and the blade Word Searches

duck 2023-12-19

7 Items: andand alsoducks areducks are alsofast in the waterthat helps them flysome thing that flys

States of Matter 2024-09-08

12 Items: a solid changing to a gasa gas changing to a solida gas changing to a liquida liquid changing to a gasa liquid changing to a solida solid changing to a liquidenergy related to particle speedmatter with no definite shape or volumematter with a definite shape and a definite volumestored energy due to interactions between particles or objects...

Chapter 10 Vocab 2022-11-16

11 Items: where plates spread apartwhere plates come togetherthe original supercontinenta trace of an ancient organismwhere plates slide past eachotherthe idea that continents slowly move over Earth's surfacebreaks in Earth's crust where rocks have slipped past eachotherareas along the ocean floor where underwater canyons can be found...

Retrieval 2025-01-06

11 Items: The brittle bone disease OThe body's primary source of energy CThe bodies secondary source of energy FHow many components of health there are TThe type of health that relates to friends SThe type of health that is effected by obesity PWhen a person has a large body fat percentage OThe name of the hormone released during exercise S...

Word Search 2025-10-18

11 Items: Use it to feed the baby.Name of the new Jakupca babyWhen it's dirty, you change it.Lilith is Josh and Bri's new ______.When you travel, you secure the baby in this.Use this to push the baby around public spaces.When the baby cries, you put this in their mouth.Instead of breastmilk, you can feed the baby _____....

property and casualty insurance 2025-08-19

18 Items: credit reporting act(federal regulation)event - $ 200 millionoriginally enacted in 2002result of 9/11 attacks on U.Sup to 10 years in prison or bothinsurers and producers must complypenalty - $ 5,000 1 year in prison or bothis illegal to make false statements if guiltystategramm - leach bliley act (is USC section 206)...

Sports Records 2025-09-14

20 Items: NHL’s all-time leading scorerNBA team with 17 championshipsMLB player with the most career hitsOlympic long jump record set in 1968Scored the “Goal of the Century” in 1986Cricketer with a batting average of 99.94Swimmer with the most Olympic gold medalsHolds the men’s 100m and 200m world recordsGolfer with 18 major championship victories...

Ecosystems Vocabulary 2024-12-10

11 Items: A living thing in an ecosystemA non-living part of the ecosystemAn organism that ONLY consumes meatAn organism that ONLY consumes plantsAn organism that makes their own foodThe movement of energy in an ecosystemThe process plants use to make their foodAn organism that breaks down dead materialAn organism that consumes both plants and animals...

Immigration Word Search 2026-01-08

6 Items: The goods of the earth were made by God for ______The human dignity of those who are ______ should be respectedThe Lord placed a sentiment of universal _____ into our hearts.lack of freedom goes against the proper purpose of the government.Individuals should be given the opportunity to work for the means of achieving a full and dignified ______...

Immigration Word Search 2026-01-08

6 Items: The goods of the earth were made by God for ______The human dignity of those who are ______ should be respectedThe Lord placed a sentiment of universal _____ into our hearts.lack of freedom goes against the proper purpose of the government.Individuals should be given the opportunity to work for the means of achieving a full and dignified ______...

Build Up 3-3 2023-02-03

11 Items: This turns into a froglet.The only egg-laying mammal.The top layer of a rainforest.The largest habitat on the planet.Mammals and birds are ____-blooded.Habitat where you might find horses.This kind of animal has hollow bones.Hard shiny things that cover a fishes skin.A mammal that lives in a marine environment....

The Kids and Pets 2024-12-20

19 Items: LeoDougJoshRickTonyYogiCainLunaKatieSarahTommyAudraMooseJanellJaclynOliviaEileenChandlerOccasionallyStella

The Gospel and Reason 2025-09-23

19 Items: HopeLightMercyGraceHonorWedgeLovedGospelSinfulGoodNewsDarknessForgivenReunitedChristianSeparatedJesusBloodConfessionWashedCleanCommandments

LANGUAGE AND THE BRAIN 2025-10-30

20 Items: BROCACORTEXNEURONCORTEXSTROKEPROSODYARCUATELEXICONSTIMULUSRESPONSEWERNICKEDOMINANCECOGNITIONREASONINGCEREBELLUMPERCEPTIONACQUISITIONHEMISPHERESSPLIT-BRAINLATERALIZATION

ESSAY WRITING WORD SEARCH 2024-05-15

10 Items: The central subject of an essay.The main sentence in a paragraph.One method of starting an introduction.The basic number of components an essay has.Typically the last sentence in the introduction.These sentences give more details in a paragraph.This section is developed from the thesis statement.Words or phrases used within and between paragraphs....

The Source Word Search 2024-11-06

15 Items: The number of counter checks per sheetThe last name of our Financial AdvisorThis DDA type has no minimum balance requirementsThis DDA type comes with a free Platinum Visa Debit CardThe number of months a savings account can be dormant before getting feesThis DDA type requires a $500 monthly electronic deposit to avoid service charges...

Cycle 1 S2 Week 8 2025-03-26

10 Items: solid, liquid, gasWhere lines cross overthe study of correct reasoningthe distance around a circle or the length of a circlethe amount of money held in a bank account at a given momentthe process of ending the separation of different racial, religious, or cultural groups...

Monitor Word Search 2025-05-13

9 Items: At what height should a desk be adjusted toWhat items should be placed within arm's reachThis item on a backrest supports the lower backA chair base should have ____ prongs for stabilityApproximately arm's length away and slightly tiltedAdjust chair height until _____ are flat on the floorThis type of break should be taken every 20-30 minutes...

Voices of Strength 2024-07-20

20 Items: legal entitlements.relating to the home or family.the right to express an opinion.action taken to improve a situation.the quality or state of being strong.public support for a cause or policy.a safe place for those escaping abuse.knowledge or perception of a situation.a condition of being safe or sheltered.the state of being free within society....

Lorna Simpson 2025-01-28

10 Items: artists first nameartists second namehometown of the artistartist's most famous mediumhow the artist displays her workpolitics artists subject matterBiennale museum to display artist's workof California where the artist went to schoolFigures the name of famous work by the artistAmerican culture of artist and subject of her works

All About Reads by the River 2023-09-12

11 Items: Owner/curator at RBTRThe river next to our shopThe month we opened in 2021Your favorite local bookstoreThe city where we are locatedThe street where we are locatedCreative people we love to highlightOwner and guy who can build anythingThe unique item hanging in our storeEveryone's favorite moveable item in our store...

Unit 2 Review 2023-12-19

10 Items: Push or Pullyour mass plus GravityUnit to measure force(N)How much "stuff" you are made ofsomething you can build with snowForce that pulls things down to eartha tendency to remain unchanged and has a direct relationship with massFor every action (force) in nature there is an equal and opposite reaction....

Interactive Piece - Vast Chasm Issue 8 2023-10-12

35 Items: webashmuckfeargriefflamehordebladecrowswoodsbonesthroatshadowpinkercreakydialecthunchedswarmedominousgrabbednervouspumpkinwitcheswatchingbleedingenchantedcorruptedwastelandarticulateterrifyingdistractedoverpoweredsilhouettessuperstitionjackolantern

Greys Anatomy 2025-02-04

32 Items: Jo007DNRBurkTraumaMedusaSeason1PrestonSeattlePost-itJohnDoePost-opJoe'sBarMintToBeZolaGreyLVADWire10-bladeElevatorCardioGodCodeBlackEvilSpawnAdulterousPinkScrubsAmputationInternshipFerryBoatsHarperAveryAlzheimzer'sRichardWebberPlasticSurgeryYou'reMyPersonCardiothoracicsurgery

English 1 Exam Vocab 2025-05-19

18 Items: The main character or hero.sequence of events in a story.Events leading up to the climax.How the story’s problems are solved.Information that can be proven true.Saying the opposite of what you mean.The main message or lesson of the story.Language that appeals to your five senses.The turning point or most exciting moment....

Latitude Word Search 2025-01-11

30 Items: A group or chain of islandsWhere the land meets the oceanA body of water surrounded by landA large area covered mainly with treesA cold, treeless region with frozen groundA large area of flat or gently rolling landA nation with its own government and bordersA low area of land between hills or mountainsA piece of land completely surrounded by water...

Little Miss Hope and The Bulldogs II 2026-01-10

10 Items: showing what is right or wrong behaviorprotecting and using natural resources wiselya person who speaks up for or supports a causewhen there is not evough of something to go aroundrelating to nature and how people affect the earthdisagreement or resistance to an idea or an actiona reason that explains or defends a choice or action...

Beauty Word Search 2024-02-20

5 Items: rentLineannieforty-oneand the beast

Panhandle Press Wordsearch 2025-12-19

19 Items: Billie Jo's brotherma died because of a...Billie jo's favorite hobbywhere the animals are keptBillie Jo threw a pail of...Billie Jo's father's professionthe state where Billie Jo livesBillie Jo's father's girlfriendthe first name of Billie jo's mathe crop Billie jo's father growstime when the economy was very badthe first name of Billie Jo's father...

Robert H. Goddard word search. 2024-05-06

14 Items: Space.Medal.Rocket.Goddard.Bazooka.Exhaust.Bell X-2.Altitude.Worcester.Cherry tree.Liquid fuel.October 5, 1882.Scientific Paper.Find the word that isn't hinted and come to the display for another sticker!

Year 4 Words, WordsSearch 2024-11-21

20 Items: MinuteBelieveregularPromiseQuarterStrangeCalendarProbablyPossibleQuestionStraight- Clean clothes- Known by many people- the month after January- When you know a lot of things- what you call your fanourite thing- when you don't give up on something- A peice of land , that lives on water- The thing that makes sick people get better...

The Electoral College 2024-10-21

15 Items: ________ DC has 3 electoral votes.This state has 40 electoral votes.Indiana has how many electoral votes?Symbol of the Republican party (animal)Symbol of the Democratic party (animal)This state has the most electoral votes.This southern state has 8 electoral votes.This southern state has 30 electoral votes....

AP Psychology Unit 3B 2026-02-01

10 Items: Interpreting new info using existing schemasModifying old schemas to fit with new informationDecrease in response to a repeatedly exposed stimulus.The inability to see the world different points of view.Ability to think about abstract concepts and possibilities.Mental framework that works with information and experiences....

Y7 English Core Vocabulary 2024-07-10

10 Items: Who the text is for.​What the point of the text is – what it is meant to do.​What the text looks like – how it is set out on the page.​A traditional story of early history which helps to explain the world.​An idea that appears throughout a text and helps to give the text meaning​...

CH 7: Principle of Effective Communication 2025-02-07

11 Items: Signs, symbols, and designsAccount for 55% of body Languageinitiating the communication processPutting your biases aside to understandBody language, eye contact, and gesturesThought, concept that is being transmittedWhat ensures messages are clear and simpleWhat ensures understanding through responsesTo have an interchange of ideas or information...

Chainsaw Word Search 2026-01-20

10 Items: Impending sense of ____Largest bears in the worldFlag, Green, White, and OrangeBlack and Bing, sour and sweetProgramming language, large reptileA series of small islands in a chainForestry tool invented for childbirth___bite, blackened extremities and blue lipsComedic Director, Spaceballs, Blazing Saddles...

Scientific Method 2025-10-20

8 Items: This group receives the independent variable.These are the things in an experiment that stay the same.These are the things in an experiment that stay the same.Data in the form of words and answer the question “What?”Data in the form of numbers and answer the question, “How much?”This variable is what changes because of the independent variable....

Literary DevicesFrankenstein 2024-03-04

6 Items: the time and place in which the story takes placeof View the perspective from which the story is toldthe use of symbols to represent ideas beyond their literal meaningsthe opposing force that acts in opposition to the protagonist, creating conflictthe main character in the story, the hero or central character driving the plot forward....

Countries and Capitals 2023-01-21

18 Items: praiaUS stateIn RussiaeasttimorCornish Place- Owns 50 statesIn the CarribeanIn the CarribeanCapital of RussiaCapital of East TimorSouth American country- Southern North AmericaLondon Underground stationHas a capital city of HarareBoarder of South and North AmericaNorthern Central England - Has a college...

Freedom Crossing pages 51-99 2024-02-20

16 Items: proofsimplyto stroll alonga small argumentleaves of a plantto turn or look awayclumsy; lacking skillconfused and surprisedsuffering from bad luckto go at a slow, easy paceboldly rude or disrespectfulto move around in an impatient wayfreedom from the demands of work or dutya state of great confusion or disturbance...

Word Search 2022-06-22

12 Items: (n) a swimming pool(adv), (adj) not far away(n) a single apartment in a bigger building(n) a tall modern building with many floors(adj) old-fashioned, or based on ideas from the past(n) an opinion, belief, or idea, or a way of thinking about something(n) the area of a town that surrounds someone's home, or the people who live in this area...

Tactical Entry 2026-01-20

12 Items: To break into or throughTo block or defend with an improvised barrierTo verify a space is not occupied by a threattactical mask designed to protect against bulletstactical mask designed to protect the wearer’s identitytactical mask designed to protect against inhalation of toxins...

Rowing 2024-06-09

35 Items: bowoarrundeckgateloadportbladecheckdriveshellslidesternsweepswingbowmanbuttonpaddleratingriggerstrokehatchetreleasewashingcoxswainrecoveryscullingergometerrepechagestarboardstretcherfeatheringliftweightgermanriggingitalianrigging

Figure Skating 2025-05-08

35 Items: IceAxelEdgeJumpLutzRinkSpinBladeCoachGlideMusicScoreSpeedTwistJudgesSpiralWarmupBalanceCostumeLandingRoutineSalchowToeloopFootworkIcedanceQuadrupleDoubleaxelTriplejumpCombinationCompetitionPairskatingPerformanceChoreographyPresentationArtisticimpression

Accounting in Action: Word Find Challenge - Focus on Plant Assets, Time Value of Money, and Stockholders' Equity 2025-07-24

12 Items: The nominal or face value of a share of stock.The ownership value of shareholders in a company.Income earned from the sale of goods or services.Earnings distributed to shareholders in cash or stock.Resources owned by a company, both tangible and intangible.Shares that were issued and later repurchased by the company....

Music Terms Word Search 1 2025-01-08

25 Items: softloud/strongmedium loudmedium softNeither sharp nor flatGradually getting louderGradually getting slowerArticulate a note shortlyMarkings to indicate volumeThe speed of a piece of musicConnected, flowing articulationEveryone sings the same pitchesMakes the pitch a half step lowerTwo or more notes on one syllableMakes the pitch a half step higher...

How Well Do You Know Your Model A #4 2023-12-29

20 Items: modern voltagelifts the valvesprovides inertiaoriginal voltage____ draft carburatermodern battery chargeroriginal battery chargerlegal ownership documentvehicle with body removedtype of suspension springsreduces engine exhaust noisevehicle construction starting pointseals the junction between two surfacesconverts linear motion to rotational motion...

Immigration Word Search 2026-01-08

6 Items: The goods of the earth were made by God for ______The human dignity of those who are ______ should be respectedThe Lord placed a sentiment of universal _____ into our hearts.lack of freedom goes against the proper purpose of the government.Individuals should be given the opportunity to work for the means of achieving a full and dignified ______...

HORSE TRAITS TO CONSIDER WHEN BUYING A HORSE 2024-01-18

10 Items: Can be bold & daring or need clear boundaries.Can be curious, inquisitive, and problem solving.These horses are unconcerned with their surroundings.Consider your personal goal for speed or pace when buying.A horse with the ability to do the athletics you are seeking.Horse is afraid but conquers fear with the support of partnership....

A+Unit 8 2025-05-19

18 Items: –We can trade our toys for fun.–I like to relax by reading a book.–She is not only smart but also kind.–I will be done with my homework soon.–This cake is so delicious, I want more!–We walked one kilometer to get to the park.-We poured condensed milk on the shaved ice.–Long ago, people came to colonize new lands....

Deutsch II Bundesländer Vokabeln 1 2025-09-28

33 Items: seasealakeriveroceanbeachwitchvalleybridgeislanddonkeyrobberroostertom catthe Westthe EastUS statethe Norththe Southwaterfalleast (adj)west (adj)north (adj)south (adj)German statethe Northwestthe Northeastthe Southwestthe Southeastthe North Seathe Baltic Seato visit a cityto lie (location)

-ing words 2025-10-03

15 Items: – Clue: The dog is ___.– Clue: The man is ___.– Clue: The cat is ___.– Clue: The frog is ___.– Clue: The fish is ___.– Clue: The bird is ___.– Clue: She is ___ milk.– Clue: The kids are ___.– Clue: The rabbit is ___.– Clue: We are ___ our hands.– Clue: The boy is ___ a cake.– Clue: The girl is ___ a book.– Clue: He is ___ on the paper....

akos's word search 2023-12-18

14 Items: small asteroidsstudy of planetsstudy of constellationthese are basically starsplanets that has their own lightyou can call it as shooting starsa planet goes around the sun is calleda handle made of 3 stars and a bowl of 4planets that doesn't have their own lightit's a rock that falls from space to Earthit's a massive ball it can be rocky or gas...

Engineering 2025-05-01

7 Items: Desired outcomes for an engineering design or productThe overall objectives, functions and constraints of a projectThe capabilities or tasks that an engineering solution is able to perform.statement A sentence or two that describes the identified problem or challenge an engineer or engineering team is working to solve....

for brax 2024-04-02

26 Items: megaenemyabsoldreamshinyeitherdiscussexhausteasiestpokemonzygardedelphoxlegendsdistanceentranceexercisecapybaragreninjalysandreemergencyminecraftexperiencechesnaughthe never diesthe poor prey of shiny hunterswhat you click and grandmas hate

About the ALT 2025-04-21

10 Items: One season is 雨季Another season is 乾季My name is _ _ _ _ _ Lmy hobby is S _ _ _ _ GMy language is E _ _ _ _ _ _T _ _ _ _ _ S lay eggs on the beachThere are pink and yellow P _ _ I treesA sweet fruit in my country is M _ _ _ OMy country is T _ _ _ _ _ _ D AND T _ _ _ _ OThe 3 colors on my flag are ____, white and black

Talk Word Search 2026-02-02

10 Items: - to say something again- the sound we use to speak- a short stop while talking- the way we talk and use words- being nice and caring to people- being calm and not rushing others- to pay attention when someone talks- to use words to share ideas or feelings- doing something many times to get better...

Success and Goals 2017-03-30

43 Items: NOASKSAYTHEANDACTPAYEYESELFSELFSELFPEERWALKAWAYGOALGOODOTHERSESTEEMCOPINGDECIDECHOICEVALUESSKILLSHELPINGHONESTYPROBLEMOPTIONSSUCCESSCONTACTREFUSALIDENTIFYINTERESTEVALUATEPRESSUREDECISIONQUESTIONSATTENTIONDISCIPLINEEXPRESSIONCONSEQUENCEPERSISTENCEBRAINSTORMINGCOMMUNICATION

Religion Terms 2024-11-13

20 Items: - Jesus’s Birth- believing in god- dedicated to god- to communicate to god- a building to worship god- to show your faith to god- to do good and avoid evil- thanksgiving , saying thanks- a community of Jesus’s followers- a male who commits themself to god- a religious ceremony such as baptism- a female who commits themself to god...

Takesix Word Search 2024-02-24

11 Items: Ra: The Egyptian ___ god.The crystal of true love.Hades' sacred counterpart.The state where I regrettably live.This last name is sitar-playing royalty!The ancient African kingdom south of the Nile.This cane-carrying rogue kept Joni's camera to sell.This black male acapella group's name plays on a Dave Brubek hit...

breaking bad episode 4 2022-10-06

17 Items: -absorb or clear-slang for a hand job-slang for crystal meth-a dark granular mineral-cause (someone) to feel exhausted-the study and treatment of tumours-Cancer that forms in the glandular tissue-a main or large bolt in a central position-feeling or expressing overwhelming happiness-corresponding in size or degree; in proportion...

Unit 11 2024-04-25

9 Items: this zone has enough light for photosynthesislow level of primary productivity in lakes/pondshigh level of primary productivity in lakes/pondsContains 20% of the world’s available surface waterthis zone does not have enough light for photosynthesisAmount of water used for all purposes per person over a given time...

spelling words + a lot extra 2024-05-01

35 Items: trulySciencesuggestsectionsuggestzygardeumbrellauniversecapybaragreninjasuccessfulsufficientexperiencechesnaughtunfortunatelyaka cave gamehe never diesaka dancy duckSerena mega monthey ARE stellarteam flare leadergotta catch em allaka con artist catthe capitalism ratthe most popular gimmickaka da clutch #2 clutcherthe poor prey of shiny hunters...

The Chat Went Quiet 2025-12-03

20 Items: Smart or impressiveA feeling of not being sureTo solve or repair a problemA pause because you are unsureQuiet with no sound or responseAn online space where people talkUnderstand something the wrong wayThe area where basketball is playedA written communication sent to someoneDone on purpose and with careful thought...

BRANDS 2026-01-15

10 Items: an item that shows wealth, success, or popularity.the act of creating new ideas or improving products.something that represents an idea, place, or feeling.the process of growing and selling products in new places.activities used to promote and sell a product to customers.open shoes that are easy to wear, especially in hot weather....

3B W16 pt1 2022-05-25

10 Items: n.7 daysadj.not wetadj.not safev.not forgetadj.covered in snown.another word for rockn.it's hot and it burns thingsadv.draw a circle _____ the correct wordadj.make sure to be safe or not break thingsv.think about and decide what to do in the future

Edge Challenge - Word Search 2025-06-10

6 Items: Automated provisioning without manual configuration.The delay before data transfer begins after an instruction.The intermediate data path between edge networks and the core.A cloud-native architecture combining networking and security functions.Designing networks and infrastructure with environmental efficiency in mind....

Vocabulary Lesson 11 2023-01-31

8 Items: Emily was _____ if her support of the proposal.Elizabeth Cady Stanton was an ____ for women's suffrage.Smelling mint can _____ a sense of tranquility or freshness.The mountain air was redolent with the scent of pine needles.Organs, such as your nose and the nasal cavities, are part of the _____ system....

Literary Devices Crossword Grades 11-12 MA ELA Standards 2025-12-22

30 Items: an author’s word choicea word that imitates a sounda comparison using like or asthe emotional atmosphere of a textdeliberate exaggeration for effectlanguage that appeals to the sensesspecial importance given to an ideaa recurring idea, symbol, or subjectthe sequence of events in a narrativegiving human traits to nonhuman things...

Insiders & Outsiders 2025-11-12

17 Items: hapūMāorigroupsminersracismPākehainsideroutsideridentityethnicitynationalitycommonwealthClue: a Māori tribeClue: where Chinese gold miners were invitedClue: a type of racism involving laws and the governmentClue: when ethnic groups live and work together with equalityClue: when ethnic groups are separated, with a power imbalance

Early Modern Law Enforcement 2023-01-03

16 Items: Used to put down protests and riotsWitnesses of a crime raising the alarmAn official responsible for investigating suspicious deathsA safe place offered by important churches abolished by James IA group of men called upon by the sheriff to track down a criminalEmployed to patrol the local area and deter criminals, often at night...

Clothes & Accessories 2025-09-18

16 Items: It's like a shirtThey're plain shoesBetter know as "top"It's a "T" form shirtSimilar to tenis shoesUsed by men on the neckShoes to walk on the sandman and women can use themWomen love this kind of shoesA hat made of really soft woodUsed by women to go to the gymTo have the time on your wristLike a hoodie but with no sleeves...

Dipthongs "ou" and "oi" sound 2023-12-07

10 Items: You go _____ the slide.Soil is the color _____ .I don't know _____ the book.It is rude to _____ at others.My mom _____ my missing homework.Ms. Stapleton plants flowers in the _____ .Ms. Firman has such a pretty singing _____ !I have two eyes, a nose and a _____ on my face.I hope the students do not _____ the classroom....

Pekudei 2023-05-04

8 Items: What would cover the Mishkan by day?What would cover the Mishkan by night?In what year was the Mishkan established?What is the correct word for "priesthood"?In what day did Moshe establish the Mishkan?From how many years did a person have to do the census?Under the direction of who, was the work of the Mishkan?...

Infection control 2025-10-27

30 Items: A microorganism capable of causing disease.Separating patients to prevent the spread of infection.Completely free of all microorganisms, including spores.A biological substance that poses a threat to human health.A chemical used on non-living surfaces to destroy pathogens.living organism (like a mosquito) that transmits infectious disease....

Banking Vocab Word Search 2 2024-12-17

15 Items: An account that you can put money into and use it any timeThe right column in a two-column chart that records business transactionsWhen an account doesn't have enough money to cover a transaction or withdrawalThe amount of money in an account at the beginning of a new accounting period:...

Musical Theater 2024-02-20

5 Items: rentannieLa Landhairsprayand the beast

PARTS OF THE HOUSE 2025-08-17

10 Items: YOU COOKYOU SLEEPBELOW THE ROOFYOU HAVE DINNERYOU HAVE FLOWERSYOU PARK YOUR CARTHE TOP OF A HOUSEYOU GO UP AND DOWNWHERE YOU HAVE A SHOWERYOU WATCH TV ON THE SOFA

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

Bird Word Search 2025-11-20

10 Items: - A baby bird.- The body part a bird uses to fly.- The soft covering on a bird’s body.- A large white bird with a long neck.- A colorful bird that can copy sounds.- A home that birds build for their eggs.- An animal with feathers that can fly or hop.- A strong bird that flies high and hunts for food....

Global Diversity 2024-09-25

10 Items: Volunteer and ____.Global Diversity ____ Month.Marken ____, like EAP and Virgin Pulse.Promoting ____ is a key aspect of Global Diversity.This month is a time for ____, learning, and growth.Supporting ____ businesses is a great way to get involved.Participating in Global Diversity Month involves both learning and ____....

Matcha Word Search 2026-01-25

10 Items: First dateA band we loveSmall and greenMy favorite colorYour favorite colorThe best movie theaterThey make the best matchaMy Valentine’s gift to youOur favorite thing to drinkThe month we started dating

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Shop Safety and FFA HHS 2025-02-05

20 Items: Who leads the FFA?What tool makes miter cuts?Where is convention held now?Where is the sentinel stationed?Where is the president stationed?What is the highest officer in FFA?Who is considered the father of FFA?Where was convention held until 2000?What is the name of the FFA magazine?What should be on at all times in the shop?...

Christmas 2025 2025-12-12

34 Items: sawcuttaxtoolvisemillbladedrilllathewelderplaneronlineretailcouponofficesawdustflannelturningdiamondjointercataloggunsmithshipmentshowroomproductsimportedworkbenchwarehousetechnologyprotectioncollectioninfluencerwoodworkingphotography

EDP Word Search 2025-05-01

7 Items: Desired outcomes for an engineering design or product.The overall objectives, functions and constraints of a project.The capabilities or tasks that an engineering solution is able to perform.statement: A sentence or two that describes the identified problem or challenge an engineer or engineering team is working to solve....

Constraint Word Search 2025-05-01

7 Items: Desired outcomes for an engineering design or product.The overall objectives, functions and constraints of a project.The capabilities or tasks that an engineering solution is able to perform.A sentence or two that describes the identified problem or challenge an engineer or engineering team is working to solve....

Year 7 - Vocabulary - Organs- Biology@EIS 2025-10-06

20 Items: Plant organPumps bloodControl systemContains brainPhotosysnthesisBottom of ThoraxContracts and relaxesRemoves waste productsPart of nervous systemGroup of similar cellsGroup of similar tissueThe body is divided intoPart of digestive systemPart of breathing systemPart of excretory systemContains Lungs and heartDevelopment of Offsprings...

Welcome June 2025-04-22

14 Items: you ride theseyou smell theseyou swim or surf in thisyou plant flowers in thisyou go here to see the oceanyou take this when you go awayyou get this when you graduateyou watch this in the early morningyou watch this in the early eveningyou go to these to see couples get marriedyou have this party when you finish college...

Religion Wordsearch 2015-11-01

43 Items: ofOldNewThetheandhispoperulegoodninefiveimamJesusBibleagapeallahnamesharamhalalhijabjihadummahsunnishi'agoldenninetyqur'anhadithst.paulparableliberalpillarsmakurahmoderatemuhammadshari'ahTestamentTestamentsamaritanextremistdenominationfundamentalist

sight words 2023-05-22

41 Items: nowyescaneatranshealltoobigyoureddidandonefortherunseenottwoawayintocomejumphelpwellblueheredownsaidwentlookplaymakefindwherefunnyblackthreelittleyellow

Maroon Word Search 2025-01-16

26 Items: ItNowRedSong1989KelceYoyokExileDebutLoverMaroonDreamsFor ItDaylightThirteenCardiganFearlessFolkloreEvermoreBlack DogMidnightsAnd AlwaysReputationTo DecemberATWTMVTVFTVDid Something Bad

Our word Search 2025-09-08

18 Items: Our first dance song.The month we married.The college we attended.The pet we got together.The town our home is in.The state you proposed in.The app we first messaged on.The first message you sent me.Where we went on our first date?The venue where we got married in.The person who has my heart forever.The pet we first brought into our home....

Body as Evidence 2023-11-28

11 Items: Feeding on dead fleshDepositing, or laying, of eggsThe scientific study of insectsA transformation or dramatic changeTemperature of the environment or airThe scientific study of how living things are classifiedPost-mortem cooling of the body to the surrounding temperatureSmall, often microscopic animals, especially those that live in the soil...

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

Hurricane Word Search 2025-02-11

10 Items: The sound produced by lightning during a stormA severe snowstorm with strong winds and low visibilityA large, powerful storm with strong winds and heavy rainA visible mass of condensed water vapor in the atmosphereA sudden shaking of the ground caused by tectonic movementsA flash of light caused by an electrical discharge in the atmosphere...

Mr Word Search 2023-10-23

29 Items: manrhihaghengagcokekylehillslagswanvapemayolazynewslazybeniwomanferalvoddypartybingomilliebucketspoonscaitlinmacciesand sketcrackheadpowerhour

asdf 2024-01-05

42 Items: ofallourandforourthecomejoinmindbodyuihsareacountyunitedindianhealthdentalvisionspiritindianpotawottishnonmissionhealthyservicetaaatdvnlibbynixincludesdelnortehumboldtservicesclinicalwellnessamericanelkvalleyhopewpuelweitchpeccommunityemploymentbehavioralgenerations