weather Word Searches

Women Clothing and Accessories 2023-08-30

30 Items: Tells timeUndergarmentIntimate wearHead coveringSheer legwearDenim trousersHair accessoryCasual footwearFor cold weatherFor pierced earsKeeps hands warmOne-piece outfitStretchy and snugButton-up sweaterOpen-toed footwearWorn on the fingerElevates your heightWorn around the neckAdds flair and warmthWorn around the wristHolds money and cards...

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

How's the Weather 2 2025-01-22

2 Items: hiking icy brisk blistering cold thunder and lightning storms storm clouds rainstorm heat wavetomorrow yesterday this weekend next week sunny sun shining wind blowing clouds rolling in rain falling snowing sleet freezing rain slippery stormy foggy overcast cloudy partly cloudy clear bright hot humid scorching hot warm beautiful breezy cool gloomy

Dress-Up Time Crossword 2025-09-09

20 Items: – Covers the head.– Cover the hands.– Worn on your feet.– Pants made of denim.– Clothing for your legs.– A casual hat with a brim.– Helps keep pants in place.– Clothes you wear to sleep.– Outerwear to keep you warm.– Knitted top for cold weather.– Soft cloth worn inside shoes.– Long outer garment for warmth.– Worn around the neck in winter....

Unit 7-9 vocabulary word search 2026-02-06

30 Items: shyvery oldto travelto uncoverto succeedshort in timevery pleasinggreat respectto make upsetto move alongeasily brokento think aboutto make a holelacking couragenot often foundto keep away fromto make a commenta common practiceto hold on firmlythe usual weatherto carry out a taskhaving a smart mindto try for somethingan automatic response...

Science and Social Studies Word Search 2026-05-01

116 Items: DryMassHeatCoalColdWarmWindMassSailRoseRomeEpicNileSpeedSolarFuelsEarthReefsPolesChainCycleGaugeDomesNomadEgyptIndiaChinaForumEnergyMiningTundraMarineForestDesertInlandStreamArchesEmpireIsraelGreeceTigrisKineticElasticNuclearPrairieEquatorClimateCoastalCoastalWeatherLeewardCurrentPyramidDynastySocietyJudaismAquaductTropicalSavannahLatitudeMoisture...

Word search 2025-08-19

12 Items: The day after today.It is 12 o’clock at nightThe first month of the year.Saturday and Sunday together.The time we live in, the present.It is 12 o’clock in the afternoon.The month that comes after October.The season when leaves fall from the treesA word we use to ask about the time of something....

Science 2025-12-12

132 Items: ioncellpupagenepreytidestarmassatomacidbaseorganxylemlarvanymphbiometaigacrustfaultozonefrontphasesolarlunarcometalloytissuephloempollenembryotundradesertnektonmantlefossilgalaxymatterweightvolumespeciesmimicrybenthosestuaryvolcanotsunamierosionglaciermeandermineraligneousweathertornadoclimategravityinertiaeclipsedensityelementnucleusmixtureproduct...

Acidification Word Search 2026-05-27

129 Items: SmogWindZeroZincZoneEarthFaunaFloraOceanOzoneReuseSolarToxicToxinTrashWasteWaterWorldXenonBiogasBottleCarbonChangeEnergyForestFossilFutureGlobalLitterMarineNatureOxygenPlanetReduceSewageAerosolBiomassClimateCommuteCompostConsumeDroughtEcologyErosionGarbageGlacierHabitatHarvestLeakageLoggingOrganicPlasticProtectRecycleSpeciesThermalTurbineWarming...

Weather 2023-06-24

1 Item: competition, hill, wildlife, storm forecast, rotating storm, tropical cyclone, typhoon, hurricane, world meteorological organization, spin

WORD SEARCH - ABDUL's JOURNEY 2025-11-05

14 Items: Not sure what will happenSpoke very softly or quietlyTo go from one place to another.The people closest to you at home.A place where children go to learn.A long trip from one place to anotherA safe place to stay or get protectionFilled with many people; not much spaceCaring actions that help or comfort someone...

Sweater Word Search 2025-06-22

12 Items: A light coat for fall daysSomething you wear on your headSoft things that go on your feetLong clothes that cover your legsA warm shirt you wear in cool weatherShoes you wear when it's wet or muddyWarm hand covers with no finger holesA thick layer to keep you warm outsideA part of a jacket that covers your head...

Out of the Dust 2024-05-09

10 Items: the body of a dead animalrequired or bound by a promiseto become painful and inflamedto twist your body from side to side as in painthe upper layer of soil that is made up of grassto give up or leave something or someone entirelyto wait for the right time before you do somethinga show in a theater that includes funny songs, etc....

list 3 and 4 2025-10-01

10 Items: Depressingly gloomy.Not able to be separated.The area around a certain placeDangerously low body temperature.To get thinner or narrower at one end.Extremely great in amount, size, or intensity.A person who studies and predicts the weather.Something that is very ugly and unpleasant to look at, like a messy old building....

vocab list 3 and 4 2025-10-01

10 Items: Depressingly gloomy.Not able to be separated.The area around a certain placeDangerously low body temperature.To get thinner or narrower at one end.Extremely great in amount, size, or intensity.A person who studies and predicts the weather.Something that is very ugly and unpleasant to look at, like a messy old building....

PYL3 - Unit 10 - Reading 2026-01-07

16 Items: With a lot of sun. (Nắng)With a lot of rain. (Mưa)With very low heat. (Lạnh)With very high heat. (Nóng)Start something new. (Ra mắt)Find something new. (Khám phá)With a lot of wind. (Gió nhiều)A planned piece of work. (Dự án)With strong wind and rain. (Bão)The level of heat or cold. (Nhiệt độ)Put a file on the internet. (Tải lên)...

36 2025-08-17

15 Items: Popular Mexico route.Ride across U.S. borders.Road linked to outlaw clubs.Classic American biker music.States with strong biker clubs.Worn on vests to show club affiliationThe symbol representing a motorcycle clubPatch sewn on the sleeve of a biker’s jacketLarge patches displayed on the back of a vestSmaller patch worn on the front of a club vest...

Climate Change 2023-04-29

1 Item: oxygen weather climate season

Climate Word Search 2026-06-24

11 Items: The long-term pattern of weather in a place.Someone who helps others without being paid.Doing something to make a positive difference.Food scraps and yard waste that turn into rich soil.Tall plants that provide shade, oxygen, and habitats.The ability to recover after challenges or difficulties....

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

Human Impact Vocabulary 2025-05-19

15 Items: Reusing materialsWhere animals liveA stock of materialsNo longer exists, dies outHumans clear trees to build housesVariety of habitats and ecosystemsPrevention of wasteful use of a resourceProduction and disharge of gas or radiationDeplete the stock of fish in a body of waterWeather conditions over a long period of time...

Clothes 2026-06-16

15 Items: footwear for everyday usesomething you wear on your headclothes people wear when sleepinglight casual top with short sleeveswarm clothing worn over other clothescasual trousers usually made from denimsports footwear for running and exercisefootwear that covers your feet and ankleslong piece of fabric worn around the neck...

Geography: Physical and Cultural Characteristics 2026-06-08

8 Items: the normal weather of an areaa tool that shows where things arethe special things that a group of people sharesa large area of land or space that shares special featuresthe natural features of the Earth that make a place Uniquea large, natural stream of freshwater that flows over land...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

37 2025-08-17

15 Items: Classic biker bar game.Common bar music player.Popular biker TV series.Major outlaw biker club.Angels Famous outlaw motorcycle club.Outlaw club with international chaptersA tool used to start a motorcycle’s engineA route plan for a group motorcycle journeyThe patch worn on the front of a biker’s vestA social event often held at biker gatherings...

Lifeguard Word Search 2025-05-17

20 Items: A small insect that bitesWatches swimmers for safetyKeeps drinks and snacks coldA cold sour-sweet summer drinkPaddling a small boat on waterBoat that moves using the windSport often played on the beachA hanging bed tied between treesProtect your eyes while swimmingStaying healthy by drinking waterPlace where people sleep in tents...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

POSTIES 0421 COVER 2025-03-18

6 Items: to turn round and round quicklyGeothermal energy is heat from inside the _____.The energy obtained from sunlight is known as _____ energyThe _____ affects how well solar panels and wind turbines work.a hard black mineral that is found below the ground and burnt to produce heat...

POSTIES 0115 COVER 2023-12-15

6 Items: how hot or cold something isa place that protects you from bad weather or dangerheat, energy, etc. that is sent out in the form of raysa substance that consists of very small fine grains of rockcausing damage or injury to someone, especially to their health...

shopping et boissons 2026-01-23

14 Items: an aged fruit drinkan item worn in snowy weathera jewlery item worn on the necka jewlery item worn on the wrista dairy item that comes from cowsa top worn under sweaters and coatsa sugary drink commonly made of fruita clear drink with 0 sugar zero caloriesan cloth item used to keep your feet warma firm dairy product that eaten as a snack...

Troposphere Word Search 2026-03-03

14 Items: Causes windsThe layer where weather occursHeat moving through empty spaceHeat moving through direct contactCaused by differences in air pressureThe layer that contains the ozone layerThe least dense layer of the atmosphereHeat moving through fluids(air or water)Air over cool land moves towards warm waterAir over cool water moves towards warm land...

Voca 6000 Lesson 13 & 14 Review 2026-04-27

14 Items: to cause pain or harm topersonal and not to be sharednot held back in any way; freehappening in the very near past"The sky looks ( ) today."having to do with all the people in a communitysuitcases and bags for carrying one's things on trips"Our house was destroyed in the ( )."...

CompTia ITF 2023-02-03

12 Items: How to treat people.Number system based on 8.Connects devices to Wi-Fi.Connects home to network ethernet.Company that created the ITF exam.Number system based on 2 numbers 0 and 1.Image that doesn't lose quality when resized.Number system based on 10 numbers and 6 letters.Type of internet that may be disrupted by weather....

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

Snow Word Search 2025-11-01

10 Items: - A small vehicle used to slide on snow.- Frozen water that is hard and slippery.- A thick piece of clothing worn to keep warm.- The low temperature that makes you feel chilly.- A long cloth worn around the neck to stay warm.- When something turns to ice because of the cold.- Clothing for your hands to protect them from the cold....

BRANDS 2026-01-15

10 Items: an item that shows wealth, success, or popularity.the act of creating new ideas or improving products.something that represents an idea, place, or feeling.the process of growing and selling products in new places.activities used to promote and sell a product to customers.open shoes that are easy to wear, especially in hot weather....

Spring Word Search 2025-12-15

10 Items: - a colorful plant that blooms in spring.- when a flower opens and shows its petals.- an animal that sings and builds nests in spring.- the bright light in the sky that makes days warm.- a small insect that visits flowers and makes honey.- water that falls from the sky and helps plants grow.- a round object laid by birds, often seen at spring time....

March 2026 Wordsearch 2026-02-18

20 Items: a light gentle windthe state of floweringa brief period of rainmoderate heat in the airdirect light from the sunto begin growing from a seeda colored segment of a flowera new shoot growing from a seeda field of grass and wildflowerssweet liquid produced by flowersprecipitation in the form of raina plant embryo capable of growing...

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

SHAMMY CREATION 2025-11-17

150 Items: GOLDCOZYMYDADFANCYOCEANSILLYGOOFYFUNNYBEACHBLUEYBINGOSILKYHONEYJESUSWASABISHAMMYDRAGONDISNEYSHARKSWICKEDMOVIESMUSEUMMAKEUPTONINGGINGERTRAVELFAMILYTIKTOKUROLOGYFASHIONREADINGHOBBIESVAMPIRECOOKOUTBLANKETSHAMPOOMIRACLEBUBBLESDOGGIESROMANCEGOODINGHIGHWAYMASCARAYOUTUBEBARGAINBIOLOGYDOLLARSRADIANTBLOSSOMWORSHIPCASHIERSTYLISHFLOWERSCANDLESWEATHERPAYMENT...

CLIMATE 2026-03-31

15 Items: What does kWh stand for?What is the "flow" in a wire?What is the "pressure" in a wire?– What is "Output divided by Input"?– What is trash used for energy called?What is the average weather over 30 years?What is the goal for "Net ______" emissions?What type of sunlight is scattered by clouds?– What is decayed organic matter used for soil?...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

My Bedroom 2026-05-08

41 Items: boxartfanbagdoorwallrobemesswiregamephonetablemarkerstickerblanketchargerlightswitcha "big phone"a type of shoethings you wearopposite of darka place for trashsomething you readalso a type of shoesomething you solvesomething you sit onsomething you sleep onsomething you write onsomething you play witha basket to put laundrya light you use at night...

2025 Spelling Bee - One Bee 2025-11-06

150 Items: tagsenddecksnugfishholdmindstaydrawcozytintmilkyawntankwantpondrubywiretailbaitlureajarahoyseeproamstuckscrubbrowncrowdskirtquilttwigstaffycomfytightcandyclosegiantpastemelonslimeteethhoistmangocoralfocusbasilsatinsugarsweetfaintfruitgoatswoozylimbsaheadseñorraiseeatensharkstackleskaterbucketchancetenderfarmerparenthockeyforesthollowsearchremind...

Daddy-Long-Legs pgs. 44-48 2023-10-16

15 Items: Why was Mr. Jervis in town?What did Jervis give a box of?How does Judy feel with Jervis?Where did Judy eat with Jervis?How does the campus look in May?Who did Mr. Jervis come to visit?Where is Judy going for the summer?What is Judy working hard to become?Where did Judy and Jervis walk around?How many months will Judy be on a farm?...

1thru 10 skill 6 vocabulary 2026-04-30

77 Items: headreaddeadleadmeatfleabeadbeakbeatheathealbeamleafneateastdealeacheasydeaddeafgraphjollykneelnightnoisephotodeathmeantdreadbreadleavefeastpeachbeachreachcheapcleancreamdreamtreadneverreadysweatferretfinishgentlegingerjunglemarginripplewindowsteadyspreadhealthbreathwealthheavenbeaverweaponthreadthreatspreadmeadowBritaindolphintrafficwesternwhistle...

gothic elements and gothic words word search 2023-04-22

14 Items: a non living spirita blood sucking monstera place where the dead restbeing left on a cliff hangeran unatural thing or creatureunkowing of what will happen nexta place that people can go to praywhere the weather affects the moodan era of time known as the dark agesa building someone rich might live ina young lady often in distress in gothic books...

M2L19 - Vocabulary - 7th grade 2025-01-07

14 Items: To cause to be neutral.Not pleasant and disagreeable.To remove or separate from others.To destroy, demolish, or annihilate.Hopeless or unprotected from weather.The act, practice, or process of doing something.To be excluded or treated as being of no importance.Having to do with religion and showing great respect....

Science Word Search 2026-05-15

12 Items: the scientific study of weather.One thing that contributes to an event.A measure of how hot or cold something is.- When something stays mostly the same fromThe movement of air in a particular direction.A measure of how much water vapor is in the air.where something stays mostly the same over time....

Voca 4000 Lesson 1 2025-08-27

12 Items: felling fear (AF***D)having the taste of salt (SA***)like silver in color and luster (SIL****)to praise for some act or service (COM***D)to look at in a close, thorough way (EXA***E)causing a feeling of fear or horror (HOR***E)the usual weather conditions in a place (CLI***E)to speak about something in a few words (MEN***N)...

Biology Final in May 2026-05-19

18 Items: Frogs with gillsLong-term weatherWatson & __________Large middle layer of leafSugar made in photosynthesisPhotosynthesis cycle: Calvin-_______Plant tissue that is known as “veins”Name of membranes inside a chloroplastRibose + Phosphate group + Nitrogen baseWhat frogs eat while they’re hibernatingSugar transported in the veins of a plant...

YLC5 U6 2025-07-30

10 Items: Causing fear or making someone feel scared.To go down or reduce in amount, number, or size.The effect or influence of one thing on another.To go up or increase in level, height, or amount.Referring to traits passed from parents to children.Long-term changes in temperature or weather patterns....

Vocabulary Surge Week 5 Word Search 2026-02-23

10 Items: His facts ________ the rumors that were spreading online.The mayor stood up to ________ the start of the town festival.The lawyer chose to _______ her client’s right to remain silent.The school decided to _______ the privilege after the rules were broken.She was encouraged to _________ her thoughts clearly during the discussion....

Instructions 2026-01-14

32 Items: FastGo upHave toNot fastAfter thatAfter thatAt the endUse scissorsSave someoneIn a safe wayIn a soft wayWithout dangerLift somethingMake somethingPlace somethingMove on your feetBefore anything elseIt is a good idea toTry to find somethingPut something somewhereHold and take somewhereAttach with glue or tapeA tall plant with leaves...

SPRING 2026-03-13

165 Items: AIRBEEBUDBUGDEWDYEEGGHAYMAYNEWOAKSKYWETANTSBABYDIRTDUCKFARMFERNFROGGIFTGROWHUNTIRISJUMPKITELAMBLEAFLILYLIMEMELTNESTPINKPLUMPONDROOTROSESEEDSTEMTHAWTWIGWARMWINDYARDAPRILARBORBERRYBLOOMBLUSHBOOTSBUNNYCANDYCHICKCHIRPCLOUDDAISYEARTHFAITHFEASTFIELDFRESHGRASSGREENHATCHHONEYLILACMARCHPETALPEACHPEEPSPEONYPOPPYROBINSNAILSTORMSUGARTULIPVIVIDAZALEABASKET...

Canadian cities 2025-06-14

28 Items: - Retirement paradise where gardens bloom and wallets empty- Car manufacturing town that puts wheels on Canadian dreams- Medieval fortress city that somehow ended up in North America- Cottage country gateway where city folk pretend to be outdoorsy- The center of the universe, according to everyone who lives there...

ACT Aspire - Just the Words 2026-04-08

152 Items: DNAGasCellGenePreyMassAtomWaveDataAxisMeanModeOrganNicheTraitSolidForceSpeedFaultOrbitModelClaimTrendScaleRangeChartTissueMatterVolumeLiquidPlasmaMotionEnergyFossilMedianNucleusFoodWebHabitatDensityElementProductGravityCircuitWeatherClimateErosionIgneousVolcanoAnalyzePatternAverageOutlierDiagramProducerConsumerHeredityMutationPredatorMolecule...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

Brynn's CrossWord Puzzle 2023-05-12

24 Items: Measures the air pressure.Measures the speed of wind.Change in moisture content.The weight of the air pushing down on earth.When a boundary between two air masses stalls.A warm water current that comes from the equator.Measures the amount of precipitation that has fallen.Form when a colder air mass moves toward a warmer air....

cute words♡ 2023-10-25

160 Items: momnapskysunteacakecutedearfallhopehugslakelifelilylovepetsrainrosesandsofttoysbeachbloomblushbookscleandaisydancefreshfunnygiftsgrasshappyhearthoneyhubbyjellojollylightlunchmerrymusicoceanoreospeacequietrelaxrivershinesillysleepsmilesongsstarssweetswingtastytouchtreestruthwaterwavesyummyangelsapplesautumnbreezebrightbubblycolorscuddledreamsfamily...

2026 Dallas County Word Search 2026-04-07

160 Items: cademsbobjoedogncoiiivinhitcchdnremafireadelroambeatkarljillryonkaiajackadamabbybirdechohelpncicjailsendgoldherocalmlifeiaedpingedmspaceravecatsmouseradioperrygrassbrushsouthnorthtonyacarlahollybrianbrentgraceshoessirenbadgechiefphonedustyentryglennbreaknurserandyalarmsleephumormediclermstylerdrugsterryclerkroadstireddeputycommonpolicedawsonbouton...

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

Science words 2026-06-14

17 Items: tiny piece of mattersimplest form of matterbuilding blocks of mattera young star still forminghow far light travels in a yearthe removal of trees from foreststhe amount of matter in an objecta force that pulls objects togethera community of living and non-living thingsthe variety of life in a habitat or ecosystem...

New Year's Eve Article Word Search 2025-12-17

11 Items: What object moves down at midnight?What material is the modern ball made of?What city hosts this new year celebration?What do people often make for the new year?What type of lights does the ball use today?Where in the city does the celebration happen?What do people do together as the object moves down?...

SDG 13 - JHS 1 2025-08-17

1 Item: weather, rain, flood, hot, cold, sun, storm, wind, temperature

Voca 4000 Lesson 1 & 2 Review 2025-09-02

16 Items: to leave; go away (v)to gather together (v)to make a sign to somebody (v)not hurt or broken; healthy (adj)happening or done every day (adj)to praise for some act or service (v)causing a feeling of fear or horror (adj)to accept or regard something as true (v)the usual weather conditions in a place (n)to speak about something in a few words (v)...

Woman In Black Puzzle Quiz!!!! 2026-06-03

14 Items: The Woman in Black's sonThe name of Arthur's sonThe village Arthur stays inWho visits Arthur when he is illWhen the weather represents the moodWhat does Arthur do to understand everything?The name of the dog which protects Arthur KippsA key mode of transport used throughout the bookA gothic convention to do with the absence of others...

Winter Weather 2025-12-10

1 Item: • FROSTBITE • SNOWSTORM • AVALANCHE • WHITEOUT • WINDCHILL • FREEZING • HYPOTHERMIA • TEMPERATURE • SLEET • HAIL • ICICLES

Human-Environment Interaction Review 2025-11-12

12 Items: The removal of salt from seawaterWhen fertile land turns into a desertA resource that cannot be replaced once it's been usedThe process of collecting and moving water for farmingUsing resources in a way that protects them for the futureA resource formed in the Earth by plant and animal remains...

Words Beginning with the Prefix "anti-" 2025-08-04

18 Items: Against fighting or war.A strong feeling of dislike.Weapons made to stop airplanes.The exact opposite of something.Not liking to be with other people.Something that kills or stops bacteria.Something that cleans cuts to stop germs.When something exciting ends in a boring way.Medicine that kills bacteria making you sick....

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

List 10 2026-05-28

1 Item: weather, jargon, versatile, malleable, replenish, uncanny, tactic, stamina, scarcity, sociable

The Gothic 2025-09-30

10 Items: Dracula and FrankensteinA feeling of intense and overwhelming fear.Something unnatural that cannot be explained by science.Here we regularly find stormy, dark conditions with rain or fog.Feeling excited or anxious about something that is going to happen.Something strange and unpleasant that is linked to death and violence....

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

Unit 10: Atmospheric Science and Pollution 2024-04-25

14 Items: the ocean's pH becomes more acidicatmospheric layer in which auroras occuratmospheric layer that breaks up meteorsthin layer of gasses surrounding the Earthatmospheric layer that contains the ozone shieldheat can be reflected by gasses in our atmosphereatmospheric layer in which all weather events occur...

Aviation Terminology 2026-06-13

27 Items: Unstable airAircraft leavingCabin crews seatThe study of weatherA device that floatsDistance measured in.Area where aircraft parksPyrotechnic signaling aidUniversal time co ordinatedUndercarriage of an aircraftThe main body of an aircraftShort for General DeclarationProtective breathing equipmentStation other than base station...

Advanced Science 2023-02-28

21 Items: study of arachnidspollination by birdsWhat mammal lays eggsalloy of copper and zincwhat type of fish is albacoreAnother name for the stone ageLinseed oil comes from what plantHow many men have walked on the mooncloud at ground level is called whatthe rabbit has how many incisor teethThe fastest-running terrestrial animal...

El Hombre de Vocabulario PE 2/Quizlet 2024-09-11

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustpleaseseasonwinterspringsummerTuesdayJanuaryOctoberyou saynotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberhow manyIt's hotclassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyIt means...student deskIt's rainingIt's snowingfall, autumnstudent (male)...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Hola, ¿Qué tal? 2025-11-24

44 Items: badwellso-sopleaseGoodbyeLikewiseIt's hotvery wellexcuse mehe/she isdelightedIt's coldWhat's up?My name isIt's sunnyIt's windyI'm from...Good morningIt's rainingIt's snowingSee you laterGood afternoonYou're welcomehis/her name isSee you tomorrowHow is it going?Nice to meet youWho is he/she/it?He/She is from...and you (familiar)And you? (form.al)...

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Spooky Word Search 2024-10-31

179 Items: axebogboocatnunspywigbatsfallfearhowlmaskmistmothalienbeardbeastbloodbonesboxercandyclowncovencryptdecaydemoneerieenemyfancyfangsfoggyghoulgourdmummyouijapartypropsravenscaryskullslimesnakestaffswordtoxictrollvenomwingsafraidapplesautumncasketcharmscircuscorpsecreepycurfewghostsgoblinhorrorleavesmakeuporangeparadepeglegplaguepiratepoisonscared...

Water Word Search 2025-05-05

20 Items: A treat for summerA big boom in the sky!Something fun to jump onWhat you take in the summerWhat you feel in the summerA type of meal or gatheringA sweet and freshly productHow you get tan in the summerYour body's reaction to cool offWhat people say it looks like outsideWhen you bath in the sun it's called?A place to go when the weather is warm...

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Units 47 & 48 part 3 2024-03-15

40 Items: credit(math) minus(το) the dollar(η) the square root(ο) the (shape) cube(το) the social media(το) the figure, shape(η) the (math) algebra(ο) the (weather) wind(η) the saving, thrift,(η) the temperature, heat(η) the rain, rain shower(τα) the mathematics, math(το) the coin, physical currency(η) the value, price, worth, merit...

Geography & US Regions 2023-02-08

9 Items: The way a certain place makes moneyThe average weather in a given area over a longer period of timeA region famous for citrus fruit, alligators, jazz music, and seafoodAnything that is found in nature that can be used by humans or animalsThe act of people traveling to places outside of their usual environment...

English language devices Word Search 2023-06-25

15 Items: a naming wordwords that link to each othera word used to describe somethingan action or something that you can doa comparison using the words like or asthe repeated use of the s sound in a wordthe same starting letter for two or more wordsdescribing something as though it is an animalusing a word that sounds like the sound it makes...

summer 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Earth and Space Science 2025-05-30

10 Items: A large, slow-moving mass of ice formed from compacted snow.Any form of water falling from clouds—rain, snow, sleet, or hail.The layers of gases surrounding Earth that support life and weather.Molten rock beneath Earth's surface that can form lava when erupted.An imaginary line around which Earth rotates, causing day and night....

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Summer Wordsearch 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Environmental and Nature 2025-04-14

10 Items: CLIMATE : The long-term weather patterns in a specific area.RECYCLING : The process of converting waste into reusable materials.RENEWABLE : A resource that can be replenished naturally, like solar energy.HABITAT : The natural home or environment of an animal, plant, or other organism....