?...

Greece Vocabulary 2025-04-15

10 Items: a marketplace in ancient Greecethe hill above a Greek city, on which temples were builta member of the most powerful class in ancient Greek societya group elected or appointed as an advisory or legislative bodya government in which the ruling power is in the hands of one persona person who has certain rights and duties in a city-state or nation...

The way of the truth, and the life 2024-04-27

11 Items: lovelifehopetruthpeacefaithprinceprayerbelievethelightholyspirit

The way of the truth, and the life 2024-04-27

11 Items: lovelifehopetruthpeacefaithprinceprayerbelievethelightholyspirit

School Search 2025-12-27

10 Items: Place for lunch and chatssomething students beg forA fresh start that feels tiringGoing over lessons before a testHelps measure academic achievementThe lesson no one wants but has to attendA day full of colours, food, and laughterwill definitely get taken away by teachersShowcasing talent and creativity,while missing classes...

history word search 2024-10-08

15 Items: signed by henry viiicreated the mona lisaLed to the reformationcreated by John CalvinRediscovery of old ideascalvin created calvinismprotestant who was excommunicatedpainted the sistine chapel ceilingking of England that took office in 1509religious war between Roman Catholic and Germanyaccusing people of witchcraft based on stereotypes...

Seveth Year - Lesson 2 2024-12-06

15 Items: Genuine; true.A bird's feathers.Imaginary; not real.To eat up thoroughly.A choice item of food.Coming earlier in time.The killing of an animal for food.Wise in a clever or practical way.Moving in a clumsy or awkward way.Living by killing and eating other animals.Open to attack; easily injured physically or emotionally....

Cell Word Search 2026-01-03

4 Items: the basic unit of lifeanother word for digestLysosomes are _____ the cellLysosome have ______ for food and water

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Amistad Word Search 2025-10-16

30 Items: MrMrskisslateearlymeetingon timeto supportcell phonethe opposite of wronga gathering of peoplesynonym for saying sorrypeople that ____ are meana person who is at a partyto be thankful for somethingwhat you take when your wrongthe relationship between friendswhen your married you are ______the bond between husband and wife...

Freddy Word Search 2023-01-11

13 Items: chicafreddybonniebonniefreddymanglefazbearfredbearthe bunnymarrionetethe chickenendoskeletonthe pirate fox

FORMS OF GOVERMENT: WHAT SHOULD BE THE RIGHTS AND RESPOSIBILITIES OF THE RULERS AND THE RULED 2024-09-13

24 Items: WUATHENSSPARTAEPHORSDAOISMBABYLONPERICLESLYCURGUSXENOPHANKHASHOGGIWAHHABISMHAMMURABICODEOFLAWEUPHRATESTHUCYDIDESHANDYNASTYSAUDIARABIAMESOPOTAMIACONFUCIANISMCAPITAlOFFENSEDIRECTDEMOCRACYMANDATEOFHEAVENPELOPONNESIANWARMOHAMMAMADBINSALMAN

Electricity & Magnetism 2023-06-20

8 Items: metallic threadparticle with a negative chargetype of electricity that requires a wirethe transfer of electrons from one atom to anotherwhen two or more things are not in equal proportionsmagnet made from electricity and a metallic materialtype of electricity produced when you rub a balloon on your head...

B1.2 Revision Wordsearch 2024-01-28

10 Items: joins two bones togetherjoins a muscle to a boneall the bones in an organismthe bones that protect the lungsthe sheet of muscle used in breathingthe gas that our bodies need to respirethe gas removed from our bodies as a waste producta group of tissues working together to perform a function...

Polynesian panthers 2024-10-14

9 Items: who ended dawn raidswhat did the Polynesian panthers facewho influenced the Polynesian pantherswhat was the purpose of the dawn raidswhat event was the Polynesian panthers inwhat was the main goal of Polynesian pantherswho was the leader of the Polynesian pantherswhat did the Polynesian panthers do foe the community...

Gulf Amitriptyline 2023-08-23

12 Items: managed in divided ?is the tablet film coated ?Gulf Amitryptiline is used for?what is the colur of the label?hundred - what is the pack size?what is the strength of the tablet?true or false , has sedative effectscolour of the Gulf Amitriptyline 25mgwhat type of antidepressant is Gulf Amitryptilineit is safe to use Gulf Amitriptyline in pregnancy...

Doses Word Search 2023-08-23

12 Items: managed in divided ?is the tablet film coated ?Gulf Amitryptiline is used for?what is the colur of the label?hundred - what is the pack size?what is the strength of the tablet?true or false , has sedative effectscolour of the Gulf Amitriptyline 25mgwhat type of antidepressant is Gulf Amitryptilineit is safe to use Gulf Amitriptyline in pregnancy...

The Immune and Lymphatic Systems and Related Care 2025-05-01

15 Items: lymphlupustumormyelomaimmunityspecificlymphomaoncologistlymphedemainfectionsnonspecificlymphologistimmunologistanaphylacticmononucleosis

Defense Mechanisms in Addiction #1 2023-09-12

10 Items: Making others the responsible party for our drinking and drugging.Distorting the truth, or omitting key details to change a narrative.Keeping someone on the offense by using fear tactics, forcing complicity or else.Making light out of a dark situation by turning it into a joke whenever possible....

Genesis Matters 2025-12-07

11 Items: Jesus, Paul, and Peter said this book matters.This argument is based on Law from Higher Power.This lesson on Genesis goes back to this argument.Fine-_____________ is part of the design argument.Genesis gives evidence (A&E's sin) that we need the g_______.Besides Gen 1:1, this argument is supported by Stephen Hawking....

Payments and Debt 2023-08-14

11 Items: What does the D stand for in DCA?What does the C stand for in DCA?What does the A stand for in DCA?What is the longest we can spread a repayment plan?What button in Kraken do we press to process a refund?A repayment plant must include debt and what other element?What payment method do we prefer and always promote to our customers?...

Countrys 2025-06-04

10 Items: The gayest countryThe biggest countryThe happiest countryHome to Nikola TeslaThe smallest countryHome to mother TheresaThe country with most time zonesWhat country does Greenland belong toThe country outside of Europe using eurosThe country in Europe with pyramids bigger than the once in Egypt

Production Practice 2023-03-24

10 Items: All __ calls are on a recorded line.The 2 forms of verification that requires only name + 1.Form needed to add a beneficiary to your E*TRADE account.Verifiers that shows up RED and must always be asked for.What you are required to leave on every account you touch in Genie.Tab in genie that shows you which accounts are tied by which username....

Spanish 2023-11-09

18 Items: oryesandwellto runto skito singto drawto swimto workto danceto skatealso tooneither norto skateboardto read magazinesto listen to musicto play the guitar

Baby Shower 2025-11-02

12 Items: The safety throne for road-trip royalty.A cozy wrap that turns baby into a burrito.What you pray doesn’t leak during a car ride.The fashionable splash guard for messy meals.The magical plug that stops the crying (for a while).The watchful gadget starring in “Baby TV: Live Feed.”The warm meter that proves mom was right—baby is hot....

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

Provider Data Management 2024-12-18

15 Items: Line of BusinessNational Provider IdentifierGroups that do not need an NPIDepartment that signs up new groupsSystem used for Roster management toolMissing and/or incorrect required fieldsThird party vendor for dental/vision benefits10 digit code that includes numbers and lettersThird party vendor used to house data/pay claims...

DND Character Creation 2025-11-21

30 Items: Your roleDivine KnightSniper hunterHumanoid DragonPact SpellcasterDivine SpellcasterNature SpellcasterWhere you come fromStudied SpellcasterMechanic SpellcasterInherent spellcasterEnraged damage dealerPerformance SpellcasterLarge humanoid with tusksBlood magic monster hunterDamage dealer and defenderPrecise damage and stealth...

SIP AND SOLVE 2026-01-17

12 Items: Arun's football clubWhere does Arun work?Shankari's football teamShankari's favourite soupWhere Arun currently residesWhere Shankari currently staysShankari's favourite superheroOne of Arun's favourite animalsOne of the groom's theme coloursOne of the bride's theme coloursWhat Arun is wearing for today's solemnisation...

Horror Movie Icons 2023-06-16

20 Items: B-Eating-USeven days.Number one fan.Heeeeere's Johnny!1,2 he's coming for youMother's favorite camper.How are you with puzzles?Wants to drink your blood.Literally the spawn of Satan.Have such things to show you.Makes children float in gutters.You're gonna need a bigger boat.A skilled taxidermist and cannibal.An identity shared by many killers....

Sportscape Word Search 2025-11-20

9 Items: concerned with appearancethe number of times an ad is seenreplaces the ticket with a bar codeoffer fans tickets to all of a team’s games in one priceall of the elements that make a sports game more than just a gamethe attempt to try to get fans to buy tickets before the season starts...

Wedding Wordserch 2025-11-07

10 Items: The Brides NameThe Grooms NameThe Couples DogWedding DestinationWhere the Couple MetCouples Work IndustryThe Newlyweds SurnameRyans Drink of ChoiceHelenas Drink of ChoiceWhere the Couple Calls HOME

Slavery and the US Civil war 2014-04-21

30 Items: GinSpyUnionRifleDeathSlaveRebelKansasBattleTubmancottonSlaveryLincolnRunawayGeneralNebraskaCivilWarIroncladRailroadDouglassfugitiveAmendmentVicksburgConductorJeffersonCompromiseGettysburgConfederateUndergroundEmancipation

Alexander The Great and Ancient Greece 2016-02-25

57 Items: OMENZEUSARESEGYPTINDIAPLATOHOMERDEITYATHENSGREECEPERSIATHEBESDARIUSORACLEHERMESATHENEAPOLLOHELOTSSLAVESSPARTAGREEKSATHENSSTATUEBABYLONGENERALPHILLIPPTOLEMYCULTUREHOPLITEDEMETERCENTAURGODDESSTEMPLESCYCLOPSAMBITIONCAMPAIGNASSASSINCAMPAIGNSOCRATESPOSEIDONOLYMPICSCITIZENSMINOTAURALEXANDERARISTOTLECONQUERORMACEDONIAAPHRODITEARISTOTLEDEMOCRACYACROPOLIS...

Alexander The Great and Ancient Greece 2016-02-25

57 Items: OMENZEUSARESEGYPTINDIAPLATOHOMERDEITYATHENSGREECEPERSIATHEBESDARIUSORACLEHERMESATHENEAPOLLOHELOTSSLAVESSPARTAGREEKSATHENSSTATUEBABYLONGENERALPHILLIPPTOLEMYCULTUREHOPLITEDEMETERCENTAURGODDESSTEMPLESCYCLOPSAMBITIONCAMPAIGNASSASSINCAMPAIGNSOCRATESPOSEIDONOLYMPICSCITIZENSMINOTAURALEXANDERARISTOTLECONQUERORMACEDONIAAPHRODITEARISTOTLEDEMOCRACYACROPOLIS...

Alexander The Great and Ancient Greece 2016-02-25

57 Items: OMENZEUSARESEGYPTINDIAPLATOHOMERDEITYATHENSGREECEPERSIATHEBESDARIUSORACLEHERMESATHENEAPOLLOHELOTSSLAVESSPARTAGREEKSATHENSSTATUEBABYLONGENERALPHILLIPPTOLEMYCULTUREHOPLITEDEMETERCENTAURGODDESSTEMPLESCYCLOPSAMBITIONCAMPAIGNASSASSINCAMPAIGNSOCRATESPOSEIDONOLYMPICSCITIZENSMINOTAURALEXANDERARISTOTLECONQUERORMACEDONIAAPHRODITEARISTOTLEDEMOCRACYACROPOLIS...

Countries and Capitals of the EU 2020-12-02

30 Items: romespainitalypizzabigosgreekparisfrancepolandgreecepaellafrenchgermanpolishmadridberlinwarsawathensgermanybaklavaspanishitaliancapitalbratwurstcroissantacropoliscollesseumroyalpalaceeiffeltowereuropeanunion

Beauty and the Beast - Character Search 2024-05-08

34 Items: redpapafanglunabluetinkcrewbeastgreenhenribrunopropsbeautyprincebeggarhowleryellowmarcelgrowlercostumeartistsbellezzawildbillmrwindupbebebakerfrederickmrsparklebookkeepermrsteatimefionafarmergerardgrocermilliemillinerflorencefloristloganlumberjack

Elijah and the Prophets of Baal 2024-06-23

25 Items: godbaalfirewoodrainkingahabmountaltarwaterfaithpowerelijahcarmelprayeranswerheavencloudscontestdroughtjezebelvictoryprophetsmiraclessacrifice

The Maze Runner Characters and Themes 2025-02-01

34 Items: MazeLoveNewtHoleAlbyStungDeathChuckMinhoFlareGallyVinesGladeFrypanGenderThomasWickedTeresaMemoryRunnerSadnessGrieverBraveryEnemiesLoyaltyImmunityCreatorsIdentitySicknessBetrayalFriendshipLonelinessExperimentLeadership

32_Purification and Dedication of the Tabernacle 2025-03-30

20 Items: LAWSINHOLYWAVEALTARBLESSBURNTDRINKFLOCKGUILTSILVERFORGIVENAZARITEOFFERINGOINTMENTABUNDANCEATONEMENTTESTIMONYCONSECRATEDEDICATION

Order and Chaos on the Waves 2025-04-30

25 Items: RyujiWidowGloryNoboruFusakoFatherMotherMundaneYokohamaBetrayalVoyeurismAmbiguousTelescopeSacrificePrecociousNihilisticAlienationCulminationObjectivityYukioMishimaForeshadowingJuxtapositionSentimentalitySailorFellGraceDisillusionment

Education and Culture Around The World 2025-07-22

40 Items: UrbanRuralExamsStressRespectJanitorUniformMannersHarmonyCustomsRoutineHomeworkScheduleConflictReservedResourcesAcademiesTraditionTraditionLifestyleNewcomersCommunityOccasionsObedienceAncestorsDisciplineMotivationSanitationRelaxationCreativityExhaustionGenerationChallengesTraditionsCooperationIndependentCompetitiveCompetitionIndependence...

The Ash and J Word Search 2025-10-31

24 Items: SiuMehYapGaleMeanySlothCutieOscarSnipeBananaGeraldCookieChickenMotthewSideeyeDarknessDiagonalWhateverFakewordPardonmePatootieSnacksonRururemonIndubitably

The Magic of Night and Day 2025-11-03

29 Items: sundayskyraysdarkmoongrowfuelcoallightearthnightstarsnightpowerbrightwarmthenergysunsetsourceenergysystemmorningsunriseshiningbatterymovementrenewableelectricity

CV aging cl 3 2024-11-16

18 Items: bad rhythmpredictabilityheartbeats per minutename for a muscle cellheart rate less than 50impulse causes contractionmajor complication of afibheart rate greater than 100pacermaker node of the heartresting state after contractionion responsible for contractionchest sensation of skipped beatsanother name for atrial contraction...

Polynesian Panthers 2024-10-14

10 Items: Who was the leaderWhat group influenced the polynesian panthersWhat country inspired the Polynesian PanthersWhat social issue did the Polynesian Panthers fight againstsocial movement in the U.S. inspired the Polynesian PanthersWhat police operation targeted Pacific Islanders in the 1970sWhat city was the Polynesian Panthers' headquarters located in...

Physical Science 2025-09-23

20 Items: How fast something movesThe smallest unit of matterA push or a pull on an objectA change in position over timeTwo or more atoms joined togetherA form of energy that helps us seeThe ability to do work or cause changeAn object that can attract iron or steelA path that electricity can flow throughAnything that takes up space and has mass...

Disciplinary Hearing Participants 2024-04-24

4 Items: A Labour Relations Act requirement is that employees are allowed to have an employee _ to assist them in putting forward their case.The individual against whom allegations have been made who can choose to state their case or not be present at the disciplinary hearing....

Language & Thought 2025-12-23

24 Items: it's impliedspiky & sharpround & lumpyan overused phrase"the," "our," "that," e.g.implied background knowledge"be clear": the maxim of ____sarcasm, joking: ____ a maxim"be truthful": the maxim of ___"stay on topic": the maxim of ____a set of related words: _____ fieldlying is an example of a maxim ____when one thing is compared to another...

Vocab 12 2024-03-04

12 Items: I was ______ in the moment.I wished for my enemy to _______.My room was _______ after I cleaned it.In class i am a ______ person because I don't talk.I _____ on my last statement to strengthen my argument.The party was _____ because nobody had come to the party.Every since i was a kid, I had a ______ for playing soccer....

Flu Vaccine Word Search 2025-10-03

12 Items: A symptom of the fluThe goal of vaccinesExtra dose of the original vaccineA month people tend to get vaccinatedThe method of administering a vaccineA shot that contains a killed flu virusA type of germs that vaccines can preventThe bodies ability to fight off infectionsProteins produced by the immune system to fight infection...