and the blade Word Searches

POSTIES 0923 COVER 2024-08-29

6 Items: In a car, magnets power the ____ that helps it move.a piece of metal that attracts objects made of special metals towards itIf the north ends of both magnets are placed together, they ____ each other.If the north and south poles of the magnets are touching, they ____ each other....

Sampling and Bias in Stats 2025-11-04

14 Items: The group all samples are chosen fromA group of data taken from the populationA random sample like drawing marbles from a bag______ source is when you gather the data yourselfStanding in a shopping mall and surveying passers byParticipating in a survey only if you choose to: ____ response...

Fun Halloween KIDS Movies! 2025-10-20

18 Items: ___(1995)___(2009)House (2006)___town (1998)Goose___ (2015)___ Pocus (1993)___ Bride (2005)Hotel ___ (2012)___weenie (2012)___Norman (2012)___juice (1988)___busters (1984)___ Mansion (2003)The Little ___ (2000)___ Family Values (1993)___ Before Christmas (1993)___ the Square Pumpkin (2004)Double, Double, Toil and ___ (1993)

Anatomy & Physiology: G 2026-02-12

30 Items: GumPregnancySense of tasteStorage carbohydrate in animalsPresence of glucose in the urineAnerobic breakdown of glucose to ATPEntire complement of an organism's DNAHormones that regulate the function of the gonadsTuft of capillaries surrounded by Bowman's capsuleProtein that has one or more carbohydrates attached...

"A Doll's House" Extra Credit 2025-11-19

13 Items: How Torvald views NoraHow Nora acts in Act 1The setting of the playHow Torvald acts towards NoraThe main character of the playThis character blackmails another characterThe person who raised Nora and her childrenTorvald gets this, which reveals Nora's secretNora is afraid of having a negative influence on her......

The Princess and the Wizard 2025-11-04

13 Items: BATCOWTEARFISHELIZAFAIRYSTONESNAKEWIZARDCASTLESPIDERCHICKENPRINCESS

Far East of Europe 2025-06-14

12 Items: A Manchu pigtailJapanese dwarf treesA people group from Manchuria, ChinaCatholic missionaries that came to JapanThe first shogun of the Tokugawa dynastyThe son of Ieyasu who became the Tokugawa shogunHidetada's son who became shogun and closed JapanMost Japanese people believed in this kind of religion...

CrossWaves Word Search 2025-01-17

10 Items: CrossWave models are our line of ___-dry vacuums._________ mode will normally dispense less water than area rug mode.Specific models are able to be monitored or controlled through the BISSELL ______ app.For CrossWave models, the brush roll is normally expected to be replaced after ___ hours of use....

Wordly Wise UNIT 15 2025-10-12

9 Items: My mom's _______________ about my cold is great.I will ________________ during the class at CREO.There is a _______________ between night and day.Be careful! The chicken eggs are _________________.The weather was a _____________ to our picnic plans.Remember the ___________ on speaking Korean in class....

Find the Emotions Hiding in Plain Sight 2025-11-26

9 Items: The fiery emoji come to lifeYour brain’s built-in alarm systemThe king of yawns and snooze marathonsThe “Eww, no thanks!” feeling in actionThe spark that makes you grin like crazyThe “Oops, did I really say that?” blushBuzzing like a million butterflies at onceThe “why is it raining on my parade?” feeling...

The Lion the Witch and the Wardrobe 2025-12-04

15 Items: ColossalEnormousGiganticDeceptiveEmotionalDelightfulMysteriousSuspiciousTremendousAdventurousCredibilityFantasticalResponsibleProfessionalEntertainingly

SDS Fall Wordsearch 2025-09-18

7 Items: Our new athletics director.The name of the school play.The theme of the homecoming dance.Where the trip taking place during fall break is.The entire school signs pledging not to cheat and stay honorable.The book of the Bible being read in bible study with Dr. Michael.A standardized multiple choice college exam registered by CollegeBoard.

Love Word Search 2026-01-30

25 Items: Side by side; not apartThe French word for loveTo love and admire deeplySymbol of love and emotionA romantic outing togetherA popular Valentine’s treatSoft, gentle, loving in toneA sweet way to show affectionA love that lasts without endClassic flowers given for loveWarm embraces to show you careStrong, intense feelings of love...

Mrs Marinho's Super Awesome VOCAB WORD SEARCH 2025-12-03

8 Items: action wordto make changescorrect and precisea glimpse of the pastperson, place, or thinga word with the same meaninga word with the opposite meaninga statement supported by evidence

FFA CREED PARAGRAPH ONE 2025-12-05

9 Items: Ioffaithin thewith ain thewe now enjoy have comeof better days through better ways, even as the betternot of words but of deeds- achievements won by the present and past generations of

Fish Word Search 2025-11-18

10 Items: – A sea animal shaped like a star.– A sea animal with eight long arms.– A small animal with a hard shell and two claws.– A huge sea animal that comes up to breathe air.– A soft, see-through animal that floats in the sea.– A small orange-and-white fish that lives in coral.– A large sea animal with sharp teeth that swims fast....

Credential Word Search 2025-05-25

5 Items: clear and exactgive the latest informationmoney sponsored for a particular purposethe document that proves you are who yoy claim to bethe use of skills and imagination to create something new

Have fun 2024-04-26

12 Items: Egregioussweet or musical pleasant to hear.hazy, vague, indistinct, or confuseda group of people that make decisionspleasant odor that is associated with rainexisting or being everywhere at the same timefull of, marked by, or causing complete happinessgood luck in making unexpected and fortunate discoveries...

Jessica & Parker 2024-08-03

28 Items: Parker's nieceParker's sisterParker's nephewParker's hometownJessica's hometownParker's birth monthJessica's oldest sonJessica's professionParker's middle nameJessica's middle nameJessica's birth monthJessica's maiden nameJessica's older sisterParker's favorite sportParker's favorite colorJessica's oldest twin sonThe month Parker proposed...

Parts of the Computer 2024-11-05

9 Items: This is the brain of the computerThis is a camera for the computerThe part of the computer that has the screenAn input device that allows you to select things on the screen.It is an input device that allows you to write letters and numbersAllows a group of people to hear the sound coming from the computer...

Nonfiction/Memoir Vocabulary. 2025-10-10

20 Items: Roll call of prisonersTo give false representationA person who carries out harmful actsThe fear and hatred of anything strangeA Jewish prayer recited in the daily ritualA person not recognized as a citizen anywhereAn official whose job is to inspect new thingsA prisoner who is elevated to a better position...

Active & Passive Transport 2025-09-25

13 Items: What does ATP do?How does the cell make ADP?What are phospholipids made of?What is a phospholipids function?What are the two types of transport protein?What way does the concentration gradient go?How much sodium is put into a sodium-potassium pump?How much potassium is put into a sodium-potassium pump?...

Internal Parts of a Computer 2025-01-16

7 Items: The system's short-term memory.The system's long-term storage.The computer's main circuit board.It is sometimes called the brain of the computer.It is responsible for what you see on the monitor.A device that cools the central processing unit (CPU) of a computer.It sends power through cables to the motherboard and other components.

Team 3 2025-11-03

10 Items: This is a scientist. He is famous for his IQ.This is a Spanish artist. He is famous for his paintings.This is an artist and he is famous for having cut off the ear.This is a musician. He is famous for singing “juntos a la par”This is a musician. He is famous for being in the band "los piojos"....

APES- Unit 10 2024-05-01

8 Items: The warm phaseIntergovermental panel on climate changeIce caps and glacier melting, reducing ________ sources.Insolation passes through the atmosphere and heats up the surface of EarthLandmark agreement made by UN countries to reduce greenhouse gases mostly CO2.we tackle climate change in small chunks making it easy for everyone to participate...

Kings of Judah 2025-11-11

17 Items: (642-640 BC) Assassinated by his own servants (Amon)(841 BC) Reign ended after he was terribly wounded (Ahaziah)(609-598 BC) Another "bad" king, whose name was changed (Jehioakim)(870-848 BC)good king, established religious practices (Jehoshaphat)(841-835 BC) Queen, Only female monarch who ruled over Judah (Athaliah)...

Kings of Judah 2025-11-14

17 Items: (642-640 BC) Assassinated by his own servants (Amon)(841 BC) Reign ended after he was terribly wounded (Ahaziah)(609-598 BC) Another "bad" king, whose name was changed (Jehioakim)(870-848 BC)good king, established religious practices (Jehoshaphat)(841-835 BC) Queen, Only female monarch who ruled over Judah (Athaliah)...

Understanding Insurance 2025-05-27

15 Items: What do we call our clients?What is another name for a homeowner?What acronym do we look for on checks?What is another name for the Insurance Company?FEMA administers this program for Flood insurance.What's another term for borrower-obtained coverage?What coverage does the mortgage company care about?...

Word Search grade 6 2024-12-06

20 Items: A doctor for teethThe time after sunsetA light you can carryLand surrounded by waterThe first day of the weekA very tall piece of landA place to play with sandThe first meal of the dayA vehicle with two wheelsA tool to find directionsA loud noise during a stormColors in the sky after rainA special day for celebrationA book to write your thoughts...

Shemot 2025-01-12

24 Items: “Tov”“Puah”בַּיִתמֹשֶׁה“Shemot”Mitzrayim“Shifirah”Moses wife“to go out”ark, HebrewAdonai's son.Moses firstbornThe priestly tribe.Jochabed’s husband.Moses elder brother.The mother of Yeshuaan intentional untruth.The minister of Midian.The prophet of the Haftarah.The Redeemer of Abraham….HaftarahYeshua was born in this town in Israel....

Solar system 2026-02-04

7 Items: blue planetNearest starlargest planetNearest and smallest planetbrightest planet in the skyplanet with many satellitesand Neptune outermost planets

Lesson 13 2023-11-15

6 Items: I will study for at least one hour every day before dinner is an example ofA type of rule governed behavior that is under control of socially-mediated consequenceWhen cooking, you might follow a recipe that tells you to preheat the oven to a certain temperature is an example of...

Conventions of Crime Fiction 2024-09-10

12 Items: The killing of a characterThe character who solves the crimeThe facts used to accuse the murdererThe setting in which the crime was committedThe reason why the murderer commits the crimeThe character who actually committed the crimeThe character who has had the crime done to themThe characters who might have committed the crime...

Creatures of the Waste 2025-12-19

13 Items: Fast UndeadSlow Mindless UndeadDraws in more undeadLaunches acid from afarUndead big and hits hardTheir eerie song can killAngry ghost damaged beaconWorks for the Blood SuckersMore powerful with a full moonGhost that keeps reforming quicklyChills the strength from your limbsCryptic Nightmare that wears a suitDrinks blood and extremely dangerous

christian-8th grade 2024-05-15

15 Items: temperature at which a solid meltshappens between metal and notmetaltemperature at which a gas condensestemperature at which a liquid freezes2 elements are sharing valence electronschange from a solid state to a liquid statechange from a gaseous state to liquid statechanging from a liquid state to a solid state...

Emor 5.0 2025-05-11

21 Items: KorbanPesach“HaShem”“set apart”“Commandments”‘priests’, Hebrew.The day of complete rest.The 10th day of the seventh month.Punishment for blasphemy of The Name.Animal korbanot are to be without ______.What kind of oil was used in the menorah?The Haftarah Emor comes from the book of ______.A kohen is to marry a ______ from among his people....

One Ordinary Day with Peanuts 2025-04-09

15 Items: a sweet treatwho is the Authora driver of the taxithe name of the horsethe mom of the one kidWho is the main characterthe main character's wifethe place they are moving tothe time period it takes placethe person who is late for workplace they have recently visitedthe kids old person who is a dudethe kid the main character gives food...

Turkey Word Search 2025-10-03

10 Items: To say “thank you.”A big round orange vegetable.A big meal with lots of food.The main meal in the evening.Green part of a plant or tree.– A big bird we eat on Thanksgiving. 🦃Parents, children, and people we love.– Yellow vegetable that grows on a cob.– A sweet dessert baked in a round dish. 🥧The season when leaves turn orange and fall.

The Lion and the Mouse 2023-02-15

13 Items: denpawstiedpileropecruelsillyproudpromisebranchesstraightcheerfulAesop's fables

Time management frameworks 2025-07-04

15 Items: – Grouping similar tasks to reduce switching costs– Fundamental step in organizing tasks ahead of time– Law that “work expands to fill the time available”– Time-boxing technique using 25-minute focus intervals– The act of assigning tasks to others to manage workload– Strategy involving proactive scheduling and forecasting...

africa 2023-09-20

48 Items: FasomalitogochadghanaLeonekenyaVerdebeninnigergabonSudanlibyaegyptAfricaangolaGambiaguineaGuineaugandamalawirwandazambiatunisialgerianigerialiberianamibiasenegalburundilesothocomorosmoroccotanzaniaethiopiad'Ivoireeswatinibotswanacameroonzimbabwedjiboutimauritiusmauritaniaseychellesguinea-bissauAfrican RepublicTomé and PríncipeRepublic of the Congo

GOOFY GOOBERS 2025-05-25

27 Items: DANRAIDPATTYPATTYMANRAYCHEEKSWAITERHUT JRGOOBERSSQUIDDYEVIIIILPATRICKFANCYSONDUTCHMANCHOCHLATEANCHOVIESHOY MINOYJELLYFISHBOATMOBILEDIRTY BUBBLEWAS NUMBER 1WEENIE HUT JRBLUE NUMBER 2LIVING HERE WE COMECOME FOR YOUR PICKLEHASH SLINGING SLASHERKRAB PIZZA IS THE PIZZA FOR YOU AND ME

0 TO 9V DC POWER SUPPLY CIRCUIT 2024-10-18

10 Items: How many LEDs are used in this circuit?50mA is the same as 50 __________________ .In this circuit, resistor R3 is a ____________ .The transistor in this circuit is an NPN or a PNP?How many NPN transistors does this power supply circuit use?What kind of voltage does this power supply output, AC or DC?...

Rachel & Matthew 2024-07-18

20 Items: THEIR OCCUPATIONTHE APP THEY MET ONBRIDE'S MIDDLE NAMETHEIR FAVOURITE FOODNAME OF THE BEST MANTHE NAME OF THEIR DOGCOLOUR OF GROOM'S EYESTHE MONTH MATT PROPOSEDTHE NAME OF THEIR STREETA SPORT THEY PLAY TOGETHERMASCOT OF THEIR UNIVERSITYTHE LOCATION OF THEIR HONEYMOONTHE LOCATION OF THEIR FIRST DATETHE MONTH THEY BOUGHT THEIR HOME...

spanish 2025-10-27

26 Items: lowwoolsilkhighstylelooselightcottonbrightbargainleatherentrancethe signthe salethe exitto choosethe brandshoe sizeto try onthe marketthe cashierpastel colorto spend moneysynthetic fabricto be in fashionthe clothing size

Maura & Ryan 2025-05-04

26 Items: groom's first jobbride's first jobbride's professionGroom's middle namecolor of bride's carwhere dis Ryan proposethe bride's middle namethe bride's best friendthe color of groom's carGroom's favorite pastimeBride's favorite pastimeBride's favorite beveragenames of the couples' catsName of Groom's only sisterwhat month was Maura born in...

Cyberbullying 2024-09-12

25 Items: Software that damages a device or steals informationInformation that isn’t true, often created to trick peopleInformation- A way to get help from a website if someone goes wrongA person who uses a fake online persona to gain the trust of someone else.Software designed to gain unauthorized access to and disrupt or damage a computer system...

Football World Cup Moments 2025-09-14

20 Items: Winners of the 1966 FIFA World CupEngland midfielder in the 1966 finalWinners of the 1982 World Cup in SpainCaptained Argentina to victory in 2022Winners of the 1978 World Cup as hostsScored the “Goal of the Century” in 1986Hosts of the first FIFA World Cup in 1930Frenchman who scored twice in the 1998 final...

World Cup Moments 2025-09-14

20 Items: Winners of the 1966 FIFA World CupEngland midfielder in the 1966 finalWinners of the 1982 World Cup in SpainCaptained Argentina to victory in 2022Winners of the 1978 World Cup as hostsScored the “Goal of the Century” in 1986Hosts of the first FIFA World Cup in 1930Frenchman who scored twice in the 1998 final...

Elements of Modernist Poetry Vocabulary 2026-02-05

8 Items: (v.) To disagree.(v.) To point out or show.(v.) To take a legal problem to court.(n.) The study of language and how it works.(adj.) Able to speak or write clearly and well.(n.) A list of sources used for a research paper.(n.) All the words used in a language or by a group of people....

Definition Report Words 2026-02-06

12 Items: a person or thing equal or similar to anotherThe emotions or conduct of friends; the state of being friendssomething that manifests, embodies, or symbolizes something elsea succulent plant with a thick, fleshy stem that typically bears spinesAn unintended hole, crack, or the like, through which liquid, gas, or light enters or escapes...

Bellamy Word Search 2024-10-13

14 Items: Bellamy's half-sisterThe first Grounder we seeThe first danger in The 100Jaha's shady second in commandThe city where the show was filmedThe Grounders leader from season oneWhat are the 12 linked stations calledThe episode with the highest body countFirst main character to die on the groundWho snuck onboard the Droneship in season 1...

TOBACCO USE 2023-03-13

16 Items: Another name for bad breath.Keep something from happeningVaping often starts during these settings.The aerosol from e-cigarettes may contain this.A dangerous chemical found in tobacco products.An addictive chemical found in tobacco products.The average age people start using tobacco products.The top sellling e-cigarette brand is called ________....

P&P 2024-09-12

5 Items: Wix won the dispute case.The status when the resolution is still pending.Happen when a cardholder disputes a merchant charge.The resolution of the dispute was given in favour of the user and the bank is responsible for transferring the amount....

The Lion, The Witch, and The Wardrobe Wordsearch 2019-06-28

18 Items: lucysnowfaunSusanpeterWitchedmundTumnussledgeturkishdelightlullingpassagewardrobelamppostsardinesprofessormelancholy

The Lion, The Witch, and The Wardrobe Wordsearch 2019-06-28

18 Items: LucysnowfaunSusanPeterWitchEdmundTumnussledgeTurkishdelightlullingpassagewardrobelamppostsardinesprofessormelancholy

MERDEKA DAY WORD SEARCH CHALLENGE 2025 2025-08-31

15 Items: main city of a countryMalay words for stripesMalay word for gloriousNational Anthem of Malaysiaour country in Southeast Asiaa person who guides a countryMalay word meaning independencea country and its people togetherMalaysians standing together as oneBravery shown by leaders and peopleDifferent cultures living peacefully...

great depression 2024-10-09

14 Items: a large dust stormbudget in office high upthe largest economic disasterthe heavy rainfall we had thealso known as wall street crashgetting a loan and using that moneyprograms for young people to get jabsit crashed early in the great depressionsmall homes put together for the homelessa series of programs that FDR came up with...

Gabriel 2025-04-23

10 Items: council in ItalyWar that ended in 1648Rejected predestinationPromoted ideas to reformTranslated bible into GreekSpecific group of puritainslargest order in the churchTranslated bible into EnglishLed the reformationd in switzerlandcriticized the wealth and power ofchurch

Boy Word Search 2023-02-13

13 Items: The _____ was lost in the forest.Everyone makes _________ sometime.I want to be ______ when I'm grow up.The mole mistaken the tree as a _______.The fox was caught by the human ________.What is the ________ thing you've ever said?The ______ at the top of tree was so beautiful.Asking for ________ , is refusing to giving up....

6th Grade Colton's Word Search (Good Luck) 2024-05-15

15 Items: The hottest planet7th planet from the sunLava that forms underwaterThe planet that we live onThe closest planet to the sunThe planet with jewelry (rings)The furthest planet from the sunAll the continents brought togetherThe largest planet in the solar SystemThe theory that says that continents move.The water brought into the earth from plants...

123 2025-06-01

7 Items: Elephant is ________ the lesson it was sunny____ the lesson it started rainingThere are no animals in the ____ partI can ____ the infinity cube in my tableActors and singers ____ to different countriesThere are animals in the ____ part of my T-shirt

Chapter 9 2025-11-18

10 Items: request for paymentproduct offered by an insuranceperson financially responsible for paying a medical billfederal health insurance program for people 65 and olderpayments for office visits, diagnostic procedures, and other expensescompanies that specialize in submitting claims to insurance companies...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Animals 2023-11-16

13 Items: LadderCuddlesStripesThe fastestThe long hornApex PredatorThe water kingThe alone hunterMan's best friendKing of the JungleThe Amazon nightmareLargest in the JungleThe strongest in the Jungle

RIDERS EQUIPMENT AND TERMS TO KNOW 2024-01-18

11 Items: Essential safety gear to protect the head.The practice of horse riding and horsemanship.Tight fitting trousers worn primarily for horse riding.A common unit of measurement for horses. One hand equals four inches.A person who trims and shoes a horse’s hooves. Also known as a Blacksmith....

ITV 2024-02-27

24 Items: CBBIrelandAKA "STV"New "York"The Weekend ITVFancy "Compass"Refection Ident"From The North"TTTV, Channel 8!The sun is alive!Biggest W ever(!)Became STV in 2006Formed as ATV Midlands.The 1st ITV Franchise ever!Lasted only 10 years! (Lame.)Originally a cinema business(!)Took over basically everything!Ident features Miami palm trees....

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

9325 The 10 Bridesmaids 2024-03-06

10 Items: A young woman.The man getting married.Being ready ahead of time.Lacking good sense or judgment.Having or showing good judgment.To stay awake and pay attention.A way to describe the place where God rules.Devices that give light, oil lamps to see in the dark.A liquid used for fuel used for the lamps to burn and give light....

Turkey Word Search 2025-11-05

10 Items: – Feeling thankful for what you have.– A big meal with lots of delicious food.– A round orange vegetable often used in pies.– People you love and celebrate the holiday with.– Something good in your life to be thankful for.– To enjoy and do something special for a holiday.– The main meal shared with family on Thanksgiving....

Ch.3 Science Vocabulary 2025-11-20

10 Items: A sperm or egg cellThe DNA copying processFinal stage of the cell cycleSet of three nucleotides in tRNASet of three nucleotides in a strand of mRNAProcess of converting DNA code into a proteinProcess cells use to make RNA copies of a geneSection of DNA molecule that codes for a unique portionSunbit of DNA consisting of sugar, phosphate, and a base...

Cardiovascular Systems 2025-11-24

9 Items: incision into a veinoriginating in the heartcondition of fast/rapid heart (rate)inflammation of the muscle of the heartabnormal reduction of (all) blood cellsabnormal reduction of white (blood) cellsabnormal reduction of (blood) clotting cellsPhysician who specializes and treats blood disorders...

Math Word Search Labs 2025-10-09

23 Items: / A number that doesn’t change./ A problem that takes two steps to solve./ A problem you can solve in just one step.numbers / Counting numbers like 1, 2, 3, 4...decimal / A decimal that ends, like 0.5 or 2.75./ Flip the fraction! The reciprocal of 2/3 is 3/2./ A problem that takes more than two steps to solve....

Kombucha Word Search 2025-12-09

8 Items: What is the core fermented beverage product that WonderBrew sells?Which type of market segmentation segments buyers based on the "who," such as age and gender?Which segmentation type divides buyers based on the "why," such as their lifestyle and values?...

Unit 107 2025-10-05

30 Items: and they are...-Offer money as payment-Something given as a gift-An outdated type of payment-This could be wrong on the bill-A modern way of making a booking-An analysis from the billing system-How to make a booking whilst visiting-This person deals with group bookings-This could fail when taking a payment-A birthday may be a special one of these-...

Human Activities That Affect the Earth 2025-12-04

10 Items: What do we call the cutting down of trees?Building cities and roads is known as what?What process removes minerals from the Earth?What activity involves catching too many fish?What gas is released when fossil fuels are burned?What do farms use that can pollute soil and water?What material is commonly thrown away and harms oceans?...

Hiragana Word Search 2025-07-24

10 Items: the japanese writing system for japanese wordsthe Japanese art of flower arranging that emphasizes form and balancea gambling device resembling a pinball machine but with automatic payoffJapanese comic books and graphic novels considered collectively as a genreone of a line of military governors ruling Japan until the revolution of 1867–68...

Acceleration Word Search 2025-04-17

10 Items: Any push or pull.How fast an object moves.speeds up, slows down or changes directionvelocity speed needed at the top of a loopA force that draws any two objects toward one anotherA force caused by a rubbing motion between two objects.energy The energy stored by an object ready to be used....

Lesson 3:3 - Communication 2024-10-16

23 Items: Deafness & blindnessLoss of the ability to speakExample of nonverbal feedbackA message must be __________.Listening requires __________.Spoken words & written words or symbolsThe person receiving a message from a senderThis is an example of nonverbal communicationIssues that make communication more difficult...

GRIDLOCK 3 2025-08-11

15 Items: Remove duplicatesHarmless treatmentMemory reserved area in SASProcedure for analysing survival dataGraph type typically used for time-to-event dataOption in PROC FORMAT to create multilabel formatsSDTM variable which indicates study treatment groupMacro variable that stores the current system date in SAS...

Asked & Answered 2023-12-31

10 Items: What kind of spirits are banshees?A type of divination that involves eggs.Provide the incantation for the Gouging Spell.What colour is the Potion for Dreamless Sleep?The flutterby bush produces flowers once a _____.What is the incantation for the Gouging Spell again?What is the process of turning base metals into gold called?...

Chettinadu Puzzle 2026-01-03

16 Items: Simple onion gravy side dishFinely woven palm-leaf basketStainless steel coconut slicerOrnate and proud doorway designTiny silver rattle for childrenCrispy and soft white snack itemAuthentic crunchy rice flour snackHand-box used to keep money safelyCentral open courtyard of the homeUnique address for a sister-in-law...

6B Sopa de Letras 2023-05-01

41 Items: farcleandirtychoresto livekitchento helpto cookto giveto washto dustbathroomthe roombasementapartmentto vacuumthe moneythe garageto receiveclose, nearliving roomthird floorif, whetherground floorsecond floorWhich? (ones)enough; rathera (one) momentthe dining roomthe home officeto cut the lawnto feed the dogto make the bedto put; to place...

Word search science 2026-01-09

12 Items: of overlapping scalesthe central core of a hairthe tough outer covering of a hair that isDNA - genetie material in the nudeus of a cellgranules- bits of pigment found in the cortex of a haira type of fibrous protein that makes up the majority Of the cortex of a hairthe region of hair located atside the medulla that contains granules of pigment...

Basic concepts related to functions 2024-12-23

16 Items: Graph of a linear functionA value that does not changeGraph of a quadratic functionA symbol that represents a numberA function whose graph is a parabolaA visual representation of a functionAll positive and negative whole numbersThe point where a graph crosses an axisAll possible output values of a functionA function that reverses another function...

Crime & Measurement 2026-02-01

19 Items: A part one index crimeA part one index crimeA part one index crimeA part one index crimeA part two index crimeCrime rates are higher in the summerProduces a sense of relative deprivationSurveys that get the dark figure of crimeImmune to punitive nature of the CJ systemMeasures criminal victimization experiences...

CHAPTER 5 2025-05-07

212 Items: TĨNHĐỘNGBỔ-TỐVỊ-NGỮCỐ-HỮU“TALL”TỪ-NỐITÍNH-TỪHẬU-NGỮSTATIVEDYNAMICADVERBSINHERENTGRADABLE“ATOMIC”TRẠNG-TỪADJUNCTSSOME-HAVETHUỘC-NGỮNHẤN-MẠNHTĨNH/ĐỘNG“CAREFUL”CANNOT-BEADVERBIALTRẠNG-NGỮDISJUNCTSCONJUNCTSMODIFIERSINTENSIFYADJECTIVESAMPLIFIERSKHUẾCH-ĐẠIOF-ADVERBSPROPERTIESLIKE-“-OUS”ATTRIBUTIVEPREDICATIVECỤM-TÍNH-TỪNONINHERENTEMPHASIZERSVERY-“TALL”...

Finish the phrase 2024-08-13

15 Items: "Pull the (blank) Kronk.""Call (blank) 877 cash nooooow""Ouch, (blank) that really hurt!""Its my (blank) and i need it now!""I'm a little lad who loves (blank).""Dirty mouth, clean it up with (blank)."(blank) ahead. Uh, yeah I sure hope it does.""A (blank) flew around my room before you came.Hurricane Katrina more like hurricane (blank)."...

U12 2026-01-12

11 Items: Taking everything into account; regarded as a whole.To seize or take hold of something suddenly and roughly.To win a victory over an opponent in a battle, game, or contest.An act of helping a teammate to score a goal or point in a game.A list of players taking part in a particular game or sports match....

Among the Hidden Chapters 8-15 2025-11-13

11 Items: a manner of disbeliefprovoke or challenge someonespeak or act in opposition tothe giving or offering of a bribein a way that lacks confidence, not certainmove or balance unsteadily, sway back and forthclean, fresh, spotless, in its original conditionspeak to someone or about something in a scornful way...

TOP 10 HORSE BREEDS 2024-01-18

10 Items: Are cold blooded, heavy horses known for doing work pulling heavy loads.An exceptionally cooperative breed with an eagerness to please its human.A horse that's fully grown at 14.2 hands (57 inches) or less is considered a pony.A category of horses that have been selectively bred for a smooth ride or ambling gait....

Animals 2025-03-19

12 Items: catpighippohorsetigermousemonkeyswallowman's best friendking of the junglehates its black and white stripesa friend that remembers you forever

Bronson's word search 2023-12-18

8 Items: stars in belefthe study of spacethe galexy that we live ina person who go's up to spacemade of dust and ice that orbits the suna path that go's around a planet or starwhen you conect star and it makes a shapea rock that coms from space in to a atmosfer

Chicken Word Search 2024-06-25

25 Items: my hall passwhat you areyou’re my #1it just is a…your dream petbest brand ever!when your back inyour favorite dogwhat you are to memy favorite phrasei love to give youwhat you are to meyour favorite dessertmy favorite descriptorwhat your water must beone of your favorite drinkswhere i love you to and backthe best name to call a friend...

HARRY POTTER 2025-10-06

27 Items: THE MAPSWEET SHOPHEADMASTERBLONDE FAMILYGIRL BEST FRIENDHARRYS BIRDAYDAYVOLDEMORTS SYMBOLFIRST DAY OF TERMPUB FOR HOGSMEADEHARRYS FORS BROOMTHE LOVE GOLD STUFFRED HAIR BEST FRIENDPOPULAR WIZARD DRINKSHE WAS ONCE A MALEDICTUSHAMLET THE STUDENTS GO TOGODFATHER OF HARRY POTTERWHO SEALED THE PLATFORM 9 3/4HOUSE ELF OF THE CROUCH FAMILY...

Bill Nye Music Word Search 2025-10-20

20 Items: A single sound or tone in music.How many sound waves pass by each second.How high or low a sound seems to our ears.The pattern of beats that makes music move.The unit used to measure how loud sound is.A set of notes that go up or down in order.The gas around us that sound travels through.The way sound travels outward from its source....

Twenty One Pilots MOSTLY songs clues 2025-02-12

41 Items: to floata red gemto go backto get darkera tight necklaceto decorate againthe day after Fridaya door that is a trapthe place you were bornwhat a forest is made ofto sink in water quicklyyou watch TV shows on thisa compromise between peoplea really really bad headachemany tiny peices of somethinga bunch of trees in one place...

Places in Matosinhos 2024-10-17

9 Items: The main building where the local government works.A place where you can borrow books to read or study.A building where people go to pray or attend religious services.A sandy or rocky area by the sea where people can swim or relax.A statue or building made to remember an important person or event....

Ancient Word Search 2025-11-23

28 Items: old and important in historya person who designs buildingsunder the surface of the eartha particular part of a city or townsomeone who likes something very muchfrom the period between 1000 and 1500 ADsomething valuable because it is very oldconnected with or believing in a religiona public building where people can see art...