valentine's day Word Searches

2nd Grade Alexander and the Terrible, Horrible, No Good, Very Bad Day 2018-04-02

10 Items: timelylonelymostlyslowlytotallyquicklyhonestlyperfectlynervouslyhopefully

Tuck Everlasting Chapters 1-5 2024-01-19

18 Items: Not eagerLook searchinglyCapable of being reachedShowing fear and lack of courageMade less hopeful or enthusiasticFeeling or expressing pain or sorrowPrevent from being seen or discoveredA quick reply to a question or remarkDeficient in amount or quality or extentA formal and solemn declaration of objection...

Water safety 2023-11-23

16 Items: important sea safety hintnice sea view by the seasideuse it to dry up your wet bodyprotects your head from the sunan activity we all enjoy at seais the main component of the seaa virtue you must have by the seasidethe name of a garment you wear to swimwhen ever in doubt about where to swimdangerous objects buried under the sand...

Monsters of Myths and Legend 2023-06-20

15 Items: You're after his lucky charms.West Virginia's beloved monster.Stone by day, warriors by night.The terror of sailors the world over.Friend to talking donkeys. Has layers.I hope you brought silver tipped bullets.Bigfoot's frosty cousin in the Himalayas.Garlic and crucifixes will ward these away.This is what you'd classify Frankenstein's monster as....

The Secret Garden pgs. 55-61 2023-09-13

15 Items: She has my _____ to stay here.What did Mary tell Colin about?How was the weather for a week?When did Mary and Colin talk until?Who can't see Colin when he is awake?What constant sound came from Colin's room?Who was already hard at work in the garden?How did Colin look now that Mary was around?What did Mary and Colin speak the most about?...

Sip and search 2024-06-06

23 Items: Toby's car?Emma's car?Emma works for?The wedding car?Emma's middle name?Who is left handed?The Brides mums name?The Brides dads name?The Grooms mums name?The Grooms dads name?Toby teaches what subject?What bird rhymes with love?Emma's bouquet is what flowers?What county did Toby grow up in?what county did Emma grow up in?...

Vocabulary Unit 1 Station 2 2022-10-19

10 Items: Carrots, broccoli, onions are ...My biggest ... is becoming a famous star one day.A good ... has to know all the players in his team.Some teachers ... nice at first, but are really nasty.Do you like Mexican chili? - Nah, it's too ... for me.Tom has been ... so he can't go and see a movie with us....

Chukat ~ “Statute” 2024-07-07

17 Items: Moses’ sisterAbraham’s nephewHe dies at Mount HorHebrew word for “statute”Hebrew word for a good work.Hebrew for “instruction” or “teaching”“outside the camp” during Temple times.Messiah Yeshua is the _____ of the Torah.The last enemy to be destroyed. 1Cor15:26The person who took Yeshua’s body away for burial....

AMAZING 2018-02-20

156 Items: heyhaydaybaymaytaypaywaynayfaycaykayjaywonwintinbinminlinpinfinrinsinzinvinyinvancanmandanlanpantanranyansanwanjanboytoyhoyjoypoyloyroywoymoynoyvoycoyzoysoykidbidfidpidridsidwidcidzidfornownewnottontennetwetfewdewpewtwofanboypoddottotpotmotnotlotyothotjotgotfotrotwotzotcotvotsotwipdiplipsiptipripviphipcapgaphaplapmapnapvaprapyapwapsapbundungunguy...

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Paulina & Matias 2024-09-27

25 Items: The Couple's SongKendrick vs. DrakeThe Bride's first jobThe Groom's first jobThe Bride's birthday monthThe Name of the Groom's barThe Bride's favourite movieThe Groom's favourite hobbyThe Name of the couple's catWhere the couple got engagedThe Couple's first date spotThe name of the wedding venueHow did the couple first meet?...

Try to Be the Only One pt.2 2024-03-05

26 Items: 聞く(hear)人生(life)賛美歌(hymn)他の(other)伝える(tell)ラジオ(radio)教会(church)考える(think)聴く(listen)いくつかの(some)について(about)牧師(minister)静かに(quietly)ある日(one day)meetの過去形(met)とても(very much)欲しい,〜したい(want)tellの過去形(told)hearの過去形(heard)findの過去形(found)wantの過去形(wanted)気づく,見つける,探す(find)thinkの過去形(thought)listenの過去形(listened)理解する,わかる(understand)興味がある(be interested in)

ww4 u10 2024-06-07

14 Items: What _______ you?The knight ______ the dragon.What is the _________ of the lake?What are the ________ you are experiencing today?The dog _______ from the sound of the vacuum cleaner.It is kind to __________ your friend if they are sad.It is important to ______________ well in a friendship.The king decided to _________ the thief from the Kingdom....

Devarim 2024-08-03

18 Items: King of BashanKing of Heshbon.יַרְדֵּן (English)הַדְבָרִים (English)Brother of the Master.synonymous with “overseer”Number of men it takes for a minyan.The 12 spies are better known as ______.Moab and Ammon were descendants of ____.Moses’ farewell speech to the sons of Israel.The original inhabitants of the territory of Mt. Seir....

Unit 1 week 2 and Unit 2 week 4 2023-09-28

15 Items: very valuable to you.it is in danger of being hurtto represent ideas or objectsbravery in a difficult situationyou remembered something from the pastto be stay alive after a dangerous eventthings that have been done for a long timeyou do something special for a day or eventis the number of people living in a certain place...

Tigris Word Search 2024-01-24

17 Items: The first Emperor of Rome.The Romans built these to carry water.Huge Chinese wall built for protection.A series of rulers from the same family.The large mountain range where the Inca lived.Ancient sporting event held in Olympia, Greece.The Inca were famous for these connecting paths.A step-like type of temple found in Mesopotamia....

New Words for the Week of November 6 2023-11-11

17 Items: Our neighbors kept chickens in a _________.What will I _________ if I look in your bag?If you have an itch, you want to _________ it."Please forgive me!" she said with a __________."My car was stolen! Somebody call a __________!"After dinner, Budi had a big _______ on his face.On a warm day, your ice cream cone will _________....

My Word Search 2023-04-19

15 Items: opposite of possiblethe school you go towhat number is this?a sport for self-defenseI wonder what a Maltese Poodle is?what's the opposite of impossible :)a sport that contains a big orange ballthe name of a toy rabbit from a famous booka real-estate board game for up to 2-8 playersin this sport you kick the ball with your feet...

A Charm A Day Keeps The Bad Moods Away 2023-07-15

5 Items: juliescharmsbiscuitteatimedelicious

Interaction Desktop: I3 2023-03-29

13 Items: Select this status when you go to lunch.Select this status only when you are going on vacation.Select this status when a senior, supervisor or manager has asked you to.Select this status when a supervisor or manager has assigned a task to youSelect this status when a supervisor or manager has asked you to meet with them....

May the Words be with You 2023-04-10

1 Item: Blossom, Bumblebee, Butterfly, Cinco de Mayo, Flowers, Garden, Green, Ladybug, Lawnmower, Maypole, Memorial Day, Mom, Mothers Day, Pinata, Plant, Seeds, Spring, Sunshine, Beautiful, Breakfast, Candy, Charming, Comfort, Hugs, Joy, Laughter, Love, MOD, Mot

Inheritance Word Search 2024-08-03

12 Items: – Apex predator (Hint: 1975 film about a menacing sea creature)– Unlikely hero (Hint: 1994 film chronicling an extraordinary life)– Icy enchantment (Hint: 2013 Disney film with magical snow powers)– Artificial reality (Hint: 1999 film featuring a simulated universe)– Underdog triumph (Hint: 1976 film about a struggling boxer’s fight)...

YOU AND I 2023-01-17

30 Items: MY HOMETOWNSPREAD MY ASHESCOUNTY WE MET INTOBAGO HONEYMOONWEDDING DAY VIBESMY FAVORITE DRINKIT FEELS LIKE HOMEMAKES THE DREAM WORKMY FAVORITE SPORT(S)MY MAIN LOVE LANGUAGEYOUR VERY FIRST TRUCKMY FAVORITE CAR BRANDYOUR MAIN LOVE LANGUAGEMY FAVORITE TRINI FOODSEQUAL THE SCALES OF LIFEEXCHANGING OF INFORMATIONYOUR FAVORITE DRINK COMBO...

Battle # 2: Greek Mythology 2023-04-25

23 Items: Aphrodite's SonMagical PrincessName of the shipHero of the storyWhat the hero WANTSThe whirlpool monsterThe hero's fatal flawGuardian of the fleeceWhat killed the hero's fianceThe hero's most supportive goddessThe god who gave the seer his giftsThe titan they saw on their journeyCeased the Harpies from attacking Phineus...

Megan and Aaron 2024-07-31

20 Items: Where do they live?The new Mr & Mrs ??What is their favourite food?What is the name of their dog?Where was their first holiday?What instrument does Megan play?What is Aaron's favourite hobby?What is the Bride's maiden name?What is the Groom's birthday month?What is the Bride's birthday month?On what day did Aaron propose to Megan?...

Popculture Word Search 2022-08-26

12 Items: This was the guidebook for witch hunters.The modern book used by 20th century witches.The amazing holiday celebrated on October 31st.Teen age witch from television and comic books.An official religion practiced by modern-day witches.This Biblical king sought a witch to help him in battle.The Wicked Witch of the West is from this classic story....

Columbus Word Search 2024-08-07

20 Items: Capital of the Aztec Empire.Spanish conquerors of the Americas.Native American empire conquered by Cortés.Spanish colonial territory in the Americas.Aztec god whom Moctezuma mistook Cortés for.People of mixed Indian and European heritage.Spanish conquistador who conquered the Incas.Native American people in the Rio Grande valley....

Basic Vocabulary - Find the following adverbs, phrases to show frequency and parts of the day in the wordsearch. 2024-05-10

19 Items: peictmayreadrainymathswritestudysummerfrenchwintersundayautumnmondayjanuaryamericanwednesdayseptemberuruguayan

Thanksgiving Word Search 2022-11-12

12 Items: This is the sound a turkey makesThanksgiving falls on this day of the weekFalls from the trees in autumn; changes colorThe spirit of Thanksgiving; an attitude of ___It has green leaves that change colors in the fallIt is made out of breadcrumbs and goes with turkeyThis animal has feathers and is served for Thanksgiving...

APUSH Chapter 1 Word Search 2024-08-07

20 Items: Capital of the Aztec Empire.Spanish conquerors of the Americas.Native American empire conquered by Cortés.Spanish colonial territory in the Americas.Aztec god whom Moctezuma mistook Cortés for.People of mixed Indian and European heritage.Spanish conquistador who conquered the Incas.Native American people in the Rio Grande valley....

ww5u5 2024-03-28

15 Items: His response was _____.He fell into a _____ creviceHe __________ my plans for revenge.I take the same _____ home every day.I went to Bali on my _______ vacation.I ________ my friend to a game of basketball.You are so ______ for trying to pet that tiger!I _______ my fear of heights so I could go skydiving!...

Nova Farms Word Search 2023-12-19

20 Items: Ground flowerSolventless edibleSleepy time edibleTHC, CBD, CBN, CBG3g Joint with a wooden tipBlunt infused on the insideJoint infused on the insidepre-packed glass one-hitterTHC oil used with a dropperTopical brand made in houseBlunt infused on the outsideVape with live cannabis derived terpenessolvent extract used in Sticky Fish products...

Pub Crawl 2023-04-14

64 Items: Oman portJordan portfrench portAfrican PortSunny day barMalaysia portPort for Romeport in Maltabar on deck 15Hawaii CapitalPort in TurkeyName of our ship2nd Spanish portport in Sri Lankabuffet restaurantEmbarkation port 1Embarkation port 2South American PortAmerican Samoa porthome to birj khalifaFirst port in Mexicofirst Port in Tahiti...

vocab 2 2024-09-11

63 Items: enhoyhaymayoluneseneromarzoabriljuniojulionievael anoel diael mesmananamartesjuevessabadoagustollueveviernesdomingooctubrecuantosse diceel lapizel libroferbrerohace solel otonola semanamiercolesnoviembrediciembrepor favorhace frioel veranola carpetael pupitreseptiembrese escribehace calorel cuadernoel profesorhace vientola estacionel invierno...

kwanzaa 2022-12-11

10 Items: The Kwanzaa celebration is this long.The name of the Kwanzaa candleholder.This principle is based in the idea of creativity.Kwanzaa means "first fruits" in this African language.Examples of this symbol are fruits, nuts, and vegetables.Kwanzaa is based on these (unity, self-determination, etc)...

What is a mineral?5 2024-05-04

10 Items: When something turns around in one spot.An imaginary line that an object spins around.When one thing goes around another thing in a circle.Phases: The different shapes of the moon as seen from Earth.Pace: Moving at a consistent speed without significant changes.Side of the Moon: The side of the moon that is not visible from Earth....

Word Search 2024-07-06

10 Items: Who was the last Viceroy of British India?Who wrote the book “The Discovery of India''What is the universal symbol for friendship?Which Indian leader is known as the “Father of the Nation”?Which movie features the friendship of a lion cub and a warthog?Who is one of Harrys best friends in the famous Harry Potter series?...

European Age of Exploration 2024-08-12

10 Items: What was the name of the reconquest of Hispaniola?What nation discovered a new route to India and China?What were southern cities of Spain in terms of religion?What was the name of the trade route from Asia to Europe?What land was known for the large amount of spices produced?What city fell to the Ottoman Empire and cut off the silk road trade?...

Classroom Scavenger Hunt 2024-09-03

10 Items: Class Expectation #2: One Mic, One _____________.Find your _______________ number hanging above your head.Bonus: Teacher Faunt's dog's name is _____________________.The turn in _____is located on the table as you enter the classroom.Is it a _____ 1 or _______2? You can find out on the announcements whiteboard....

Pirket Avot פרק ב, משנה כ, משנה כא, משנה יג 2024-02-14

18 Items: The day is _The workers are _There is a lot of _ to be doneNumber of students in Mishna יגThe _ is pressuring the workers.A good friend gives constructive _Rabbi Yose says this is the best trait: _ tovthe reward for the righteous will be in (Hebrew)Rabbi Eliezer says this is the best trait: _ tovaRabbi Yehoshua says this is the best trait: _ tov...

11-20-22 2022-11-18

2 Items: SUZANNE CARLY BRITA KATE PETER NETTAEACH BLESSED DAY TWO EVERY BREATH TAKE THREE FAMILY FOUR ALL THEY MEAN FIVE ALIVE SIX EARTH SKY SEVEN HEAVEN GOOD THING COMES FROM GOD BLESSINGS SENDS WITHOUT NUMBER COUNTED HUNDRED THOUSAND SURE THERE WOULD STILL THANKFUL

Learning Yarn Words 2024-08-15

74 Items: 12346789010GoSadBadCrySitArmSitManyGoodI amFromComeNoseBackNeckHeadKneeSandHereHelloTiredHappyAngryStandAnkleBellyTeethElbowMouthFingerTongueMorningIpswichThunderWelcomeBrisbaneMosquito5 or handVery manyShouldersWaterholeThank youDay or sunWild honeyStorm birdEye or lookBright starSand goannaYam BellbirdWater dragonEar or listenSpeak or talk...

Genesis, Exodus, Leviticus, Numbers 2024-03-13

28 Items: cleanno foodliked the bestJoseph's fatherplace to worshipAdam and Eve's sonAdam and Eve's sonto do what others doboat that Noah builtGod so love the worldJacob's son (favorite)Adam and Eve's third sonthe first man God createdthe first book in the biblethe third book in the biblethe second book in the biblethe fourth book in the bible...

July Word Search 2024-07-16

32 Items: Jarrod's NRL teamNumber of groomsmenNumber of bridesmaidsWhere Jaz & Jarrod metJaz's favourite singerJaz's favourite colourJarrod's favourite foodThe month of our weddingName of our wedding venueJarrod's favourite colourJarrod's favourite dessertJarrod's favourite superheroJaz & Jarrod's favourite tripWhere Jaz went to unniversity...

Vocab 9 2024-01-10

12 Items: The two different stories were _______.after I got an A on my test is I was _______.It was a _______ event when War world 1 happened.After I got an a on my project tried to ______ them.I couldn't get past question one it was a real _____.He was ______ to a lower math class when he failed his EOC....

Fever 1793 2023-03-23

20 Items: The cat's nameThe author's last nameGrandfather's mouth parrotMattie's partner at the coffeehouseMattie dreams of visiting here some day.He organized the society from question 18.Stephen ___ turns Bush Hill into a safe hospital.It kills off the mosquitoes and the yellow fever.Eliza's brother who lost his wife to yellow fever....

Yes sir 2024-09-11

195 Items: aisbedogoamheanwasarehadcanusehasseedidgetmaysaysetputasktryaddsawgotruneatletcutwaydaymanboyendmenaireyecarseaonealltwonewoldanybigownhaveweresaidwillmakelikelookbeencallfindcomemadetakeknowlivegivehelptellcamewantshowdoesmustwentreadneedmoveplaykeepturnseemopenwalkgrowtookhearstopmisstalkwordtimepartworkyearbacknamelinefarmlandhomehandpagefood...

Space II 2023-03-09

23 Items: a moonless planetthe solstice on june 21another moonless planetthe name of pluto's moonmain gas in Mars' atmospherethe brightest star in TaurusFirst american woman in spaceWord meaning "around the sun"a moon feature named CopernicusThe liquid in the ocean of TritonWhat is the star nearest to the sunthe constellation for the star Vega...

Landmark History 2023-09-13

21 Items: Landmarks first namelandmarks ____ # is 401043In 2013 ____ was appointed CEOLCU serves 2 counties in _____Landmarks saying is Youre_____ hereHow many members did we have by 1973?What position did Joseph Woelfel have?Who was the first PAID employee for us?How many times do we check Night drop a day?we have three of these machines at our branch...

Genesis, Exodus, Leviticus, Numbers 2024-03-13

28 Items: cleanno foodliked the bestJoseph's fatherplace to worshipAdam and Eve's sonAdam and Eve's sonto do what others doboat that Noah builtGod so love the worldJacob's son (favorite)Adam and Eve's third sonthe first man God createdthe first book in the biblethe third book in the biblethe second book in the biblethe fourth book in the bible...

Internet Word Hunt 2024-05-12

12 Items: This is the most visited website as of nowOn average, internet users spend 6.5 _____ online each dayThe government used an internet system in order to share ___________The first operational computer network developed by the Department of DefenseThis application allowed users to easily connect to websites and browse the internet...

💕 Galentine's Day 💕 Celebrating Friendship 💕 Work TOGETHER to find all of the words that describe a great friend! 2023-01-26

20 Items: funkindloyalsweetcaringhonesthelpfullistensreliabletruthfulforgivingwonderfulunselfishsupportivethoughtfulfriendshiprespectfultrustworthyunderstandinginspirational

Earth day 2024-04-19

1 Item: earth

wk1 0902 2022-09-02

14 Items: To go __________ you need a pair of skis and fast boat.I'm not going to watch that ghost movie, it's too _________!The old man likes to sit by the river and go _________ all day.They go ___________ on their boat in summer. It's very relaxing.Everyone plays ______________ in the UK, it's the most popular sport....

Day One 2023-07-14

1 Item: peter, jesus, nets, galilee, discples, boat, holy, follow, bible

D-Day 2023-06-04

1 Item: USA, Canada, France, Germany, Normandy, Mulberry, CaneCanalBridge, Landing, Overlord, Operation, Hitler, Beach, AtlanticWall, June, Calais, RAF, Navy, FrenchResistance, Occupation, Bombardment, Eisenhower, Neptune, Memorial, Victory, Battleships, Liberati

Naw Ruz 2023-02-16

1 Item: springtime, equinox, new year, bahai, calendar, celebration, renewal, refresh, revive, festival, season, joyous gathering, growth, new day, spring, beginnings, feast,

Ancient History 2023-07-17

20 Items: 490 BCE Battle of _________.9500 BCE Settled _______ began.2560 BCE Great _______ of Giza.6000 BCE _______ was discovered.200 BCE Paper is invented in China.776 BCE ______ Games first recorded.323 BCE Death of Alexander at _______.508 BCE Democracy introduced at ______.1700 BCE End of _____ Valley Civilization....

T09 - Word Search #1 2024-04-12

22 Items: Andrew...the doughboyaka spicy SpanishLiz doesn't like this fruit...used to track lender match callsthis was our trainer earlier this weekwhat did leigh have for lunch yesterdayDOB can be updated her after verificationissues will arise if the source is this...used to retrieve a copy of your EIDL LCD'sthis person doordashed chinese food last week...

FNW Final Review 2024-04-26

20 Items: One of FCCLA's colorsFCCLA's official flowerA unit of energy found in foodOne way vegetables are classifiedOne of the parts of a grain kernelThe number of essential amino acidsThe main nutrient of the dairy groupAn example of a cultured dairy productWhen food choices are influenced by sensesThe number of calories in a gram of protein...

Kehan & Milleni 2024-09-04

25 Items: The bride's favourite fruitThe bride's dog's full nameThe groom's favourite sportThe month the groom proposedA fruit that the groom hatesThe groom's favourite cocktailThe hospital the groom was born atThe suburb the couple just moved toThe host of the bride's favourite showA chore that only the groom will ever do...

Quiz MPMAX Edisi Mei 2023 2023-06-02

10 Items: Singkatan dari kegiatan Honda Premium Matic DaySingkatan dari “Indonesia CSR Awards” oleh The IconomicsKomunitas Honda ______ mengikuti kegiatan Kopdargab Halalbihal di MPM Riders CaféSingatan dari Persatuan Pabrik Monosodium Glutamate dan Glutamic ACID Indonesia adalah...

Neuro Word Search 2023-05-02

15 Items: The Spinraza Program Lead.Same day delivery service.We call to do this for new patients.The extension 219332 is for what team?Another word for the supplies a patient may need.Any test claim questions for Evrs can be answered best by who?Any test claim questions for Emfl can be answered best by who?...

Animals of the World 2024-09-15

15 Items: The largest animal on Earth, found in all oceans.A long-living reptile found in the Galápagos Islands.The largest land animal, known for its long trunk and tusks.The largest primate, native to the forests of central Africa.This bird of prey is the national symbol of the United States.A large, herbivorous mammal with one or two horns on its nose....

T10 - Word Search #1 2023-07-26

24 Items: team 10 over...former team 10 nameSBA loans are ____ _____ loanswho on this team lived in Austriathese cannot be cancelled in mySBAwho on this team has lived in SpainBO's can forward phishing emails herewho on the team has held an alligatoron this day the mySBA landing page changedthis can be used as PII in ETRAN if listed...

Chapter 5 Vocabulary 2023-10-05

11 Items: The middle score.Words correct per minute.Planned reading of text to children for a specific purpose.The ability to read text accurately, quickly, and with expression.A graph line drawn from a student’s current level of performance to a fixed benchmark score....

Solution Center Training Week 1 2024-07-02

17 Items: BA stands for ____.What we call a 3HSS or 5HSS adThis is what we call a potential clientTerm used to describe a service as a softwareThis "Center" helps a client grow their businessWhat we call products that can no longer be sold as newThe last day to retire a product before late work startsWhere we can view copies of the print directories online...

Police Call Type 2023-11-28

20 Items: Someone broke into my barn.Someone broke into my house.There is a snake in my living room.There are dogs loose in my neighborhoodMy 14yo did not come home from the movies.I need to report an alarm from a business.My ex said he was going to come beat me up.There is a large piece of metal in the road.My 24yo daughter did not come home last night....

Pudgy Penguins 2022-10-14

20 Items: When were rogs born?What hatched from the eggs?The infamous Penguin haircut.Where do all the Pudgys gather?Where was the Pudgy Asia event held?Which way is our iconic igloo logo facing?What event takes place every other Sunday?What is the web3 first name of KinkyBedBugs?A female Pudgy Penguin called a Pengu _____?...

Random 100 P2 2024-03-19

51 Items: 6, sixdiscussedby translating(η) the battery(το) the height(η) the Thursday(το) the mushroom(το) the toy store4000, four thousand(η) the mother-in-lawby (in sport) scoring(ο) the (bird) woodpeckerto be liked by, pleased by(το) the book store, bookshopto key in, type, use a keyboardresponsible, accountable, liable(ο/η) the (m or f) choreographer...

Lesson 13 2023-11-15

6 Items: I will study for at least one hour every day before dinner is an example ofA type of rule governed behavior that is under control of socially-mediated consequenceWhen cooking, you might follow a recipe that tells you to preheat the oven to a certain temperature is an example of...

Macro Hard 2023-01-30

19 Items: chairish doesn't employAlways pays for shippingthis is your profile pictureMillions of shoppers want to buyRates are based on your seller planrefers to an item that is 100+ years oldanything that was made more than 20 years agothis mode lets you temporarily put your shop on hold.seller plan is offered to approved sellers for $99 a month...

Favorite Things Christmas Word Search 2023-12-06

20 Items: Carol of the what?Means "God with us"Where Jesus was born.What kind of night was it?Candice loves to bake these at Christmas.Katie loves cookie making and going here.Jennifer R likes doing this to the Christmas tree.Benna loves going to mass with family at this time.Audrey loves attending this church service on Christmas Eve....

5B-01 2024-01-03

18 Items: I won an _________ last week for never being late to class.I had no idea how _________ the pyramids in Egypt were until we traveled there last year. I felt so small.I really want to _________ something everyone in the world needs, then I can be rich when everyone buys it!...

3 Nephi 20-26 The Savior's Teachings 2024-08-01

12 Items: 3 Nephi 25:5 “the great and _____________ day of the Lord”3 Nephi 24:7 “Return unto me and I will ___________ unto you”3 Nephi 24:11 “I will rebuke the _____________ for your sakes”3 Nephi 25:6 “and the heart of the ___________ to their fathers”3 Nephi 24:8 “Wherein have ye robbed me? In ___________ and offerings”...

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

Day 4 Vocabulary 2023-08-10

1 Item: cloth, stretch, cotton, tape, measure, scissors, marbles, string, paperclips, goggles, sunglasses, early, current, storybook, zombie, apocalypse, presentation

St. Patrick's Day 2023-02-03

1 Item: brogue shamrock donnybrook harp ireland leprechaun magical mischief rainbow

tester23 2023-03-18

245 Items: codaâmeartbiochidayareaauraautoâyurbachbodycampcodecoldcropdéfidéjàdénidheaalphaamwayangesappelarchebaccibiaisbiblebijoubonneboulebrainbrownbyrnecayceclarkcordecorpscourscultedabicdébutakashaanoxieapportarchéoashtarastralavatarbamboubarnumbarronbetterbrightbunyipbuttarcabalecannoncartescasquecécitéchaînechampscharmecherrychopraclimatcônagecrânes...

0916 Who will win 2022-09-13

13 Items: The typhoon was so _______ that it blew many trees down.We like to go ________ on the largest lake in the world.You need a _______ of gloves today because it will be very cold.It took me over seven hours to get the _______ to this math problem.Have a ________ during break time, so you will feel well for the next class....

EARTh DAy aP 2024-04-23

1 Item: april

A Fun Day 2024-01-04

1 Item: Tuesday Wednesday Thursday Friday Saturday Sunday

Medieval Word Search 2022-12-12

10 Items: The biblical birthplace of Jesus.The length of the Medieval Christmas celebration.Find the hidden bean in the bread, and be queen or king for a day!This vibrant bird was roasted in its feathers for the Christmas feast.This word, when broken down to its roots, literally means "Middle Ages"....

0923 who will win 2022-09-23

14 Items: Don’t ___________ that flashlight in my eyes. It’s too bright.The __________ in the movie was full of little green men from Mars.It took me over seven hours to get the _______ to this math problem.We feel terribly hot when the temperature is high up to 35 ____________.The fisherman uses a large _________ to catch fish that are deep in the ocean....

Payments 2023-10-25

17 Items: This means the check has been stopped by us.What type of payment can we make the same day?What carrier do we use for any expedited payments?We can take a verbal on what type of hazard policy?What website can a caller upload a policy document to?What type of payment will arrive in 3-5 business days?...

Game 2023-04-10

15 Items: The colour of chocolate.A small vehicle for travelling on water.The day before today. The letter starts with Y and ends with Y.An object for taking photos or making films or television programs.An object with a sharp blade used for cutting fruits, vegetables etc...It is a vegetable. The letter of the word starts with C and ends with T....

Empowering & Uplifting 2024-06-25

25 Items: Lacking fearGive out a bright lightThe center of interest or activityGive out steady light without flameTrust in yourself and your abilitiesNot deterred by danger or pain; braveFreedom from disturbance; tranquilityA feeling of great pleasure and happinessShowing a heartfelt and powerful intensityRegard for one's own well-being and happiness...

Elizabeth Word Search 2024-07-11

35 Items: Tom’s middle nameTom’s zodiac signKelly’s middle nameKelly’s zodiac signState they eloped inCity Tom was born inThe clear favorite catCity Kelly was born inKelly’s Hogwarts houseSeason they got engagedWebsite the couple met onFavorite video game systemCity of their first apartmentName of Kelly’s oldest siblingName of Tom’s youngest sibling...

Who’s Who in American Church History 2023-07-16

1 Item: CABRINI, John CARROLL, DOROTHY DAY, DR. TOM DOOLEY, KATHERINE DREXEL, ROSE Philippine DUCHESNE, Father Francis DUFFY, James Cardinal GIBBONS, ROSE HAWTHORNE, ISAAC JOGUES, JOHN F. KENNEDY, PADRE KINO, John LALANDE, Father Daniel LORD, JOHN NEUMANN, Fr. Pa

4B 0512 2023-05-11

15 Items: Cycling to school is __________ than walking.A wonderful activity we can do on _______ days is flying kites.Krista has lots of _______ ideas so we want her to be on our team.It is always necessary to wear a _______ when you ride a motorcycle.Bruce Willis is a famous _________. He has starred in many action movies....

Water around the world 2023-11-23

11 Items: water vapour changes to cloudshow rare or how much we have of somethinga body of permeable rock which can contain or transmit groundwater.When water lands on the ground as precipitation, some of it soaks into the soil.Some precipitation that falls to the ground also flows into rivers, lakes and oceans....

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

End of School/Summer Search 2024-04-22

1 Item: BRIDGES, MR STRUMPLER, MRS MOORE, MS SLEDGE, SUMMER, POOL, BEACH, OCEAN, WAVES, SUN, ICE CREAM, SCHOOL, PARTY, LAST DAY, SLEEP IN, HOT, SPLASH, TRAVEL, VACATION, CREEKSIDE, SIXTH GRADE, CAR, PLANE, BOAT, LATE NIGHTS, SAND, SWIMMING, SHOVEL, BUCKET, SIGHTS

BBC Idents 2024-02-27

51 Items: What.UniqueA color 2!A round shapeA normal globeAn amazing viewNow w/identity!A new kind of 2.Self explanatorySo nice looking!Fit for childrenLacks a visible 2Much better identInnovative indeedGame over 3 on Tv!Fitting ident 4 4.Curious indeed....Includes calm musicA choice of 3 -----3 is here tomorrow!A little too trippy------- of learning...

middle school academic day 2024-02-14

1 Item: monday

Follow Along! 2024-03-16

20 Items: What clan is the author a member of?The name of this poem! (without "the)The author of the poem is ______ Keeshig.The word "plop" indicates which literary device?Over 52% of children in _____ _____ are IndigenousThe author is a member of the Chippewas of ______ Unceded First Nation....

Coloum 2022-09-15

25 Items: A rounded roofThe pillar of a buildingA person who designs buildingsHorizontal member of step (stair)Vertical member of a step (stair)A structure that has a roof and wallsA design plan or other technical drawingA fence or balustrade made of rails and postsThe lower surface of a room that people walk on...

Provider Referral Word Search 2024-03-28

30 Items: 2. __________3. ______________4. ____________ of times referred.2. Language other than ___________California state animal is a ______.2. (orthodontist, endodontist, etc.)3. ______________ for a given provider3. Unusual or exceptional ____________.The member is referred to this team for ________.These needs include things such as: 1._____________...

LD New Claim 2024-08-01

17 Items: Loss Date goes in the ___ ___ note.Regular mail could take 8-10 ___ days.Check the ___ ___ page to determine if the loan type.In step #6, after linking to IIM we click Creat & __ __ __.If the caller does not have a loan #, what system can you use to find it?Where in the Module do you go to begin the process of opening a new claim?...

jewish history 2023-09-04

10 Items: In 586 BCE, the Babylonians captured Jerusalem and destroyed the _____ _____, leading to the Babylonian Exile.In the 1st century CE, the _____ _____ conquered Judea and, in 70 CE, destroyed the Second Temple during the First Jewish-Roman War....