world countries Word Searches

Unit 6: Reason & Revolution Vocabulary 2025-10-27

20 Items: Queen of France known for extravagance; executed during the Revolution.Revolutionary French document asserting equality and individual rights.French Enlightenment writer who championed freedom of speech and religion.Enlightenment thinker who advocated for separation of powers in government....

Team 3 2025-11-03

10 Items: This is a scientist. He is famous for his IQ.This is a Spanish artist. He is famous for his paintings.This is an artist and he is famous for having cut off the ear.This is a musician. He is famous for singing “juntos a la par”This is a musician. He is famous for being in the band "los piojos"....

Chapter 4 - Life In The Colonies - myWorld Social Studies 2023-01-26

21 Items: a rebelliondisagreementa societal groupshowing much varietya nation that is a military partnera formal agreement between countriesan area defined by its common featuresa person who owns property or a businessa product brought into a country to be soldresources that are used to manufacture productsa worker skilled in a trade, usually done by hand...

At this Mel Melap Camp 6, we're thrilled to welcome Premis from around the world! Are you able to find where they've come from? 2024-06-21

45 Items: agrakotaajmerdelhisikardubaitokyobelizebeawarbhopalindorejaipurkanpurmumbainagpurraipuralaskamanilajakartabandungkarachibangkokchennaijalgaonjodhpurhoustonhongkongbhilwarabilaspurvaranasiyavatmaltenerifesingaporeahmedabadbairagarhbangalorebharatpurbhataparafaridabadlaspalmasguangzhouyogyakartakualalumpurchittorgarhfuerteventura

Review 2025-04-08

1 Item: welder, ashes, surface, chance, patch, badge, taxes, advice, manager, stretch, gardener, clutch, bricklayer, judge, faucet, luggage, recess, crutches, countries, take, took, taken, sing, sang, sung, come, came, come, ring, rang, rung, bad, worse, worst, s

BIP3 U4 2025-09-26

1 Item: jungle, moon, plant, sky, star, waterfall, wave, world, bounced, caught, fished, flew, hopped, kicked, learnt, sailed, skipped, threw

Terrestrial Biome 2025-10-02

19 Items: A permanently frozen area of tundra and taigaIt is considered as the most arid terrestrial biomeGrasslands caters for the feeding habit of these animalsIt refers to the amount of water vapor present in the airIt describes the daily climatic condition in an specific areaThe type of trees that are specifically found in tropical forest...

BIP3 U4 2025-09-26

1 Item: jungle, moon, plant, sky, star, waterfall, wave, world, bounced, caught, fished, flew, hopped, kicked, learnt, sailed, skipped, threw

New Grad Residency Program Word Search 2024-04-03

11 Items: The acronym for "New Grad Registered Nurses"Term that describes the process of working as a teamType of guidance/counseling given by another fellow nurseEssential skills and abilities that every nurse should possess.Term that defines the process of going from New Grad to Professional World...

Pokemon 2023-09-13

23 Items: I am made of 108 spiritsThey can run around 150mphThis pokemon has the most headsThis professor was once a championThis pokemon is eaten as a delicacyThis pokemon is featured on currencyThe original name of this was FoxfireThis pokemon has over 4 billion variantsThis pokemon was the first one ever createdThe only champion to not have a home town is...

Gymnastics 2025-09-14

20 Items: Aerial skill performed on floor and beamSoviet gymnast known as the “Sparrow from Minsk”Uzbek gymnast who competed in eight Olympic GamesSoviet gymnast known for artistic style in the 1980sAustrian gymnast who won medals in the 1930s OlympicsChinese gymnast who won six medals at the 1984 Olympics...

Haley & Adam 2025-09-18

30 Items: Adam's favorite colorAdam's birthday monthHaley's birthday monthHaley's favorite singerAdam's favorite cuisineThe color of Haley's jeepDating app the couple met onAdam's favorite football teamHow old the couple's cats areThe couple's beloved dog's nameAdam's favorite alcoholic drinkThe month the couple got engagedThe make of the groom's race car...

united 2022-12-08

66 Items: rosesagebiomecamelbridgeantigenacologybiologybiofuelbiotechbiomassparsleyaerologyairplaneaccepterantibodybackbonebiometerbroadwaybrooklynconsumercompounddolphinscardamomlavenderaerospaceanabolismastronomyacidulantbiospherebiologistchinatownchemistryatmosphereabsolutismabsorptionantibioticabsorbancecapitalismcryospherecardiologyaerodynamic...

Our Word Search 2025-01-26

20 Items: your halloween costumeOur first winter vacationWhat I said on January 4thThe nickname I use for youThe most handsome boy everThe name of our newest playlistWe are each our favorite at this activityThe song we recently learned was about WLWThis is embroidered on your hat I made youWe went skinny dipping at this hot springs...

It starts with dirt! 2025-03-29

20 Items: What family do potatoes belong to?What color were carrots originally?Where do Poinsettias originate from?What fruit has seeds on the outside?What tree is the source for aspirin?Soil can be acidic, alkaline or what?Which grain is used to make semolina?What do Peas use to cling to supports?What flower was once more valuable than gold?...

At this Mel Melap Camp, we are thrilled to welcome Premis from across the world! Are you able to find where they have come from? 2024-06-11

43 Items: kotaagradelhiajmersikardubaitokyobelizejaipurmumbainagpurkanpurbeawarraipurindorebhopalraipuralaskamanilajakartabandungkarachibangkokchennaijalgoanhoustonhongkongbhilwaravaranasibilaspuryavatmaltenerifesingaporefaridabadahmedabadbairagarhbhataparabharatpurlaspalmasyogyakartakualalumpurchittorgarhfuerteventura

Algorithm Word Search 2023-04-06

10 Items: What is the study of meaning in language called?What is a spoken word, phrase, or sentence called?What is a group of similar data points or objects called?What is a set of step-by-step instructions for solving a problem or performing a task called?What is a system of communication used by humans, including spoken, written, and sign, called?...

Spelling & Vocabulary Wk. 9 2025-10-07

10 Items: obtain in exchange for paymenta spherical or rounded object; the Earthan unexpected or astonishing event, fact, or thing.the measurement or extent of something from end to endput an end to the existence of (something) by damaging or attacking it.the number equivalent to the product of ten and ten; ten more than ninety; 100....

Natural Selection Word Search 2025-07-18

10 Items: The ability of all owls to see at night is an ____.Only organisms that ____ pass on their genes to another generation.An animals ____ determines which adaptations are helpful and which are harmful.An example of ____ is that both zebras and antelopes eat the same grasses and plants....

Ham Radio 2024-07-12

20 Items: High power operation, typically more than 100 watts.A device used to transmit and receive radio signals.Extremely low power operation, typically less than 1 watt.A contact or conversation between two amateur radio operators.A combined transmitter and receiver unit used for two-way communication....

International Business Etiquette 2 2024-09-05

22 Items: Avoid ___________________ and high pressure talk.Do not ___________________ touch your Chinese colleagues.As of 2008, Germany was global leader in ___________________.Most business meetings are conducted over ___________________.___________________ is the most widely spoken language in Europe....

Industrial Revolution Vocabulary 2025-03-20

22 Items: Goods are made by hand in homesProduction of items using machines.To send items to another country for saleAn official ban on trade between countriesA system of money used in a specific country.Relating to farmer and small town ways of life.Goods are mass produced in factories by machinesMaterials in nature which are used to produce a good...

Famous Hispanic Figures 2024-10-04

25 Items: Who is known as the Queen of Salsa?Who is the current Pope from Argentina?Who painted "The Persistence of Memory"?Who was the first Hispanic woman in space?Who wrote "One Hundred Years of Solitude"?Who was a famous Cuban-American salsa singer?Who is the first Hispanic mayor of Los Angeles?Who was the first Hispanic Supreme Court Justice?...

Battle of the Somme 2025-10-28

21 Items: – The country where the Somme River flows– The country where the Somme River flows– The year when the Battle of the Somme began– The group of nations fighting against Germany– What the battle helped Canada build as a nationWar – What the Somme came to symbolize in history– The new type of weapon first used in this battle...

Adoration, Word Search 2024-02-13

25 Items: a in acts 1c in acts 2t in acts 3s in acts 41st in 7 sacraments 82nd in 7 sacraments 93rd in 7 sacraments 104th in 7 sacraments 115th in 7 sacraments 126th in 7 sacraments 137th in 7 sacraments 14latin of Our Father 17communication with go 5tagalog of Our Father 18is an "action" of the whole Christ 151 of the 3 mysteries of faith starts with 7...

Gymnastics 2025-09-14

20 Items: Aerial skill performed on floor and beamSoviet gymnast known as the “Sparrow from Minsk”Uzbek gymnast who competed in eight Olympic GamesSoviet gymnast known for artistic style in the 1980sAustrian gymnast who won medals in the 1930s OlympicsChinese gymnast who won six medals at the 1984 Olympics...

science 2025-03-03

16 Items: the worldthe earth; and the atmosphereevaporation the change of state from a liquid to a gascondensation the change of state from a gas to a liquidprecipitation any form of water that falls to Earth's surfacewind the movement of air caused by differences in air pressurerivers, and return to the atmosphere by evaporation and transpiration....

Literary Genres Review 2024-11-07

20 Items: tale´s openerfirst tale collectorsLittle Red Riding Hood author"slow and steady wins the race"the author of "Pride and Prejudice"All tales share the rule of three and...French fabulist who was inspired by Aesop"The Adventures of Huckleberry Finn” authorThe Ugly Duckling was written for this authora story about human events or actions not proven...

Famous Writers: One-Word Riddles 2025-06-14

28 Items: Created robot laws that are more ethical than most human laws.Created a teenager so annoying that adults still quote him decades later.Chronicled suburban despair so perfectly that it became a literary genre.Made war seem absurd by adding aliens and the phrase "so it goes" to everything....

Globalization 2025-08-05

1 Item: Tariff, Economic, united nations, Cultural, Transportation, immigration, import , export, world bank, liberalization, international, business, company, urbanization , communication, trends, Market , supply, technology

Movie Title Word Search 2025-10-08

10 Items: Count Orlok's alias.Your favorite 90's ghost (animated).Toni Collette was robbed of an Oscar for the crying in this film alone.Brillant young women who is looking for a companion to face this cold cruel world.Fantasy story that involves a girl named Sarah, a Goblin King and a kidnapped baby brother....

Unit 4 Review 2025-02-06

18 Items: way of Romanizing the Chinese wordsthe Latin spoken by the common peoplearticulator engaged to nasalize a soundsounds made without the use of the lungssound made with little obstruction of airthe forcing of air through the nasal cavitywhat the letter "h" is on French and Spanishlangauge family to which French and Spanish belong...

The Best In The World Pack (2019) 2025-12-10

2 Items: OMERTAMONEYINTHEGRAVE

dandys world characters 2025-12-01

1 Item: Bassie, Blot, Bobette, Boxten, Brightney, Brusha, Coal, Cocoa, Connie, Cosmo, Dandy, Dyle, Eclipse, Eggson, Finn, Flutter, Flyte, Gigi, Glisten, Ginger, Goob, Gourdy, Looey, Pebble, Poppy, Razzle & Dazzle, Ribecca, Rodger, Rudie, Scraps, Shelly, Shrimpo,

Giahna's world search 2024-11-25

1 Item: Goal,Degree,Promotion, Apprenticeship, Collaborate, Policy,Mentorship,Job, Career, Shadowing, Service Learning,Creativity,Innovation, Initiative, Work Ethic,

World Water Day 2025-12-04

1 Item: princess, save, water, pollution, shower, clean, health, drink, wash, clothes, grab, pot, lake, river, ocean, Africa, earth, planet, well

Jesus Loves You 2024-10-04

1 Item: God so loved the world that he gave his only Son that whoever believes in him should not perish but have eternal life.

winter fun 2022-11-30

20 Items: Achieve top speeds down the dill!Blow it up and zip down the hill!Gather up the kindling and keep warm!Cannonball into the near frozen water!It's cold out there, so be sure to do this!Build this friend out of fresh packing snow!Built with hard work and bricks made of snow!Footwear that lets you walk on top of the snow!...

Word Search 2025-01-08

30 Items: Related to the sunThe planet we live onEarth’s natural satelliteA being from another worldThe sky above us after sunsetThe closest planet to the sunA ball of glowing gas in spaceA large object orbiting a starThe start of a rocket’s flightAn object that orbits a planetThe fourth planet from the sunA vehicle used for space travel...

Tennis 2025-09-14

20 Items: Serbian star who first won Wimbledon in 2011German legend who won the Golden Slam in 1988American who won 109 ATP titles in his careerCroatian who won Wimbledon in 2001 as a wildcardSwiss player who won 20 Grand Slam singles titlesThe only man to win the calendar Grand Slam twiceBritish player who won Wimbledon in 2013 and 2016...

Unit III: Classical Civilizations Review 2025-11-03

27 Items: "Follow the rules.""Follow your heart.""Life is suffering."Another word for "Dalit"The Hindu social hierarchy"Follow the rules or else."The oldest religion in the worldWhich came first, Maurya or Gupta?Ashoka's edicts were written on theseAnother word for the Greek city-statesChina was first unified under this dynasty...

Characters 2025-12-16

90 Items: BTEEO2SkyAsdaMarsMiniASOSNextTescoBootsArgosCo-opHeinzHovisFairyRadoxDysonThreeCurrysGreggsSubwayRibenaJaguarMullerAndrexPersilKitKatGalaxyWHSmithIcelandCadburyWalkersPG TipsBentleyFord UKEasyJetComfortTopshopWaitroseDomino’sTwiningsLucozadeVauxhallWeetabixSmartiesNew LookMorrisonsPoundlandNestlé UKKingsmillMaltesersTobleroneSuperdrugDebenhams...

Government puzzle 2025-04-21

17 Items: Leak : An intentional disclosure of something secret or privateChief of Staff: the senior staff officer of a service or command.Treaty: a formally concluded and ratified agreement between countriespolicy: a course or principle of action adopted or proposed by government...

Volleyball 2025-09-14

20 Items: A serve that lands untouched for a pointMen’s team that won the 1976 Olympic gold medalThe men’s net height in volleyball is 2.43 metersDefensive move at the net to stop an opponent’s spikeNation that dominated women’s volleyball in the 1990sCity and year where volleyball made its Olympic debutPlayer responsible for attacking the ball over the net...

Really? 2025-01-10

22 Items: What fruit is slightly radioactive?What is Cookie Monster's real name?What animal sleeps with one eye open?One in 18 people have this extra body part.What were chainsaws originally invented for?The speed of a computer mouse is measured in?What is the hashtag symbol technically called?What is the most shoplifted food in the world?...

WWI TImeline 2023-05-03

20 Items: February 21, 1916: The Battle of _____ begins.July 1, 1916: The Battle of the ______ begins.August 10, 1914: _______ ______ invades Russia.June 28, 1914: ________ _______ was assassinated.September 9, 1914: The First Battle of the _____.June 24, 1917: U.S. combat forces arrive in ______.May 23, 1915: _______ declares war on Austria-Hungary....

IBDP Language B Identities Vocabulary Word Search 2025-09-04

25 Items: Usual ways of behaving in a cultureFeeling accepted and part of a groupThe country a person legally belongs toPrinciples or beliefs that guide behaviorJudging others unfairly before knowing themA group of people born around the same timeMoving from one country or region to anotherShowing your thoughts, feelings, or identity...

winter fun 2022-11-30

20 Items: Achieve top speeds down the dill!Blow it up and zip down the hill!Gather up the kindling and keep warm!Cannonball into the near frozen water!It's cold out there, so be sure to do this!Build this friend out of fresh packing snow!Built with hard work and bricks made of snow!Footwear that lets you walk on top of the snow!...

WWI TImeline 2023-05-02

20 Items: February 21, 1916: The Battle of _____ begins.July 1, 1916: The Battle of the ______ begins.August 10, 1914: _______ ______ invades Russia.June 28, 1914: ________ _______ was assassinated.September 9, 1914: The First Battle of the _____.June 24, 1917: U.S. combat forces arrive in ______.May 23, 1915: _______ declares war on Austria-Hungary....

Space Adventure 2025-07-09

25 Items: — People live on me.— I am a red planet.— I am the opposite of day.— I have to do with the sun.— I have big rings around me.— I carry astronauts to space.— You use me to look at stars.— I’m when a rocket takes off.— I am everything beyond Earth.— I fly around a planet or the sun.— I help you see. The sun gives me.— I pull things down to the ground....

Ice Hockey 2025-09-14

21 Items: TennisSerbian star who first won Wimbledon in 2011German legend who won the Golden Slam in 1988American who won 109 ATP titles in his careerCroatian who won Wimbledon in 2001 as a wildcardSwiss player who won 20 Grand Slam singles titlesThe only man to win the calendar Grand Slam twiceBritish player who won Wimbledon in 2013 and 2016...

Miketz 2025-12-21

26 Items: “I give them ________ life!”Joseph is given _____ as a wife.His second son is named ______ .Joseph’s first son is called ______ .Pharaoh sees G~D’s _________ in Joseph.The whole world came to _____ for food.Joseph tells Pharaoh to appoint _______.Pharaoh puts his _____ _____ on Joseph.The seven years of famine were ______ ....

Types of Plastics & Their Uses 2022-06-05

10 Items: Acrylic, which is strong and transparent, is commonly used as a substitute for _____.Polystyrene, otherwise known as _____, is commonly used to make disposable takeaway boxes.Polyethylene, which is commonly extracted from natural _____, is used to make plastic bags....

Gilbamesh 2023-07-29

10 Items: The gods create _____, a wild man, to humble him.The story highlights themes of friendship, _____ , and the search for meaning.Utnapishtim recounts the flood story but denies _____ the gift of eternal life.They succeed but incur the wrath of the goddess _____, leading to tragic consequences....

Lesson 13 2023-11-15

6 Items: I will study for at least one hour every day before dinner is an example ofA type of rule governed behavior that is under control of socially-mediated consequenceWhen cooking, you might follow a recipe that tells you to preheat the oven to a certain temperature is an example of...

Mesopotamian myth 2022-12-14

15 Items: The god of the moon (Sumerian).The Sumerian goddess of fertility.She was goddess of love and war (Assyrian).The god of air, wind, and storms (Sumerian).The Sumerian goddess of fermenting, brewing, and ale.The Sumerian mother goddess of mountains and nurturing.The goddess of the sea; drawn as a huge dragon (Babylonian)....

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

Unit 2: Political Science Vocabulary 2025-09-08

15 Items: a formally concluded and ratified agreement between countries.a system of government in which priests rule in the name of God or a god.a form of government with a monarch (king or queen) at the head; one leader.the action or manner of controlling or regulating a nation, organization, or people....

A Series of Unfortunate Events. When you drive away in secret, you'll be a volunteer, so don't scream when we take you, the world is quiet here. - VFD 2025-10-20

146 Items: PoeIkeKitSirVFDEyeBabsEsméPhilHugoSunnyKlausEdgarFrankDeweyFionaLionsKevinPianoVioletArthurDuncanGregorLemonyErnestJeromeHectorEaglesIslandQuigleyIsadoraJacquesSnicketFernaldShirleyGuntherIshmaelSqualorCharlesFortuneHarpoonBaldManColetteBeatriceBertrandEleanoraQuagmireStephanoSpyglassQueequegMrs.BassLookAwayNurseFloCountOlafJosephineAnwhistle...

Public Health Literacy Word Search Puzzle 2025-03-25

25 Items: Actions taken to avoid the onset or spread of disease.An epidemic that spreads across countries or continents.A state of complete physical, mental, and social well-being.The process of being admitted to a hospital for medical care.The body’s ability to resist disease-causing organisms or toxins....

Amazon Rainforest Word Search 2025-09-04

15 Items: The color of adult Amazon river dolphins.A fruit similar to a banana, often served fried.A constricting snake native to the Amazon rainforest.The larvae of this insect burrow into a mammal's skin.The primary method that jaguars use to secure their prey.What several animals in the jungle visit a clay lick to find....

Word Search 2024-09-14

1 Item: School, Aaron, Philippines, September, Albert Einstein, Wednesday, Tagalog, Nile River, World Health Organization, Paris, Titanic,FBI, Pacific Ocean, Coca-cola, Monday, December, Starbucks, Dr. Jose Rizal

Modules 2 & 3 Review 2025-02-06

11 Items: Domain in which motor skills are included.These are detailed, objective, and accurate.Can be informal, formal, and can track benchmarks.Domain in which language and literacy are included.Domain referring to a child's ability to think & reason.Domain in which children develop autonomy or independence....

Harry potter 2024-12-21

140 Items: NoxAccioAurorDobbyLumosMoonySeersBezoarCrucioFluffyHealerHedwigHowlerKeeperNaginiSquibsAnimagiBeatersChasersGoblinsImperioLeviosaMad-EyeMugglesProtegoQuaffleRefereeSeekersStupefyBasiliskBludgersBoggartsHogwartsPensieveUnicornsVampiresWormtailAlohomoraChristmasDark-LordDementorsHalloweenHogsmeadeHorcruxesMerpeopleMudbloodsMuffliatoObliviatePhoenixes...

Maus Wordsearch 2025-05-15

20 Items: – The unified armed forces of Nazi Germany.– An organized massacre, especially of Jews.– The official secret police of Nazi Germany.– Yiddish term meaning "crazy" or "senseless."– Practical; concerned with the facts at hand.Mitzvah – A Jewish coming-of-age ceremony for boys.– A small house or cottage, usually single-storied....

TEXAS'S COMPLICITY IN GENOCIDE 2025-12-04

27 Items: Popular name for San AntonioFounder of Cornerstone ChurchThe real name of SATX's sister cityFormer mayor who visited Israel in 2017County commissioner who visited Israel in 2025Amount of tax dollars sent from Texas to IsraelFormer mayor who visited occupied Jerusalem in 2011Refunds for energy spending that HOLT Renewables got....

American Revolution Review 2025-11-20

17 Items: Where did the tea party take place?What were the colonists fighting for?The number of people killed in the Boston Massacre.What was the last Battle of the American Revolution?The number of colonies during the American Revolution.Which country formed an alliance with the colonies in 1778?What was the last name of the commander of the colonial army?...

Oculator Word Search 2024-09-26

23 Items: "Grandpa" SmedryAlcatraz's motherfather of Alcatraza Librarian defectormakes the Translator's Lenseshas the Talent of breaking thingsa literary critic for the Nalhallan Dailyare a sapient species in the Free KingdomsLeavenworth's daughter and Attica's sistereditor of Alcatraz Smedry's autobiographiesknight of Crystallia and princess of Nalhalla...

0916 Who will win 2022-09-13

13 Items: The typhoon was so _______ that it blew many trees down.We like to go ________ on the largest lake in the world.You need a _______ of gloves today because it will be very cold.It took me over seven hours to get the _______ to this math problem.Have a ________ during break time, so you will feel well for the next class....

Beeple: Tales from A Synthetic Future Exhibition Wordsearch 2024-12-01

15 Items: A word for digital currency. Answer: Cryptocurrency.Alias of the digital artist of the exhibition. Answer: BeepleThe real name of the digital artist. Answer: Mike Winkelmann.The title of Beeple's first kinetic sculpture. Answer: Human One.Name of the digital asset on display in the form of digital art. Answer: NFT....

Ancient Greece Timeline 2023-01-25

15 Items: academy 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

Ancient Greece Timeline 2023-01-25

15 Items: 386 BCE: Plato establishes this school.776 BCE: The first of these takes place to honor Zeus.431 BCE: These wars, between Athens and Sparta, begin.432 BCE: This temple to the goddess Athena was completed.323 BCE: This period begins after the death of Alexander the Great.490 BCE: The Greeks battle this Middle Eastern group for independence....

world cuntreis and capitals 2025-12-02

1 Item: lietuva austria germany france austrailia japan yayjapan latvija estija usa canada brazil ryga talin tokoy aisia afrika amerikas europ 67

Tough Word Search 2025-11-01

250 Items: TVupusvswetoytrytwouseviawarwaywetwhowhywinyesyetyoutourtowntreetriptruetubeturntwintypeuglyunituponurgeuseduservaryvastveryviewvotewagewaitwakewalkwallwantwarmwarnwashwaveweakwearweekwellwestwhatwhenwhomwidewifewildwillwindwinewingwipewirewisewishwithwoodwordworkwrapyardyeahyearyellyourtoughtowertracetracktradetrailtraintreattrendtrialtribetrick...

FLAVOURS OF THE WORLD 2022-10-24

1 Item: portugal, lays, periperiprawn, garlicbaguette

world cuntreis and capitals 2025-12-02

1 Item: lietuva austria germany france austrailia japan yayjapan latvija estija usa canada brazil ryga talin tokoy aisia afrika amerikas europ 67

Norse Cosmology 2022-07-25

12 Items: The Realm of the Aesir is _____.The Realm of the Giants is _____.The realm of human beings is _______.Norse cosmology divided the universe into ____ realms.Bestla gave birth to the first of the gods: ____, Vili, and Ve.Odin's famous hall of _______, where his throne may have been located, is in Asgard....

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

Pontiuspilate Word Search 2025-11-06

26 Items: Jewish “Churches”.Celtic / Scottish peopleAnother name for March 15 in 44BC.Battle where Carthage gave up Spain.Asian Kingdom Rome acquired in 133 BC.Person executed in the middle of March.Greek translation of the Old Testament.Punic War where Rome annihilated Carthage.Who was warned “Beware the Ides of March!”...

jan edition word search 2025-12-14

20 Items: The planet 55 Cancri is made up of…First asian to receive a nobel prize in physicsThe process through which your brain eats itselfFounder of the Indian Space Research OrganisationTiny particles of pollutants suspended in the airAn amphibian that vomits out its stomach and cleans itThe brains of this creature holds the key to smarter AI...

Puzzle World Football Quiz 2023-05-10

1 Item: modric

wonderful world of science 2025-08-05

1 Item: EXPLORE, DISCOVER, OBSERVE, EXPERIMENT, IDEAS, ENVIRONMENT, LIFE, PROBLEM SOLVING, SCIENTIFIC METHOD, WATER, INQUIRY , UNIVERSE, WONDER, PLANET.

US Landmarks and Symbols 2025-03-20

1 Item: House US Capitol, Washington Monument, Thomas Jefferson Monument, Lincoln Memorial, World Trade Center, Statue of Liberty, Getaway Arch, Alamo, Mount Rushmore, Hoover Dam, Golden Gate Bridge, Space Needle, Liberty Bell

Module 3 Worksheet 3 ESL 2025-11-18

1 Item: Essential Start Stability Notice Inches Receive Surroundings Smart Sell Real-world Stress Partner Design Obstacles Set Holder Magic Stable Document Unique Module Items Microphones Identified Formatting Mean Fill Movement Freestanding

world cuntreis and capitals 2025-12-02

1 Item: lietuva austria germany france austrailia japan yayjapan latvija estija usa canada brazil ryga talin tokoy aisia afrika amerikas europ 67

7.The 1950s were a time of unprecedented economic growth and prosperity in the United States, as the country emerged as a global superpower in the wake of World War II. 2023-03-04

20 Items: boomlevittownmassmediatelevisionconformityadvertisingmiddleclassgenderrolesmccarthyismunionizationbluecollarjobssuburbanizationpostwaroptimismnewtechnologiesconsumerculturewhitecollarjobstheamericandreaminterstatehighwaystheaffluentsocietycivilrightsmovement

Delaneys bachelorette 2023-06-29

1 Item: Camilo, Delaney, London, Bentley, Mackinac, wedding, track, basil boys, Columbia, Starbucks, 2018trackmeet, anniversary cruise, Disney world, bear lake, bride, bridesmaids, white fox, cookouts, track meets, firsthouse, Miami, umich, b1gten, nelinails, Si

Unit 2 EXPLORING ETHICAL ISSUES RELATED TO COMPUTERS AND COMPUTER SYSTEMS 2022-09-21

1 Item: World Wide Web, Website, Web pages, Online, Informational website, Corporate website, Inappropriate material, Search Engine, Keywords, Results page, Efficient search, Boolean search, Search strategies, Research questions, Extract, Online rules, Digital me

APHUG Unit 5 test review 2024-01-31

21 Items: farmingUses many inputsHaving enough to sellCanada and the Western USthe minimum amount to sustain lifeplantation farming found in this type of climatediseases like malaria and small pox traveled from ____ to _____water contamination and depletion is a _ of the Green Revolutionuse of little labor and capital to increase agricultural productivity...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

WyWy and Magpie Wordsearch 2025-03-21

40 Items: I __ youSingle/Flowerambient albumBoy roommate!!Girl roommate!!Cute world bear!Cute world bear!Vegan Jewish deliBlack, green, chaiPolish cats kissingResident feline divaSexy one or short one?Lead singer of the 1975___ BF, Edward Abbey GFMary Oliver BF, ____ GFSubject of a jobstopperMaggie is NOT one of theseThe thirty-year old virgin...

The Word Search 2025-04-15

250 Items: aIbeoftoinheitasonatbywedoorifnosoupgotheandnewhowtoofornotsheseeusegetanyoldyoubutonenowmayallsaywhocandaywaymanoutownofffewaskputwaryetendletbigboywhytrypayhavethanintoonlyyearsometakegoodeachfeelseemhighthattheywithcomeknowlikethenveryhandlifetellthisfromworksuchgiveovermostevenfindhereshowBothneedmeancallwillmakewhenmorealsomanymustlookbacklast...

APUSH 2001-2025 2025-04-28

22 Items: The company that launched AWSThe company behind the Starship programA popular virtual assistant launched by AmazonGlobal wireless internet connectivity between devicesA voice-activated virtual assistant developed by AppleComputers or machines are made to think and act like humansThe increasing ease with which one can connect to the internet...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Unit 3.2 2025-11-23

29 Items: a religious buildingcausing great sadnesstogether to meet sociallyfree from outside controlto organize or have an eventa fight between armies in a wara planned public or social occasiona place where dead people are buriedout to remove something from a placea period of heavy rain in parts of Asiathe time in your life when you are a child...

Sherlock Holmes 2025-12-16

1 Item: incomplete, thief, supernatural, bath, sewers, neck, world, arrest, pursued, warrant, sentenced, tomb, rope, target, magic, symbol, trickery, murder, parliament, device, war, window, diversion, employer, trigger, shoot, fail, society, five, case, request,

EV3 Robotics Vocabulary 2023-05-09

16 Items: to take apart.provide linear mobility for a robot.detects rotational motion on a single axis.any command or group of commands in a program.to build by putting parts together; to build; to create.specific areas for connecting sensors and motors to the EV3.the primary source of physical motion in the Mindstorms EV3system....

Vocabulary unit 11 2025-05-19

18 Items: A mark indicating the quality of a student's work.The grounds and buildings of a university or college.A college or university student who's not a graduate student.A first-year student at a university, college, or high school.Based on or characterized by the methods and principles of science....

Nerdy Birdy Tweets 2025-10-08

15 Items: Clue: What you do when you want to see someone's posts on social media.Clue: What you do when you want to stop someone from contacting you online.Clue: The platform where Nerdy Birdy shares his thoughts with his followers.Clue: A bird who seems to enjoy picking on Nerdy Birdy, causing trouble online....