and the blade Word Searches

ERIKA AND CHRISTINA CHRISTMAS 2025-11-15

28 Items: YOUR LAST NAMEYOUR SISTERS NAMEERIKA'S MOMS NAMEERIKA'S DADS NAMEERIKA'S MIDDLE NAMETHE NAME OF YOUR CATCHRISTINA'S MOMS NAMECHRISTINA'S DOGS NAMEERIKA'S BIRTHDAY MONTHNAME OF CHRISTINA'S DADCHRISTINA'S MIDDLE NAMECHRISTINA'S MIDDLE NAMETHE 11TH MONTH OF THE YEARCHRISTINA'S BIRTHDAY MONTHERIKA IS CURRENTLY THIS AGECHERISTINA'S FAVORITE MLB TEAM...

Nurse Brain in Action 🧠🩺 2026-02-02

15 Items: is high blood pressure.helps the body remove excess fluid.is used to listen to heart and lung sounds.is the act of throwing up stomach contents.is a condition marked by low red blood cell count.refers to drugs given to treat illness or symptoms.are medications used to treat bacterial infections.is the inability to control urine or bowel movements....

Loss Drafts Information Part 2 2023-09-20

26 Items: The longer of the two claim processes.The shorter of the two claim processes.When a person passes away, they are _________.A document proving that a borrower has passed away.This investor has a monitored threshold of $10,000.This loan type has a monitored threshold of $20,000.A court document that can replace an adjuster's report....

The weather and the seasons 2 2021-05-26

39 Items: MayhotwetdryicyJuneJulywarmcoldcoolMarchAprilsunnywindysnowyrainyfoggytodayspringsummerautumnwinterAuguststormycloudyJanuaryOctoberthundershoweryrainbowFebruaryNovemberDecemberfreezingtomorrowSeptemberlightningyesterdaytemperature

The Aztecs and The Spanish Conquistadors 2023-11-25

87 Items: goldincagameballaztecarmortradeclashSpainmaizecausemayorarmorstonecorteshernanempiremexicosilverglyphsallieshorsesatlatleffectrightstemplosystemayllustributetemplesnahuatlcodicescholuladiseasepizarromestizosocietyritualsgardensquetzalserpentreligiontlaxcalasmallpoxmalinchefirearmschariotsinvasionpochtecaobsidianfeatherswarriorscalendarometeotl...

Words in Chemistry, Physics, and Energy 2023-05-22

20 Items: Energy of lightGas to a liquidLiquid to solidEnergy of positionUnit to measure forceBonds between nonmetalsUnit for work and energyMakes reactions happen slowerGroup 17 on the periodic tableDefined as exerting a force over a distance_________ forces do not cause a change in motionChemical reactions that release energy to the environment...

HEARTBREAK HOTEL 2026-01-26

20 Items: Visibility (7)Moo Moo Kitty (8)Double-Dealing (9)Opening Song, CLEAR EP (4)Small matters turn vile, briefly. (7)The rule that hurts before it heals (9)Mental descent from a single thought (9)Self-examination, within inked notes (13)The call that shows more than intended (8)Bitterness you pretend is indifference (6)...

In The Garden 2024-09-10

34 Items: Easter _______Also known as Moss Rose."Tiptoe through the ______"Bell, Sweet, Chili, Ghost, BananaPorky's girlfriend - _________ PigBig ones are called Night CrawlersGoes great with tomato on bruschetta!Main ingredient of Arby's Horsey sauceThe best part of a BLT - after the bacon.This fluttery insect is a garden favorite...

Mia. L Astronomy Word Search 2023-12-18

8 Items: looks like the dig spoonlooks like a small spoonshortest days of the yearThe belief of constellationsa celestial made out of ice and dusta system of million or billion starsScience test that deals with space and universeperson who is trained to travel in a spacecraft

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...

word search 2025-04-28

10 Items: Circuit: A circuit that is not complete, meaning there is a break or gap that prevents current from flowing.Switch: A device used to control the flow of electric current in a circuit by opening or closing the circuit.A device that stores electrical energy and provides a voltage difference to drive electric current in a circuit....

Revolutions Word Search 2023-10-12

10 Items: emperor-ruler of an empiretrade-napoleon prevented trade with great britainoppression-people were oppressed in france and haitiestates-three estates that sectioned people into classesguillotine-weighted blade that was used to behead peopleliberate-setting countries free from rule by other countries...

0817 Let's do it ! 2022-08-16

18 Items: Baguettes are from ________.definition: very smooth, not bumpyIn the past, bad ____ lied to people.May I have some _____ cookies, please?We should _________ our homework soon.Betty never lies. She is very _______.That's why "a baker's ______" means 13!This necklace is worth a lot of _______.definition: to move something around an area...

Sounds 2022-11-04

12 Items: pitchvolumedecibelmuffledvibrationamplifierunit for volume of soundsound that is quiet softloud or quiet the sound isquick movement back and forthvoice have a higher _______ than adultselectronic device that makes sounds louder

Patriot Day Word Search 2025-09-10

30 Items: Which building was taller?(2 words)The 9/11 Memorial has _____ memorial pools.September 11 is known as a Day of _________.The 9/11 Memorial pools are ____ _____ deep.The name of the location struck on 9/11.(3 words)The city where the one non-military plane flew to on 9/11.The length of time the fires at Ground Zero burned.(2 words)...

roller costars 2025-04-17

9 Items: Any push or pull.How fast an object movesspeeds up, slows down or changes direction: The energy stored by an object ready to be used.A force that draws any two objects toward one another.A combination of speed and the direction in which an object travels.The energy of an object in motion, which is directly related to its velocity and its mass....

The Foster Wedding 2025-02-26

18 Items: brides professionCouples last nameGrooms Middle NameBrides Maiden NameWhere did they meetGrooms Birthday MonthBrides Birthday MonthWhat are the dogs namesMother of the Brides nameMother of the grooms nameWhat state do they live inWhat's the Officiants nameWhat holiday did Gage propose onWhat town does the couple live in...

Our Family 2023-10-10

10 Items: A brother or a sister.Family that have immediate family only.Family that includes grandparents as well.It is important to show _______ for the elderly.The only person who works and earns money for the family.A basic social unit made up of parents and their children.Modern family rely too much on _____ to take care of their children....

And the Giant Peach 2022-02-05

20 Items: newmissyorkcityjamesstatesharkoceanspiderempireauntiespongeladybugseagullsbuildingatlanticcentipedeearthwormrhinocerosgrasshopper

Beauty and the Beast 2024-02-17

61 Items: piereadrosechippapacheflovetimetalekissbeastbellebookscurselefooframespellguestfightmagicbeautygastonfatherinventcastleforestwintertavernmirrorprincewolvesteapotsultandinnertemperlibrarymauricelumierevillagebonjourmaestrodancingcontrollibrarymrs.potsballroomwardrobebimbettsprisonerkindnesspatienceenchantedcogsworthwest-wingfootstoolenchantress...

Jonah and the Whale 2024-06-23

26 Items: fleeshipfishdaysspitcitywormjonahstormthreeshoremercyangerplantnightsprayerpreachpeoplerepentninevehprophetsailorsswallowtarshishoverboardrepentance

The Friends and Family 2024-08-21

21 Items: ZoeSamJohnGigiJoshSeanLillyHarryAprilEbonyFredaEmilyFamilyOliviaBironyFriendsSuzanneRahaleyjohnjohnHarrisonGlastonbury

JONAH AND THE WHALE 2024-10-19

44 Items: seaevilwindvowsfishcitylovewormpityJONAHJoppabellyashesangerboothgourdshadeasleepperishHebrewragingdecreefierceNinevehfleeingbillowsvomitedTarshishmarinerscastlotsdistressrememberviolencedisasteroverthrowsacrificesalvationfortydayssackclothrelentingrepentancetempestuousthanksgivingproclamations

Jonah and the Whale 2025-05-17

21 Items: GodSeaShiplotsFishFleeLordCalmCityJonahStormWhalebellyMercyPrayerRepentNinevehSailorsTarshishProphesyDeliverance

Fast and the Furious 2025-07-31

29 Items: JKHCCSGallefaceBYDShowroomDehiwalaZooDominosKotteCityofdreamsCinnamonGrandDutchHospitalcontactimtiazdaladamaligawaMinistryofCrabWorldtradecentreCinnamonLakesideIndepenenceSquareMountLaviniabeachMountLaviniaHotelOneGalleFaceTowerKeellsatUnionPlacePizzahutunionplacecolomboswimmingclubRajagiriyaMcDonaldssriparakumbapiriwenaPizzahutMattakkuliya...

Sinai and the Tabernacle 2025-11-02

23 Items: GodHolyseatMosesMountCubitCrownMyrrhEphodheartIsraelOuchesSantifySabbathHolinessConsecrateTabernacleNeedleworkEmbroidererFrankincenseCommandmentsPomegranatesShoulderpieces

Marina and the Diamonds 2025-12-26

47 Items: OhnoNumbLiesEvolBlueGoldGirlsHappyFrootWeedsGuiltyForgetSexyeahImaruinSavagesShampainRootlessTeenidleImmortalHollywoodSeventeenSolitaireObsessionsPrimadonnaLivingdeadHypocratesMowglisroadTheoutsiderHomewreckerRadioactiveBuythestarsIamnotarobotStarringroleElectraheartHermitthefrogCantpinmedownBubblegumbitchBetterthanthatAreyousatisfied...

Earth and The Ocean 2026-02-10

37 Items: AtollTrenchBigBangErosionFossilsSlapPullRidgePushCollisionMountainsDeepOceanCoastlinesConvectionOceanRidgeRiftValleyProkaryotesEarthquakesBarrierReefGlacialScarsAbyssalPlainAbyssalHillsFringingReefOceanicPlatesMidOceanRidgeOceanicOceanicAccretionMethodPlateTechtonicsSubdudctionZoneAncientClimatesCometsFormOceansHydrothermalVentContinentialDrift...

Hickam AFB 2025-11-26

27 Items: Our streetVacation condoVacation islandVolcano in MauiVolcano in OahuOur favorite mallThe other big mallFavorite pizza placeBig comet in the skyNeighbor to our leftOur elementary schoolThe Blazer’s nicknameRyan’s ride to the BXThe big pink hospitalTasty fruit from DoleNeighbor to our rightBeach we went to oftenThe Gibsons lived here...

¿Como te llamas? 2025-08-18

14 Items: mr.namemrs.misshellolikewiseMy name is...And you? (fam)And you? (form)It's a pleasurecharmed.delightedWhat is your name? (fam)The pleasure is all mineWhat is your name? (form)

World Malaria day KEPhSA. 2025-04-22

19 Items: What insect spreads malaria?What is the parasite that causes malaria called?Which part of the body does malaria mainly affect?What term is used for medicines that prevent malaria?What is the best way to avoid mosquito bites at night?Which mosquito species is the primary vector of malaria?Which drug is used for radical cure of malaria parasite?...

Magazine 3 2025-08-19

24 Items: a small songbirda body of running waterthin; having little widtha pleasant smell; fragrancea stopper for a bottle or jugto be unwilling to do somethingsomething that is made or growngiving it strength so it can lastto carry from one place to anotherto push or force into a small placea ruler in charge of land and people...

Semantics Word Search 2026-01-15

25 Items: nebulous- Vague or ill-definedumbrage- Offense or resentmentacerbic- Sharp or biting in tonekerfuffle- A noisy disturbance or fussbefuddle- To confuse or puzzle someoneatonement- Making amends for wrongdoingsemantics- The study of meaning in languagecountenance- Facial expression or appearanceastute- Having keen insight or sharp judgment...

Haley & Adam 2025-09-18

30 Items: Adam's favorite colorAdam's birthday monthHaley's birthday monthHaley's favorite singerAdam's favorite cuisineThe color of Haley's jeepDating app the couple met onAdam's favorite football teamHow old the couple's cats areThe couple's beloved dog's nameAdam's favorite alcoholic drinkThe month the couple got engagedThe make of the groom's race car...

The Lion and the Mouse 2014-09-29

15 Items: evegeneherorepaymeterelectthesebesidedemandcreatedeleteeraserpretendcompeteevening

Dylantherapgod word search 2022-11-28

9 Items: the wavelength is measured in metersis the distance of one complete wave cyclemoves the medium perpendicular to the wave motionwhich moves the medium parallel to the wave motionare the locations of maximum displacement up or downare the locations of maximum displacement up or downthe number of waves or vibrations produced per seconds...

Dog Word Search 2025-11-13

10 Items: – A very large animal with a long trunk.– A furry pet that barks and loves to play.– An animal with feathers and wings that can fly.– A big wild cat called the “king of the jungle.”– An animal that lives in water and swims with fins.– A farm animal that gives milk for people to drink.– A funny animal that climbs trees and likes bananas....

The ant and the grasshopper - Vocabulary 2025-08-05

20 Items: AntFoodWorkSingSaveColdLazyPlanHelpDanceHouseCarrySummerWinterHungryFutureRefusePrepareGrasshopperHardworking

Banking Vocabulary 2024-10-23

18 Items: Money you earnThings you have to spend money onA plan for how to spend your moneyYour signature on the back of a checkA person who buys or uses goods or servicesMoney coming in or going out of your accountThe amount of money you have in your accountAccount for money you don't plan on spending soonAdding money to your account to increase the balance...

The Elves and the Shoemaker 2014-09-23

15 Items: usevinewildgatehugezeromadelabelbonusspokebasicusualcaperfinestprogram

The Man and the Snake 2024-12-09

15 Items: BookCobraDeathHarkerButtonSnakesDeTropSnakeryDruringSerpentScientistHypnotizedOphiophagusSanFranciscoStuffedAnimal

The Classroom and the Playground 2024-11-02

15 Items: deskslideswingjigsawbeanbagshelvescrayonssandpitsandtoysstorybookplaydoughfingerpaintwheelbarrowclimbingframebuildingblocks

Memorial Day 2025-05-20

12 Items: place to bury the deadoutdoor party with foodfight between countriesmember of the armed forcesred, white, and blue bannermonth that we celebrate Memorial Daythe weekday we celebrate Memorial Daypeople march in the street to celebrateschools, banks, government buildings closedMemorial Day honors soldiers that ____ in wars...

Ethics in Cybersecurity 2025-11-21

20 Items: the V in VPNthe P in VPNthe N in VPNa hacker out to steal or cause damagewhat is truly, perfectly safe and secure?convention with cybersecurity professionalsa hacker without permission who still does goodthe ability to keep information secret from othersa situation in which regular rules may be suspended...

Loss Drafts Info Part 2 2025-06-24

26 Items: The longer of the two claim processes.The shorter of the two claim processes.When a person passes away, they are _________.A document proving that a borrower has passed away.This investor has a monitored threshold of $10,000.This loan type has a monitored threshold of $20,000.A court document that can replace an adjuster's report....

COSM/COSMO 2025-10-08

8 Items: One who travels the universeSmall version or part of a worldRelating to the broader universeA large, complex organized systemThe science of mapping the universeThe study of the origin of the universeUsed to describe a person of worldly culture and sophisticationEverything that exists everywhere (especially referring to beyond Earth)

take a break 2024-02-21

6 Items: the king pf englandbest newspaper everwrote romeo and julietteleads the continetal armyjefferson current presidentthe 2nd president of the united states

Causes and Effects of Imperialism 2025-02-06

10 Items: Survival of the fittestGeorge Washington initially wanted the US to stay ___The US's desire to tap in to new African and Asian ____The US acquired the ____ for a place in the Asian marketThe US acquired ___ after an uprising of Queen LiliuokalaniAmericans Missionaries sent to China in hopes to spread ____...

BF130 Chapter 10-17 Review 2025-10-13

13 Items: an intentional misrepresentation of a material factBreaking into a building with the intent to commit a felonyA legal doctrine indicating that parties meant to do what they did.Written defamation, or defamation published over radio or televisionan artificial, intangible entity created under the authority of a state’s law....

DNA Replication & Protein Synthesis 2024-10-06

22 Items: start codonReplicate AAGBackbone of DNA & RNAWhat does GCU code for?What does UAA code for?The process of making mRNACytosine binds with _______The process of making proteinsProteins are a made of _______Transcribe the DNA code: GATGCACTAThe process in which DNA is replicatedUnlike DNA, mRNA can _____ the nucleus...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

niniu 2025-12-09

8 Items: CollegeCompromiseCompromiseFederalistsand BalancesAntifederaliststhe ConstitutionNew Jersey Plans,

The Outsiders 2022-10-21

13 Items: RoughCool/SharpPet of the groupRich pack unloyalSmiles a lot and shopliftsModel like Ponyboys brotherQuite more ditsy than cherryGood looking fiery cheerleaderwe’re both greasers and socs hang outIndependent impulsive lacks common sense honestHigh cheek bones very blonde hair blazing blue eyes17 Sodapops best friend y’all and lean thick greasy hair...

Skin care 2024-10-30

30 Items: boilWartpimplespink eyeswellingbirth markbeauty markchicken poxlack of pigmentpersistent itchingmedical practitionerpore clogging ingredientsover production of pigmentdarkened shade of the skinfoul-smelling perspirationabnormal growth of the skina permanent mark on the bodyredness caused by inflammationa small sac or blister filled with liquid...

Vamonos de Viaje 2024-02-16

54 Items: latehotelto flyhostelexpiredto leaveto bringto carrythe roomincludedto drivethe portthe citytouristyculturalto visitthe planeto travelto returnto returnto arriveto cancelecoturismthe ruinsauthenticthe ticketto be fullto reservethe cruisethe museumthe airportthe touristthe countrythe travelerthe passportroom servicethe itinerarythe adventure...

r-controlled vowels, part 1 2025-11-12

8 Items: Harm or damage.The edge of a place.Before anything else.After first and second.To cause or have suffered pain.The official who enforces the rules.The points earned by competing teams.The shirt worn by sports players in a game.

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

Echo Word Search 2025-08-09

25 Items: "Sicko Mode" rapper?Kanye West’s new name?"Peaches" singer (2021)?SpongeBob’s best friend?Who is Batman's alter ego?Tony Stark’s superhero name?Who sings “Blinding Lights”?Meme frog known for being sad?Most-used app for viral dances?Who runs fast in the DC universe?GOAT soccer player, Messi or ___?Green Jedi Master from Star Wars?...

lawsons word serch 2023-12-18

18 Items: study of spacea pattern of starsa small icey objectlooks like a big bearalso known as ursa majoralso known as ursa minora galaxy that we live inlooks like a little bearthe study of constalationssomeone who gos in to spacea rock that tuches the grownda rock is in earths atmospherea huge object that has a orbitthe same size a a dust particle...

Vocab 12 2025-03-18

12 Items: Warm and friendly.Crouch down in fear.Feel a powerful desire for (something).Able to be changed in form, function, or character.The action or process of bringing something into existence.The ceremony of crowning a sovereign or a sovereign's consort.Act against (something) in order to reduce its force or neutralize it....

valentines day 2023-01-16

16 Items: The French word for love.The Italian word for love.This Greek goddess is associated with roses and love.Watch these movies with your sweetie on a special day.The holiday has roots in this Middle Ages Roman festival.The most popular flower to give and receive on Valentine's Day.This Roman god of love is often used as a symbol for Valentine's Day....

The Ahom Dynasty 2022-10-16

10 Items: Chief of the Ahom armyAhom Dynasty's early capitalruler after Jayadwaja Singhasucceeded in Saraghat strugglewas the founder of Ahom Dynastyforced to sign a pact with Moghulscapitals establised by Ahom Dynastywas very powerful, cruel and religious bigotAhom Dynasty defeated the muslims in how many battles?...

Units 44 and 45 Part 2 2024-01-18

62 Items: votedpublicnationalby votingto be sent(color) silver(color) copper(neuter) the wood(neuter) the metal(feminine) the voteof or made of glassof or made of plastic(feminine) the revolutionwooden, of or made of wood(feminine) the (law) treatyof or made of stone or rock(neuter) the (rock) diamond(masculine) the (male) slaveof or made of metal, metallic...

POSTIES 0603 COVER 2024-05-06

6 Items: worried and anxiousSahal was born in _____.the words spoken by an actor in a filmsomeone whose job is to perform in plays and filmsThe _____ character is the main protagonist in a film.Sahal Zaman is the _____ South Asian actor to win the best new performer category at the Hong Kong Film Awards.

Debt Treatments 2025-04-29

15 Items: What must be included in the budget calculation when reporting to the credit bureau?Medical and utility collections are examples of what type of records to be reviewed?A review of this document is necessary to ensure the NDI analysis includes all debts.If the customer is a renter, what amount must be entered into the monthly rent field?...

Skin Disorders 2026-02-06

15 Items: ItchingCrack in TissueFlat skin lesionsSkin infection from a miteHigh level of white blood cellsChronic inflammation skin disorderType of sarcoma associated with HIVOily secretion from sebaceous glandsSlightly elevated, flat, “scale”-like lesionSuperficial skin infections including ringwormDisorder in which the body lacks production of melanin...

Mishpatim 5.0 2025-02-16

15 Items: Who is “Shaul”?Mitzvot, English??Yeshua’s betrayer.To hear and respond (Hebrew)To give ear, to obey (Hebrew)Torah is _______. (Psalm 119:142)The Hebrew picture for the letter peyThe place where Joseph was sold away.This son dishonored his father, Jacob.The prophet of the Haftarah Mishpatim.To do, work, make, or accomplish (Hebrew)...

HR 3B Crossword 2025-10-15

18 Items: LawWorthRightsRightsof LawEthicalJusticeJusticeContractLibertiesof PowersGovernmentParliamentand Balancesprocess of lawresponsibilityof the GovernedJudeo-Christian

Vocabulary Word Search 2024-11-01

12 Items: How you use your hands.The emotion on your face.How fast or slow you speak.How clearly words are spoken.How high or low your voice is.The rise and fall of the voice.The levels you use in the space.The emotion in your voice, happy /sad.Raising the end of a sentence up to sound like a question....

The Lion and the Mouse 2013-10-01

15 Items: evegeneherorepaymeterelectthesebesidedemandcreatedeleteeraserpretendcompeteevening

GALAXIES AND THE UNIVERSE 2020-02-24

20 Items: MOONSTARWEIGHTGALAXYPLANETSPIRALGRAVITYCLUSTERUNIVERSEREDSHIFTLIGHTYEARSATELLITESUPERNOVAELIPTICALIRREGULARLOCALGROUPSOLARSYSTEMEDWINHUBBLEDOPPLERSHIFTCELESTIALBODY

Peter and the Wolf 2020-05-19

21 Items: CatZooDuckBirdWolfOboeRopePeterFluteHornsBrassHuntersStringsTimpaniClarinetComposerOrchestraConductorProkofievPercussionGrandfather

And the Giant Peach 2022-02-05

20 Items: newmissyorkcityjamesstatesharkoceanspiderempireauntiespongeladybugseagullsbuildingatlanticcentipedeearthwormrhinocerosgrasshopper

Julie and the Phantoms  2021-05-17

21 Items: WowLukeAlexNickJATPJukeJulieFlynnCalebReggieCarrieWillieWillexWakeupBrightDirtyCandyNowOrNeverFlyingSoloIGotTheMusicThisBandIsBackTheEdgeOfGreat

Rama and The Ramayana 2024-02-07

41 Items: bowramasitafirearmydeerlankaeagleravanajatayuordealmonkeydivinegoldenashokagardenforestvanvashanumanayodhyavalmikibharatakaikeyisugrivaagastyamarichavulturesampatidandakakausalyaindrajitlakshmanadasarathasatrughnamandodaricelestialrakshasasvibhishanakishkindhashurpanakhavishvamitra

Rahab and the Spies 2024-06-05

21 Items: godcordroofkinglandrahabspieswallsfaithhousejoshuaharlotescapesafetyjerichoscarletmissioncovenantpromisedisraelitesprotection

Jonah and the Whale 2024-06-23

26 Items: fleeshipfishdaysspitcitywormjonahstormthreeshoremercyangerplantnightsprayerpreachpeoplerepentninevehprophetsailorsswallowtarshishoverboardrepentance

Phosphorus and the Ecosystem 2024-11-16

23 Items: SoilRainPondAlgaeBloomAlgalRiverRunoffFieldsBalanceErosionSedimentLakeErieEcosystemNutrientsPollutionChemistryPhosphorusFertilizerAgricultureBiodiversityContaminationSustainability

noah and the flood 2025-03-26

20 Items: arkpigtwocudnoahboatshipcleanfloodbirdscamelsevenpairshoofsanimalsuncleangenesisvineyardvegetationcloven-footed

Antarctica and the Arctic 2025-04-22

24 Items: orcamildharshdensehardydesertfjordstundraseaiceglaciericemeltpenguinnarwhalecontinentkatabaticAntarcticapolarnightindigenouspermafrostmidnightsunArticCircleSouthernOceanamplificationclimatechange

Jesus and the leper 2025-08-29

30 Items: godmanbegsickkindlovesavejesuslepertradetouchlovedsavedpeoplebeggerpreachamazedpriestsforgivetouchedkindnessdeciplessicknessthankfulgratefulparalyzedpreachingoverjoyedforgivenessheartbroken

METH and the BODY 2025-12-31

35 Items: DETOXCRAVINGRELAPSEANXIETYRECOVERYDOPAMINEOVERDOSEDRYMOUTHHAIRLOSSWEAKNESSINSOMNIASTIMULANTADDICTIONTOLERANCESEROTONININFECTIONSKINSORESCONFUSIONPSYCHOSISBRAINBLEEDWITHDRAWALDEPRESSIONMEMORYLOSSMOODSWINGSHEARTATTACKDEHYDRATIONHEARTDISEASEMALNUTRITIONKIDNEYINJURYMUSCLEWASTINGHARMREDUCTIONHALLUCINATIONNOREPINEPHRINEDENTALDISEAESENEUROTOXICINJURY

Moses and the Plagues 2026-01-18

31 Items: NileHailLordGodsFrogsFliesBloodSoresGnatsDeathMosesAaronAngryStaffStinkPlagueIsraelRuinedLocustsPharoahSlaveryPromisePlunderDarknessWarningsMiraclesHardenedLivestockEgyptiansMagiciansDeliverance

Lion and The Gnat 2026-01-20

20 Items: webliongnatkingstuckpridespiderscaredscriptlittleroaringwinningbuzzingnarratorgreatestdefeatedexhaustedscratchedmiserablyperformance

Glaciers and the Landscape 2026-02-10

28 Items: lineloadsheettoolsarêtefjorddeformcirqueglaciercalvingmoraineterminuspluckingbasalslipregelationstillstandstriationsbergshrundglacialtillpushmorainevalleyglaciermedialmorainezoneofablationdeadicemorainelateralmoraineterminalmorainezoneofaccumulationinternaldeformation

Magnetic Field Word Search 2025-10-14

10 Items: to separate or set apart.to pull objects towards one another.to push objects away from each other.one of the two opposite ends of a magnet.to provide evidence that goes against a claim.something that can be changed and may be measured.the space around a magnet in which magnetic forces can act on objects....

6th Grade Review Words Search 2024-05-07

15 Items: FCCLA's official flowerWhat the F in FCCLA stands for.One of FCCLA's colors that starts with a W.An element of design where something is repeated.A kitchen tool used to flip pancakes or turn hamburgers.A principle of design that is the focal point of a room.A kitchen tool used to beat eggs and add air to mixtures....

Dr. Seuss's Green Eggs & Ham (advanced) 2025-07-24

39 Items: andareboxcareatfoxhamletmaynotsamsayseethetryyouboatdarkeggsgoatgoodherelikerainthatthemtheytreewillwithcouldgreenhousemousethanktheretrainwouldanywhere

Assignment by Magical_Girl 2024-05-16

7 Items: romancatholicchurchThe capital of the Byzantine Empire.The center of learning during the Mali Empire.Medieval Europe had a ____________ government.The largest civilization in West Africa that lasted from 1450 to 1600.A system of economic, social, and political organization based on the medieval manor....

Summer Word Search 2024-10-09

38 Items: isittoamwebyhashistheownandarebusknowverywillmeethavetoysstartgoinghabitdiarywordseagervisitsummerfamilypackedtravelvillagewritingcousinsclothesexcitedvacationexperiencegrandparents

Barcelona word search puzzle 2025-05-25

5 Items: Where in Barcelona can you play in the sand, swim in the sea, and enjoy the sun?What tasty Spanish dish is made with rice, seafood or chicken, and colorful veggies?Where can you see colorful fruit, sweets, and seafood at stalls like in La Boqueria?Which famous architect designed the colorful Park Güell and the amazing Sagrada Família?...

River key terms 2023-10-05

12 Items: A bend in the riverThe start of a riverThe point where 2 rivers meetWhere water is stored undergroundThe movement of sediment along a riverWhen water turns from a liquid to a gasThe point where the river meets the seaA place in Cornwall that flooded in 2004When large boulders are rolled along the river's bed...

🌸Bathukamma Special Word Search 🌸 2024-09-30

10 Items: A simple, lentil-based dish loved during festive timeGoddess worshipped during the festival for prosperity and well-beingAnother name for marigold, a vibrant flower essential to the festivalA significant day following Bathukamma, symbolizing the victory of good over evil...

Science 2024-05-16

15 Items: A big place full of wildlifeThey're in our galaxy far awayThe beginning of the water cycleThey come in all shapes and sizesThere are layers inside the earthFilled with living life everywhereThey're very dangerous to us humansBig chunks of ice that float aroundIt was on our planet a long time agoA super natural hazard that's dangerous...

02 2025-08-16

15 Items: a motorcycle clubs namea weapon outlaw bikers carryGroup of riders traveling together.Sewn badge showing club allegiance.Club member without a fixed chapter.Official part of the motorcycle club.Club’s symbolic jacket design and logo.A planned ride to a distant destination.Sleeveless biker vest displaying patches....

Plural Word Search 2025-11-17

14 Items: The plural of manThe plural of flyThe plural of footThe plural of cityThe plural of leafThe plural of wolfThe plural of womanThe plural of childThe plural of mouseThe plural of toothThe plural of gooseThe plural of pennyThe plural of puppyThe plural of person

Eric's awesome word search 😀 2023-12-18

9 Items: our galaxyknown as Ursa minorknown as Ursa majorwe _____ around the sunthe belief in zodiac signswe have 8 of them in our solar systema space scientist who studies stars and stuffa guy who goes into space and does experimentslarge objects that are made up of dust and ice

Evangelion 2024-07-18

7 Items: A translucent liquid used in Evangelion cockpits.The organization responsible for combating Angels.Mysterious and enigmatic pilot of Evangelion Unit-00.Mysterious beings that threaten humanity in the series.The main protagonist, a reluctant pilot of Evangelion Unit-01.Chief Operations Officer at Nerv and surrogate guardian to Shinji....

Competency Worksheet 2 2022-12-21

8 Items: Another way of saying Incompetent to Proceed.When you are charged with a crime, you are then referred to as the Defendant.A finding or answer of a jury given to the court concerning a matter submitted to their judgment.This means advocating on one's own behalf before a court rather than being represented by a lawyer....