weather Word Searches

Climate- 5 words- all vocabulary words from the Kessler slides 2025-01-22

5 Items: A global decrease in temperaturesthe movement of water from one location to anotherthe envelope of gases surrounding the Earth or another planet.the weather conditions prevailing in an area in general or over a long period.a gas that contributes to the greenhouse effect by absorbing infrared radiation, e.g., carbon dioxide and chlorofluorocarbons.

How's the Weather 2 2025-01-22

2 Items: hiking icy brisk blistering cold thunder and lightning storms storm clouds rainstorm heat wavetomorrow yesterday this weekend next week sunny sun shining wind blowing clouds rolling in rain falling snowing sleet freezing rain slippery stormy foggy overcast cloudy partly cloudy clear bright hot humid scorching hot warm beautiful breezy cool gloomy

Weather 2023-11-28

1 Item: sunny, cold, snowy, hot, stormy, windy, rainy, cloudy,

weather 2025-03-05

1 Item: wet, humid, dry, arid, frigid, foggy, windy, stormy, breezy, windless, calm, still, good weather; a two-day spell of sunny weather; a spell of rainy weather; Sky: cloudy, overcast, cloudless, clear, bright, blue, gr

The Great Depression 2024-10-14

15 Items: known as the CCCknown as the SSAsevere dust stormswhen you are not employedA horrific time in historywhere investors buy and sale stocksknown as the Wall Street Crash of 1929chats created by Franklin D. Roosevelta time of low rainfall and dry weatherthe president who created the New Dealknown as the Mississippi River Flood of 1927...

23 2025-08-17

15 Items: Rules bikers live by.Serious loyalty pledge.Ink showing club loyalty.Process of proving loyalty.Common outlaw biker symbol.Seasonal ride to welcome warmer weatherTribute ride held to honor a fallen riderYearly organized motorcycle ride or eventGroup ride organized to raise funds for a causeHigh-speed motorcycle competition on a paved track...

REVIEW BEFORE EVALUATION 2026-01-05

7 Items: The study of weather and Earth’s atmosphere.full of clouds, so you can still get burned.This helps protect the skin for about 1.5 hours.usually appears a few hours after being in the sun.helps protect the skin from the sun’s ultraviolet (UV) rays.Visibility is how far and clearly we can see through the air....

Weather 2023-06-24

1 Item: competition, hill, wildlife, storm forecast, rotating storm, tropical cyclone, typhoon, hurricane, world meteorological organization, spin

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Women Clothing and Accessories 2023-08-30

30 Items: Tells timeUndergarmentIntimate wearHead coveringSheer legwearDenim trousersHair accessoryCasual footwearFor cold weatherFor pierced earsKeeps hands warmOne-piece outfitStretchy and snugButton-up sweaterOpen-toed footwearWorn on the fingerElevates your heightWorn around the neckAdds flair and warmthWorn around the wristHolds money and cards...

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

Dress-Up Time 2025-09-03

20 Items: – Warm knitted top.– Worn on the head.– Outerwear to keep warm.– Dressy shirt for women.– Clothes worn on the legs.– Cover hands to keep warm.– Casual short-sleeve shirt.– Clothes worn for sleeping.– One-piece clothing for women.– Worn on the feet inside shoes.– Clothes worn on the upper body.– Pants that end above the knees....

Merit Badges 2024-09-02

134 Items: ArtLawGolfPetsChessMusicRadioStudyHikingEnergyNatureRowingSafetySportsCookingCampingCyclingArcheryBuglingDogCareFishingGeologyPotteryReadingSkatingTextileTheaterWeatherWeldingFirstAidSwimmingAviationBasketryCanoeingClimbingDraftingForestryKayakingMedicinePaintingPlumbingRoboticsWoodworkAstronomyAthleticsBirdStudyChemistryDentistryGardeningGenealogy...

Word Search puzzle grade 6 2024-12-06

20 Items: The light from the sunA place with many treesSomeone who creates artFeeling good and strongA large stream of waterA place with many booksA place for cooking foodAn opening to see outsideA large body of saltwaterSomeone who helps you learnA meal eaten in the eveningA tool for writing or drawingThe study of the natural world...

Autumn Word Search - Over 100 words to find! 2025-10-15

137 Items: oakBarkCozyFairFallkiteknitmoonnutsowlsrainsoupstewAmberAppleAromaBalesBootsBriskBrownCiderCloveCocoaCrispCrispFlameFrostfeastgeesegravymaplemazesmistyolivepecanquiltroastrootsscarfspicestormstrawtrailtreattreestricktwigswindywoodsAcornsAutumnChillyChillyDonutsEmbersExhaleFamilygardengobblegourdshikingindigoinhalelattesleavesmarketnaturenutmeg...

Bonham Word Search 2023-12-11

17 Items: Drummer for Rush.Drummer for Nirvana.Drummer for The Beatles.Queen's dynamic drummer.Iconic drummer of Pink Floyd.Genesis drummer and solo artist.Led Zeppelin's legendary drummer.Famous for his work with The Police.Renowned for his drumming with Cream.Drummer for the Red Hot Chili Peppers.The Who's explosive and innovative drummer....

Dress-Up Time Crossword 2025-09-09

20 Items: – Covers the head.– Cover the hands.– Worn on your feet.– Pants made of denim.– Clothing for your legs.– A casual hat with a brim.– Helps keep pants in place.– Clothes you wear to sleep.– Outerwear to keep you warm.– Knitted top for cold weather.– Soft cloth worn inside shoes.– Long outer garment for warmth.– Worn around the neck in winter....

Science 2025-12-12

132 Items: ioncellpupagenepreytidestarmassatomacidbaseorganxylemlarvanymphbiometaigacrustfaultozonefrontphasesolarlunarcometalloytissuephloempollenembryotundradesertnektonmantlefossilgalaxymatterweightvolumespeciesmimicrybenthosestuaryvolcanotsunamierosionglaciermeandermineraligneousweathertornadoclimategravityinertiaeclipsedensityelementnucleusmixtureproduct...

Sweater Word Search 2025-06-22

12 Items: A light coat for fall daysSomething you wear on your headSoft things that go on your feetLong clothes that cover your legsA warm shirt you wear in cool weatherShoes you wear when it's wet or muddyWarm hand covers with no finger holesA thick layer to keep you warm outsideA part of a jacket that covers your head...

Word search 2025-08-19

12 Items: The day after today.It is 12 o’clock at nightThe first month of the year.Saturday and Sunday together.The time we live in, the present.It is 12 o’clock in the afternoon.The month that comes after October.The season when leaves fall from the treesA word we use to ask about the time of something....

WORD SEARCH - ABDUL's JOURNEY 2025-11-05

14 Items: Not sure what will happenSpoke very softly or quietlyTo go from one place to another.The people closest to you at home.A place where children go to learn.A long trip from one place to anotherA safe place to stay or get protectionFilled with many people; not much spaceCaring actions that help or comfort someone...

Out of the Dust 2024-05-09

10 Items: the body of a dead animalrequired or bound by a promiseto become painful and inflamedto twist your body from side to side as in painthe upper layer of soil that is made up of grassto give up or leave something or someone entirelyto wait for the right time before you do somethinga show in a theater that includes funny songs, etc....

list 3 and 4 2025-10-01

10 Items: Depressingly gloomy.Not able to be separated.The area around a certain placeDangerously low body temperature.To get thinner or narrower at one end.Extremely great in amount, size, or intensity.A person who studies and predicts the weather.Something that is very ugly and unpleasant to look at, like a messy old building....

vocab list 3 and 4 2025-10-01

10 Items: Depressingly gloomy.Not able to be separated.The area around a certain placeDangerously low body temperature.To get thinner or narrower at one end.Extremely great in amount, size, or intensity.A person who studies and predicts the weather.Something that is very ugly and unpleasant to look at, like a messy old building....

PYL3 - Unit 10 - Reading 2026-01-07

16 Items: With a lot of sun. (Nắng)With a lot of rain. (Mưa)With very low heat. (Lạnh)With very high heat. (Nóng)Start something new. (Ra mắt)Find something new. (Khám phá)With a lot of wind. (Gió nhiều)A planned piece of work. (Dự án)With strong wind and rain. (Bão)The level of heat or cold. (Nhiệt độ)Put a file on the internet. (Tải lên)...

Climate Change 2023-04-29

1 Item: oxygen weather climate season

36 2025-08-17

15 Items: Popular Mexico route.Ride across U.S. borders.Road linked to outlaw clubs.Classic American biker music.States with strong biker clubs.Worn on vests to show club affiliationThe symbol representing a motorcycle clubPatch sewn on the sleeve of a biker’s jacketLarge patches displayed on the back of a vestSmaller patch worn on the front of a club vest...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

Lifeguard Word Search 2025-05-17

20 Items: A small insect that bitesWatches swimmers for safetyKeeps drinks and snacks coldA cold sour-sweet summer drinkPaddling a small boat on waterBoat that moves using the windSport often played on the beachA hanging bed tied between treesProtect your eyes while swimmingStaying healthy by drinking waterPlace where people sleep in tents...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

Human Impact Vocabulary 2025-05-19

15 Items: Reusing materialsWhere animals liveA stock of materialsNo longer exists, dies outHumans clear trees to build housesVariety of habitats and ecosystemsPrevention of wasteful use of a resourceProduction and disharge of gas or radiationDeplete the stock of fish in a body of waterWeather conditions over a long period of time...

Hurricane Word Search 2023-05-25

15 Items: how fast the air is movingcausing damage to somethingwater that falls from cloudsloss of electrical power networkwinds that go further than 53 mphlargest and deepest ocean on earthdisturbance in water caused by windsfamous hurricane that happeend in 2005storms that form in the tropical oceanoverflowing amount of water on dry land...

37 2025-08-17

15 Items: Classic biker bar game.Common bar music player.Popular biker TV series.Major outlaw biker club.Angels Famous outlaw motorcycle club.Outlaw club with international chaptersA tool used to start a motorcycle’s engineA route plan for a group motorcycle journeyThe patch worn on the front of a biker’s vestA social event often held at biker gatherings...

Merit Badge Word Search 2024-05-23

138 Items: artlawgolfpetschessmusicradioenergyhikingnaturerowingsafetysportsarcherybuglingcampingcookingcyclingdogcarefishinggeologypotteryreadingskatingtextiletheaterweatherweldingaviationbasketrycanoeingclimbingdraftingfirstaidforestrykayakingpaintingplumbingroboticsswimmingwoodworkanimationastronomyathleticsbirdstudychemistrydentistrygardeninggenealogy...

POSTIES 0421 COVER 2025-03-18

6 Items: to turn round and round quicklyGeothermal energy is heat from inside the _____.The energy obtained from sunlight is known as _____ energyThe _____ affects how well solar panels and wind turbines work.a hard black mineral that is found below the ground and burnt to produce heat...

POSTIES 0115 COVER 2023-12-15

6 Items: how hot or cold something isa place that protects you from bad weather or dangerheat, energy, etc. that is sent out in the form of raysa substance that consists of very small fine grains of rockcausing damage or injury to someone, especially to their health...

shopping et boissons 2026-01-23

14 Items: an aged fruit drinkan item worn in snowy weathera jewlery item worn on the necka jewlery item worn on the wrista dairy item that comes from cowsa top worn under sweaters and coatsa sugary drink commonly made of fruita clear drink with 0 sugar zero caloriesan cloth item used to keep your feet warma firm dairy product that eaten as a snack...

CompTia ITF 2023-02-03

12 Items: How to treat people.Number system based on 8.Connects devices to Wi-Fi.Connects home to network ethernet.Company that created the ITF exam.Number system based on 2 numbers 0 and 1.Image that doesn't lose quality when resized.Number system based on 10 numbers and 6 letters.Type of internet that may be disrupted by weather....

Spring Break Word Search- Grade 5 2024-04-05

16 Items: Mr. Coughlin's baby's name.What the Easter Bunny hides.Flowers _____ in the Spring.April 1st is April _____ Day.April _____ bring May flowers.What you use to draw on a sidewalk.In Spring, trees regrow their _____.Animals that go south for the Winter.The number of days we will be on break.The temperature gets _____ in the Spring....

Snow Word Search 2025-11-01

10 Items: - A small vehicle used to slide on snow.- Frozen water that is hard and slippery.- A thick piece of clothing worn to keep warm.- The low temperature that makes you feel chilly.- A long cloth worn around the neck to stay warm.- When something turns to ice because of the cold.- Clothing for your hands to protect them from the cold....

BRANDS 2026-01-15

10 Items: an item that shows wealth, success, or popularity.the act of creating new ideas or improving products.something that represents an idea, place, or feeling.the process of growing and selling products in new places.activities used to promote and sell a product to customers.open shoes that are easy to wear, especially in hot weather....

Spring Word Search 2025-12-15

10 Items: - a colorful plant that blooms in spring.- when a flower opens and shows its petals.- an animal that sings and builds nests in spring.- the bright light in the sky that makes days warm.- a small insect that visits flowers and makes honey.- water that falls from the sky and helps plants grow.- a round object laid by birds, often seen at spring time....

2025 Spelling Bee - One Bee 2025-11-06

150 Items: tagsenddecksnugfishholdmindstaydrawcozytintmilkyawntankwantpondrubywiretailbaitlureajarahoyseeproamstuckscrubbrowncrowdskirtquilttwigstaffycomfytightcandyclosegiantpastemelonslimeteethhoistmangocoralfocusbasilsatinsugarsweetfaintfruitgoatswoozylimbsaheadseñorraiseeatensharkstackleskaterbucketchancetenderfarmerparenthockeyforesthollowsearchremind...

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

SHAMMY CREATION 2025-11-17

150 Items: GOLDCOZYMYDADFANCYOCEANSILLYGOOFYFUNNYBEACHBLUEYBINGOSILKYHONEYJESUSWASABISHAMMYDRAGONDISNEYSHARKSWICKEDMOVIESMUSEUMMAKEUPTONINGGINGERTRAVELFAMILYTIKTOKUROLOGYFASHIONREADINGHOBBIESVAMPIRECOOKOUTBLANKETSHAMPOOMIRACLEBUBBLESDOGGIESROMANCEGOODINGHIGHWAYMASCARAYOUTUBEBARGAINBIOLOGYDOLLARSRADIANTBLOSSOMWORSHIPCASHIERSTYLISHFLOWERSCANDLESWEATHERPAYMENT...

Daddy-Long-Legs pgs. 44-48 2023-10-16

15 Items: Why was Mr. Jervis in town?What did Jervis give a box of?How does Judy feel with Jervis?Where did Judy eat with Jervis?How does the campus look in May?Who did Mr. Jervis come to visit?Where is Judy going for the summer?What is Judy working hard to become?Where did Judy and Jervis walk around?How many months will Judy be on a farm?...

Spanish Vocab 2 2024-09-17

58 Items: InPenDayMayBookYearWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayAugustPleaseSeasonWinterSpringSummerTuesdayJanuaryOctoberYou sayNotebookTomorrowThursdaySaturdayFebruaryNovemberDecemberIt's hotClassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyStudent deskIt's spelledIt's rainingIt's snowingFall, autumnStudent (male)...

M2L19 - Vocabulary - 7th grade 2025-01-07

14 Items: To cause to be neutral.Not pleasant and disagreeable.To remove or separate from others.To destroy, demolish, or annihilate.Hopeless or unprotected from weather.The act, practice, or process of doing something.To be excluded or treated as being of no importance.Having to do with religion and showing great respect....

gothic elements and gothic words word search 2023-04-22

14 Items: a non living spirita blood sucking monstera place where the dead restbeing left on a cliff hangeran unatural thing or creatureunkowing of what will happen nexta place that people can go to praywhere the weather affects the moodan era of time known as the dark agesa building someone rich might live ina young lady often in distress in gothic books...

Voca 4000 Lesson 1 2025-08-27

12 Items: felling fear (AF***D)having the taste of salt (SA***)like silver in color and luster (SIL****)to praise for some act or service (COM***D)to look at in a close, thorough way (EXA***E)causing a feeling of fear or horror (HOR***E)the usual weather conditions in a place (CLI***E)to speak about something in a few words (MEN***N)...

Instructions 2026-01-14

32 Items: FastGo upHave toNot fastAfter thatAfter thatAt the endUse scissorsSave someoneIn a safe wayIn a soft wayWithout dangerLift somethingMake somethingPlace somethingMove on your feetBefore anything elseIt is a good idea toTry to find somethingPut something somewhereHold and take somewhereAttach with glue or tapeA tall plant with leaves...

YLC5 U6 2025-07-30

10 Items: Causing fear or making someone feel scared.To go down or reduce in amount, number, or size.The effect or influence of one thing on another.To go up or increase in level, height, or amount.Referring to traits passed from parents to children.Long-term changes in temperature or weather patterns....

Brynn's CrossWord Puzzle 2023-05-12

24 Items: Measures the air pressure.Measures the speed of wind.Change in moisture content.The weight of the air pushing down on earth.When a boundary between two air masses stalls.A warm water current that comes from the equator.Measures the amount of precipitation that has fallen.Form when a colder air mass moves toward a warmer air....

Canadian cities 2025-06-14

28 Items: - Retirement paradise where gardens bloom and wallets empty- Car manufacturing town that puts wheels on Canadian dreams- Medieval fortress city that somehow ended up in North America- Cottage country gateway where city folk pretend to be outdoorsy- The center of the universe, according to everyone who lives there...

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

cute words♡ 2023-10-25

160 Items: momnapskysunteacakecutedearfallhopehugslakelifelilylovepetsrainrosesandsofttoysbeachbloomblushbookscleandaisydancefreshfunnygiftsgrasshappyhearthoneyhubbyjellojollylightlunchmerrymusicoceanoreospeacequietrelaxrivershinesillysleepsmilesongsstarssweetswingtastytouchtreestruthwaterwavesyummyangelsapplesautumnbreezebrightbubblycolorscuddledreamsfamily...

Greenhouseeffect Word Search 2023-06-13

30 Items: a place to dispose of waste\When fertile land becomes a desertloss of resources though soil erosiona species that is non native to an arearadioactive waste from nuclear reactorstravel and appreciation of nature areaspower obtained by harnessing of the windThe uncontrolled expansion of urban areasthe decrease in the ph levels in the ocean...

Winter Weather 2025-12-10

1 Item: • FROSTBITE • SNOWSTORM • AVALANCHE • WHITEOUT • WINDCHILL • FREEZING • HYPOTHERMIA • TEMPERATURE • SLEET • HAIL • ICICLES

SDG 13 - JHS 1 2025-08-17

1 Item: weather, rain, flood, hot, cold, sun, storm, wind, temperature

New Year's Eve Article Word Search 2025-12-17

11 Items: What object moves down at midnight?What material is the modern ball made of?What city hosts this new year celebration?What do people often make for the new year?What type of lights does the ball use today?Where in the city does the celebration happen?What do people do together as the object moves down?...

Voca 4000 Lesson 1 & 2 Review 2025-09-02

16 Items: to leave; go away (v)to gather together (v)to make a sign to somebody (v)not hurt or broken; healthy (adj)happening or done every day (adj)to praise for some act or service (v)causing a feeling of fear or horror (adj)to accept or regard something as true (v)the usual weather conditions in a place (n)to speak about something in a few words (v)...

Human-Environment Interaction Review 2025-11-12

12 Items: The removal of salt from seawaterWhen fertile land turns into a desertA resource that cannot be replaced once it's been usedThe process of collecting and moving water for farmingUsing resources in a way that protects them for the futureA resource formed in the Earth by plant and animal remains...

Words Beginning with the Prefix "anti-" 2025-08-04

18 Items: Against fighting or war.A strong feeling of dislike.Weapons made to stop airplanes.The exact opposite of something.Not liking to be with other people.Something that kills or stops bacteria.Something that cleans cuts to stop germs.When something exciting ends in a boring way.Medicine that kills bacteria making you sick....

Elements of Fiction 2022-09-12

18 Items: lead character of the storythe sequence of events in a storycharacter stays the same with no changeenemy or opposition of the main charactera struggle or central problem in the storycharacter vs. a fight against other peopleperson; told by the protagonist - I, me, mycharacter changes due to evens in the story...

The Gothic 2025-09-30

10 Items: Dracula and FrankensteinA feeling of intense and overwhelming fear.Something unnatural that cannot be explained by science.Here we regularly find stormy, dark conditions with rain or fog.Feeling excited or anxious about something that is going to happen.Something strange and unpleasant that is linked to death and violence....

Climate Change and Sustainability Terms 2025-04-14

10 Items: CLIMATE : The long-term weather patterns of a region.CONSERVATION : The protection and preservation of natural resources.SUSTAIN : To maintain or support over time without depleting resources.POLLUTION : The introduction of harmful substances into the environment.CLEANENERGY : Energy that is produced with minimal harm to the environment....

Unit 10: Atmospheric Science and Pollution 2024-04-25

14 Items: the ocean's pH becomes more acidicatmospheric layer in which auroras occuratmospheric layer that breaks up meteorsthin layer of gasses surrounding the Earthatmospheric layer that contains the ozone shieldheat can be reflected by gasses in our atmosphereatmospheric layer in which all weather events occur...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

Spooky Word Search 2024-10-31

179 Items: axebogboocatnunspywigbatsfallfearhowlmaskmistmothalienbeardbeastbloodbonesboxercandyclowncovencryptdecaydemoneerieenemyfancyfangsfoggyghoulgourdmummyouijapartypropsravenscaryskullslimesnakestaffswordtoxictrollvenomwingsafraidapplesautumncasketcharmscircuscorpsecreepycurfewghostsgoblinhorrorleavesmakeuporangeparadepeglegplaguepiratepoisonscared...

Advanced Science 2023-02-28

21 Items: study of arachnidspollination by birdsWhat mammal lays eggsalloy of copper and zincwhat type of fish is albacoreAnother name for the stone ageLinseed oil comes from what plantHow many men have walked on the mooncloud at ground level is called whatthe rabbit has how many incisor teethThe fastest-running terrestrial animal...

El Hombre de Vocabulario PE 2/Quizlet 2024-09-11

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustpleaseseasonwinterspringsummerTuesdayJanuaryOctoberyou saynotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberhow manyIt's hotclassroomWednesdaySeptemberIt's coldIt's sunnyIt's windyIt means...student deskIt's rainingIt's snowingfall, autumnstudent (male)...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Geography & US Regions 2023-02-08

9 Items: The way a certain place makes moneyThe average weather in a given area over a longer period of timeA region famous for citrus fruit, alligators, jazz music, and seafoodAnything that is found in nature that can be used by humans or animalsThe act of people traveling to places outside of their usual environment...

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

vocabulario dos 2024-09-18

63 Items: inpendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayAugustseasonwinterspringsummerTuesdayJanuaryOctoberits hotnotebooktomorrowThursdaySaturdayFebruaryNovemberDecemberits coldclassroomWednesdaySeptemberHow much?thank youits sunnyits windyyou say...it means...its rainingits snowingstudent deskstudent(male)teacher(male)...

Hola, ¿Qué tal? 2025-11-24

44 Items: badwellso-sopleaseGoodbyeLikewiseIt's hotvery wellexcuse mehe/she isdelightedIt's coldWhat's up?My name isIt's sunnyIt's windyI'm from...Good morningIt's rainingIt's snowingSee you laterGood afternoonYou're welcomehis/her name isSee you tomorrowHow is it going?Nice to meet youWho is he/she/it?He/She is from...and you (familiar)And you? (form.al)...

Water Word Search 2025-05-05

20 Items: A treat for summerA big boom in the sky!Something fun to jump onWhat you take in the summerWhat you feel in the summerA type of meal or gatheringA sweet and freshly productHow you get tan in the summerYour body's reaction to cool offWhat people say it looks like outsideWhen you bath in the sun it's called?A place to go when the weather is warm...

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Ecology: Word Search 2025-10-03

41 Items: Eat plants.Eat other animals.Consume dead animals.Single living entitiesBoth organisms benefit.Living parts of an ecosystemEat both plants and animals.The variety of life in an area.Nonliving aspects of an ecosystemThe number of species in an area.Neither organism affects the other.Consume dead organic matter (detritus)....

Units 47 & 48 part 3 2024-03-15

40 Items: credit(math) minus(το) the dollar(η) the square root(ο) the (shape) cube(το) the social media(το) the figure, shape(η) the (math) algebra(ο) the (weather) wind(η) the saving, thrift,(η) the temperature, heat(η) the rain, rain shower(τα) the mathematics, math(το) the coin, physical currency(η) the value, price, worth, merit...

Sustainable Development 2024-05-30

15 Items: Type of energy harnessed from the sun.The act of preserving natural resources.Type of farming that avoids synthetic chemicals.Type of energy that can be replenished naturally.The long-term pattern of weather in a particular area.Type of gas that traps heat in the Earth's atmosphere.The process of converting waste into reusable material....

Sustainability 2025-09-26

15 Items: The act of using goods, energy, or food.Bringing nature back to a healthy state.The variety of animals and plants in nature.Harmful materials in the air, water, or land.Fair treatment for all people and the planet.When people have the same rights and opportunities.Things we use from nature, like water, trees, and oil....

English language devices Word Search 2023-06-25

15 Items: a naming wordwords that link to each othera word used to describe somethingan action or something that you can doa comparison using the words like or asthe repeated use of the s sound in a wordthe same starting letter for two or more wordsdescribing something as though it is an animalusing a word that sounds like the sound it makes...

CE2 2025-05-14

1 Item: exclamatory comfortable miserable misbehave weather whether summarising plain plane accept expect piece peace

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Summer Wordsearch 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

summer 2024-09-09

10 Items: sleeping outside in a tent.a place that has sand and the sea.a vehicle designed for air travel.you wear them to protect your eyes from the sun.the back of a house that has grass and flowers in.similar to an oven you can cook food on this but outside.it's cold and comes in many different flavours e.g. mint choc chip....

Earth and Space Science 2025-05-30

10 Items: A large, slow-moving mass of ice formed from compacted snow.Any form of water falling from clouds—rain, snow, sleet, or hail.The layers of gases surrounding Earth that support life and weather.Molten rock beneath Earth's surface that can form lava when erupted.An imaginary line around which Earth rotates, causing day and night....

Balboa 2025-09-09

15 Items: There is a _________ between right and wrong."Under the weather" is an example of ________."Her smile was a mile wide" is an example of __________."He's as healthy as a horse" is an example of a ________."His mind screeched to a halt" is an example of _________.His new white kicks were ________, with no scuffs on them....

Environmental and Nature 2025-04-14

10 Items: CLIMATE : The long-term weather patterns in a specific area.RECYCLING : The process of converting waste into reusable materials.RENEWABLE : A resource that can be replenished naturally, like solar energy.HABITAT : The natural home or environment of an animal, plant, or other organism....

Mission: Find the Hidden Words! 2025-11-13

10 Items: Relating to the whole world; worldwide - LOBGALA room or area where food is prepared and cooked - ENICHKTA day of festivity or recreation when no work is done - YLHODIAA game, toy, or problem designed to test ingenuity or knowledge - ZUPELZA person's regular occupation, profession, or commercial activity - SSBUNIES...

The Five Themes of Geography: Place & Region 2025-03-01

11 Items: The plants that cover a specific place.The shared way of life for a group of people.The long-term pattern of weather in a particular place.These features describe the natural environment of a place.These regions are areas defined by a common characteristic.These features describe the people of a place, both past and present....

Medicalalertcodeblue Word Search 2024-12-02

12 Items: Smoke or FireA missing childYou found a suspicious packageSecurity assistance needed for a hostage situationExternal Threat requiring all entrances to be lockedSecurity Assistance Needed for a violent patient/visitor/employee with a weaponAny Staff/Visitor “Individual” experiencing any type of medical emergency situation...

Geography Key Words - L1 2025-09-03

10 Items: the types of plants in an area or a regiona tool or instrument for finding directionsa sphere that is a model of Earth and most accurately represents ita physical feature on Earth's surface such as a mountain or a plainthe study of our physical surroundings and how humans interact with them...

Earth and Space Science 2025-04-14

10 Items: GLACIER : A large, slow-moving mass of ice formed from compacted snow.AXIS : An imaginary line around which Earth rotates, causing day and night.MAGMA : Molten rock beneath Earth's surface that can form lava when erupted.ORBIT : The curved path of a planet or satellite around another celestial body....

Science Word Search 2025-02-07

100 Items: pHDNALabAtomGeneCellLensWaveDataAcidBaseBiomeVirusPlateOceanForceSpeedLightSolarEnergyProtonFossilEnzymeOpticsFusionTheorySampleAtomicBiologyPhysicsQuantumGravityNeutronSpeciesMicrobeProteinNucleusGeologyVolcanoWeatherClimateKineticCircuitCurrentVoltageFissionReagentSolventIsotopeMoleculeElectronOrganismBacteriaRibosomeTectonicVelocityFriction...

Weather and Climate 2023-05-12

1 Item: stream Warm water current

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Fall And Fall Again 2024-10-03

1 Item: Football,Daylight,Weather,Orange,Hotdog,People,Leaves,Candy,Party,Coats,Treat, Trick,Rain,Fair,Hot,Fur

Anniversary Silly Search 2024-08-22

15 Items: The most wonderful drinkA favorite Western holiday for usAn object in the sky we both adoreA favorite weather event for us bothA desi drink we both have almost dailyYour Disney plushy friend won at a county fairThe name of the trivia game we played early onA reality show we watch with the romance and drama...