states of matter Word Searches

Chapter 2 Vocab ICP 2025-01-23

7 Items: Is the rate of change of velocity.Is the the distance of object's change in position.Is the distance an object travels per unit of time.Is a change in an object's position to a reference point.Includes the speed of an object and the direction of its motion.The ______ of an object is the product of its mass and velocity....

Word Search 2024-12-27

28 Items: Steak, ribs, bacon, chicken, ham..A fruit that monkey and apes like to eat.Similar to dairy milk, but made of soybean.A long green vegetable, made mostly of water.An animal with a long bushy tail and narrow face.Some eat this with cookies, it contains lots of calcium.An insect with a pair of colorful wings. They feed on nectar....

Hydrocarbons 2024-03-21

13 Items: Crude oil took __________ years to formThe products of combustion are water and_________Short chain hydrocarbons are often used for_______At the top of the fractionating column is__________Hydrocarbons are made up of hydrogen and ____________The bottom of the fractionating column is ___________...

Semester 3 Review 2026-04-16

14 Items: Thickening of cortical boneLess than 25% myeloid cellsDecrease in overall cellularityDecrease in overall cellularityFunctions to stabilize the platelet plugSerum that appears pink after centrifugationCommon coagulation disorder of domestic animalsPrimary site for production of coagulation factorsAtypical cells with more than 30% blast cells present...

Rylans planet word search 2023-12-18

9 Items: has a curved tailpart of a connstelationis a ball of ice and gassomeone who studies spaceis the study of the movementswhen the sun crosses the equatoris a person trained to go to spacea group of stars forming a patternthe shortest or longest day of the year

Ham Radio Communications 2024-11-19

25 Items: Morse codeRadioteletypeLocator systemSingle sidebandType of antennaConfirmation cardRadio manufacturerRadio manufacturerRecord of contactsAudio input deviceRadio manufacturerHigh frequency bandFrequency modulationLong-distance contactsHow radio waves travelCode of dots and dashesVery high frequency bandUltra-high frequency band...

Go Botoño 2024-10-02

5 Items: Cosmos,Vote SupportStates Governor FamilyBotoño Environment LoveUse a highlighter to mark the words.

Knee 2025-10-27

10 Items: Commonly called the kneecapThe smaller bone of the lower legConnects the patella to the tibiaLigament on the inner side of the kneeLigament on the outer side of the kneeThe thigh bone; the longest bone in the bodyThe shin bone; bears most of the body's weightLigament that prevents forward movement of the tibia...

Culture Word Search 2025-10-31

10 Items: expected behavioursbeliefs most people in a society sharehow society ensures that people conformsomething that is constructed by societymade up of a mixture of different culturesa custom passed down from generation to generationrefuses to conform to a culture’s norms and valuesThe shared, learned way of life of a group of people...

Wabash Word Search 2022-08-13

9 Items: state birdstate treestate riverstate flowerstate insectstate animalnickname of stateof america state mottonumber of stars on flag

Intellectual Property and Digital Media Ethics 2026-03-02

20 Items: A notorious type of malicious software that encrypts all your files and demands a payment to unlock them.This term refers to false information spread unintentionally, without a malicious motive to deceive others.This is false information that is deliberately created and spread to deceive people or cause specific harm....

Modernity and globalisation 2024-03-20

5 Items: The economic system of modern societies.What is the term for a key political unit in modern society?Which sociologist argues that we are now living in a 'risk society'?__________ changes means we can cross entire borders in a matter of hours....

Unit 2: 'A Schoolgirl's Diary' 2024-10-28

11 Items: unknown namea supporter of a causethe head of governmentto refuse to do somethinga fake name used by an authorto swallow down in big amountsa blanket made of stitched fabricsthe introduction to a book or storyto discuss two opposing points of viewto make fun of someone or to mock theman official order made by someone in high power

Evidence search! 2026-05-28

11 Items: A subject of crimeA criminal's helperA person that killsMaking a place soundproofThe act of forced sexual activityBodily liquid used as class evidenceThe act of forcefully taking someoneName of the trailer women were kept inRepeated inflicted pain to hurt someoneChemical used to put effects in the body...

DC 23 Core Vocab Lists 1 - 5 Review 2017-03-21

50 Items: chatcitedenyfilelackscarunitvastamuseawareblastchutequotetardyurbanaccessaccuseadjustcleverdeletedeparteffectmatternotifyrecedeuniquevanishancientantonymclarifycompareconfessdiscusssynonymuniformacademicbehaviordialogueevaluateinternalpersuaderesemblestrategyencounterexceptionfantasticinstituteexperimentappropriatecharacteristic

Period 4 Track Day Word Search 2025-03-27

51 Items: preyapexingaleonlilinareleviarpileozlayladavidaidentymurtatevromanelinaethanarmanarsenokeefeenergymattermilanarolandbradenashleyarthurnikitasophiamilenawinterandrewelinasscienceecologynatalievanessavincenteverettproducerconsumeromnivorepredatorsunlightMaryJanekristinaherbivorecarnivorestephaniedecomposeralessandra

Fry Words Sixth Hundred List 1 & 2 2025-09-29

50 Items: sumbillfelttestmoonmindloveraineggsbluewishdropsitewallcan'treadydancecellspaintcausetrainheartmattersquarecenterenergyEuroperegionreturnpickedsimplewindowsummerforestperhapsfarmersdividedgeneralsubjectbelievememberssuddenlyanythingexercisedistanceprobablysyllablesdirectiondevelopeddifference

Chemistry 2025-12-08

50 Items: DotIonicBondsPolarAlloyAtomsAnodeTableDoubleSingleTripleChangeMatterEnergyPeriodGroupsValenceFormulaCrystalLatticeElementMeltingBoilingMixtureCathodeThermalCovalentDiagramsChemicalMoleculeNonpolarMetallicFreezingSolutionPhysicalFamiliesPeriodicElectronsSubscriptSubstanceCondensesPolyatomicElectricalExothermicHomogeneousTemperatureEndothermic...

Science 2026-01-11

51 Items: sunairgasmarsstemsolarvenusearthorbitwaterrootsbasicbonesrelaxskullshapesolidsystemsaturnuranusrotateplantsleavesenergymethodmatterjointstendonfreelyliquidplanetsMercuryjupiterneptunegravityelementmusclessupporttightlycloselyreactionincreasedecreasecontractskeletalmovementcomponentstructureintensityparticlescartilages

Science 2026-05-07

51 Items: AtomCellLavaMoonPreyWindForceGlerbOrbitSolarSoundStormXylemEnergyFossilGalaxyMagnetMatterMeteorMuscleNaturePlanetRocketBalanceCircuitClimateCrystalCurrentErosionGravityHabitatMineralNucleusReptileSpeciesTornadoVolcanoWeatherZoologyFrictionMoleculePredatorSkeletonHurricaneInventionPollutionTelescopeExperimentMicroscopeTemperatureCondensation

Chemistry I Terms 2026-05-14

50 Items: gasmolegramatomacidbaseironliterjouleionicsolidgroupflaskscaleliquidplasmaprotonmattervolumecarbonoxygenbeakeraspirinorbitalneutronethanolbalanceeyewashmolarityenthalpymolalityreactionmoleculecompoundcovalentelectronsolutionpressurehydrogenmolarmasswatchglasstemperaturebunsenburnerperiodictablestoichiometrylewisstructureaceticanhydride...

dd 2026-09-07

50 Items: sunlawmassmoonpullfalltidecorestarforceearthorbitspaceoceanapplespeedfieldcometweightplanetnewtonvacuummotioncenterenergyobjectmattergalaxymeteorcratergravityattractgalileoinertiakineticdensitysurfacedistancevelocityuniverseasteroidsatelliteastronautdirectionpotentialattractionresistanceweightlessatmosphereacceleration

Week 5 Wordsearch 2026-05-21

13 Items: The planet we live on.A process that repeatsTo take in or soak up.All the water on Earth.A very large body of waterWater that falls from clouds.An area or a part of a place.The natural features of an area.Changes from one form to another.A slow-moving mass of ice on landThings that are linked or connected.A large piece of ice floating in the ocean....

Worl Malaria day KEPhSA. 25th April, 2025 2025-04-22

20 Items: What insect spreads malaria?What is the parasite that causes malaria called?Which part of the body does malaria mainly affect?What term is used for medicines that prevent malaria?Which mosquito species is the primary vector of malaria?Which drug is used for radical cure of malaria parasite?Net What is the best way to avoid mosquito bites at night?...

Echo Prea Word Search 2025-08-10

20 Items: The year PREA was signed into lawA person confined in a juvenile facilityA person who has experienced sexual abuseA confidential way for inmates to report abuseKeeping reports and victim identities protectedThe act of notifying staff or authorities of abusePREA standard requiring no tolerance for sexual abuse...

15.1, 16.1, 16.2 - Quiz Part I 2026-02-25

25 Items: A unit of energyThe standard SI unit of energyThe polyatomic ion OH- found in basesA hydrogen ion often represented as H+The H3O+ ion formed in acidic solutionsAn insulated device used to measure heatThe average kinetic energy of a substanceThe measurement of heat flow in a reactionThe total heat content of a chemical system...

Judicialreview Word Search 2024-04-18

10 Items: Highest Federal courtChief Justice of the Supreme CourtWhat is the term of a federal judge?Who are the workhorses of the federal judiciary ?What is the title of the chief official of the Supreme Court?The set of rules and standards by which society governs itself?...

Science- Whole year 1 2026-05-18

15 Items: NONLIVING THINGSAN EDUCATED GUESSDECEMBER 21 OR JUNE 21CLOSEST PLANET TO THE SUNWHERE 2 MASSES OF AIR MEET2 OR MORE ELEMENTS COMBINEDTHIS VARIABLE GOES ON THE X AXISTHIS VARIABLE GOES ON THE Y AXISTRANSFER OF HEAT THROUGH DIRECT TOUCHONE OF THESE ON EARTH’S AXIS TAKES 24 HOURSTHIS TYPE OF ENERGY IS USED DURING PHOTOSYNTHESIS...

The Hunger Games 2026-07-12

15 Items: The hairstyle Katniss wears (5 letters)The symbol on Katniss’ pin (10 letters)The name of Katniss’ stylist (5 letters)How Rue is killed in the games (5 letters)The color of Katniss’ backpack (6 letters)What District 11 is known for (11 letters)The name of the wasp mutations (14 letters)How Peeta hides himself in the woods (10 letters)...

Science 2026-03-20

8 Items: Stores cell sapSite of RespirationSite of PhotosynthesisSupports cell structureSite of protein synthesisSite of Chemical ReactionsControls what enters and exits the cellContains the cell's genetic information

#14 Puzzle "Chemistry" 2024-09-05

50 Items: LABGASIONGOLDACIDIRONBONDATOMCURIEHELIUMSILVERCOPPERMATTEROXYGENDALTONCARBONALKALIPROTONENERGYFORMULAISOTOPECALCIUMCRYSTALPASTEURNEUTRONELEMENTHALOGENMIXTUREORGANICCHLORINEMOLECULEELECTRONANALYSISREACTIONCATALYSTHYDROGENFLUORINENITROGENMENDELEEVPOTASSIUMLAVOISIERINDICATORCORROSIONSYNTHESISMAGNESIUMALUMINIUMCOMBUSTIONEXPERIMENTELECTROLYSIS...

Welcome to 7th Grade Science! 2025-08-01

50 Items: atompurecelltablegeneschargemattermusclecarbonoxygenbioticelementmixturenervousmitosisabioticmeiosisallelesclimatemoleculecompoundreactionchemicalphysicalpropertyorganismmembranekingdomsskeletalsurvivalgenotypetransportdigestionexcretionanaerobicecosystemmutationsphenotypeorganellesatmospherehomeostasisrespirationcirculationadaptationsrespiration...

For The Science Lover 2026-02-10

53 Items: DNAdataatombondcellorbitcometadaptlearnsparknebulagalaxycosmosenergymattermotiontheoryprotonneurongrowthevolvesystemnaturerhythmwondercreateeclipsegravityhorizonelementpatternbalanceelementbalanceimaginestardustasteroidreactionresearchmoleculecatalystsolutionreactionelectroncompoundorganismlightyearsupernovamoonlightcuriositydiscoveryhypothesis...

Science Word Search 2026-04-24

50 Items: GasDataMassHeatPreyStarSolidForceLightSoundWaterCycleRecordMatterVolumeLiquidEnergyMotionPlanetGalaxyMeasureGravityCircuitBatteryHabitatWeatherClimatePropertyVariableEvidenceFrictionOrganismProducerConsumerPredatorMagnetismConductorInsulatorEcosystemCommunityExperimentHypothesisConclusionPopulationDecomposerAdaptationObservationTemperature...

End of Year Science 2026-05-19

51 Items: airwindheatdatacellmassgramhailmodelsolidclaimbloodlightopaquesystemplasmaliquidvolumeenergymatterupdrafthealingcelsiusgravitydensitythermalweatherfunctionevidencevariableparticlereasoninginferencefarenheitbarometerradiationrefractionmicroscopereflectionabsorptionexperimenthypothesisatmosphereconvectionconductionevaporationtransparentobservation...

Science Detectives 2026-09-12

50 Items: SEEGASSIZEODORHARDSOFTCLUEHEARKNOWWARMCOOLBENDSORTCOLORSHAPEROUGHHEAVYLIGHTSMELLTOUCHCLAIMTHINKSOLIDRIGIDGROUPMATTEROBJECTCHANGESMOOTHNOTICESENSESDETAILLIQUIDWEIGHTSCIENCETEXTURECOMPAREMEASURESURFACESIMILAREVIDENCEPROPERTYDESCRIBEMATERIALFLEXIBLEINFERENCESCIENTISTDIFFERENTOBSERVATIONTEMPERATURE

Mitochondria Word Search 2025-06-03

18 Items: When a gas turns into a liquid, often forming droplets on cooler surfaces.A substance that speeds up a chemical reaction without being used up itself.The rigid, outermost layer of Earth that includes the crust and upper mantle.A substance that triggers an immune response, often from a virus or bacteria....

Week 5 Physical Science 2025-10-08

9 Items: Where an electron most likely is.A subatomic particle with no charge.The measurement of the amount of particles.A subatomic particle with a positive charge.Atomic ___ is always equal to the number of protons.___ is determined by the number of neutrons of an atom.___ electrons are the ones on the outermost energy level....

Antitrust: Word Search 2026-09-10

25 Items: The total sum of money a business pays to its employees.When total expenses or outflows surpass total revenues or inflowA government limit on quantity or monetary value of a specific good.Gain: The profit you make when you sell an asset for more than you paid for it.Rate: The price of one country's currency expressed in terms of another currency...

David's Cool Waves Word Search 2022-11-28

10 Items: rarefactionlowest point on a wavehighest point on a wavemeasurement of maximum displacementis the measurement of the frequencywave moves in medium parallel wave motionis the distance of one complete wave cyclearea of maximum displacement in a longitudinal wave.wave that moves the medium perpendicular wave motion...

Leahs space themed word sherch 2023-12-18

10 Items: The start of springPeople that study spaceAlso known as Urisa minorAlso known as Urisa majourStars that make shapes in the skygive off, send forth,or dischargeThe reserch of eveything in the universeThe beliefs of the position of the starsmeans the sortist day of winter solsticeDust and ice particals that orbit the sun

LA 2025-01-23

11 Items: or play.represent the word.supported with evidenceexpression of a point of view about aThe task of combining sounds rapidly, to– A struggle between opposing forces in adifferent things to show the similarities.A comparison of the features or qualities of– The specified or clearly implied person(s)– An inclination or tendency towards an idea...

4th2 2026-08-31

8 Items: To hold or keepThe origin or start of somethingThe movement of any type of energyThe movement of heat between two thingsMaterials that allow energy to pass through them easilyMaterials that block or slow down the passage of energy through themThe movement of tiny particles called electrons that generate electricity...

Sana's Word Search! 2026-05-22

19 Items: a lovely catbookish nooka warm lightpoetic citrusbest pasta placea true blue banda flower facing the sunthe best kind of camerayou're not obsessed with ityour biggest fan (besides me)something it's never too cold forsinger dacus and the name of a cara trusty vehicle with many memoriesobligatory mention, queen of all eras...

EYGPDiabetes 2026-02-06

8 Items: Process of forming new glucose moleculesBreakdown of triglycerides into FFAs and glycerolFound in Type 1, a result of increased ketone productionWhat is the main cause of end stage renal disease in the world?The name of the triad used to identify symptomatic hypoglycaemiaDiabetic nephropathy includes a rise in the urinary excretion of?...

Arkansas and Border States 2026-04-28

7 Items: TexasArkansasMissouriOklahomaLouisianaTennesseeMississippi

Fish! 2025-11-25

10 Items: A scientist who studies fishProtective coverings for gillsSkeleton in rays & sharks made of thisName of further back set of paired finsWhat fin is the large “sail” in a sailfish?Region of fish body w/ 2 sets of paired finsWhat bony fish have to keep them from sinkingThe spidey sense organ in fish: ____________ line...

World Malaria day KEPhSA. 2025-04-22

19 Items: What insect spreads malaria?What is the parasite that causes malaria called?Which part of the body does malaria mainly affect?What term is used for medicines that prevent malaria?What is the best way to avoid mosquito bites at night?Which mosquito species is the primary vector of malaria?Which drug is used for radical cure of malaria parasite?...

Bunny vs monkey 2026-07-17

17 Items: PigMULBunnyMonkeySkunkyWinnieTotal-chaosBung-amungusBunny-bonanzaMachine-mayhemBunny-vs-monkeyThe-human-invasionThe-league-of-doomMultiversers-mix-upThe-great-big-glitchThe-supersonic-aye-ayeRise-of-the-maniacal-badger

Monalisa Word Search 2023-04-06

11 Items: italymonalisalast-supperrenaissancevitruvian-mansalvator-mundistudy-of-handsla-bella-princessleornado-da-vinciorigin-of-the-rockslady-with-an-ermine

Nature 2024-10-31

10 Items: is precipitation in the form of ice crystals.an area of land surrounded by water on all sides.is a large natural body of water surrounded by land.A parcel of land usually used for agriculture or in the open air.is a steep, high section of rock or shore that drops sharply downward....

Understanding Plate Tectonics 2026-02-13

12 Items: – What forms when plates pull apart on land?– What process forms new crust at mid-ocean ridges?– What supercontinent existed millions of years ago?– Who first proposed the theory of continental drift?– What kind of rock records Earth’s magnetic field reversals?– What percentage of earthquakes occur along plate boundaries?...

Mitochondria Word Search 2025-06-03

18 Items: When a gas turns into a liquid, often forming droplets on cooler surfaces.A substance that speeds up a chemical reaction without being used up itself.The rigid, outermost layer of Earth that includes the crust and upper mantle.A substance that triggers an immune response, often from a virus or bacteria....

STEM word search 2025-06-03

18 Items: When a gas turns into a liquid, often forming droplets on cooler surfaces.A substance that speeds up a chemical reaction without being used up itself.The rigid, outermost layer of Earth that includes the crust and upper mantle.A substance that triggers an immune response, often from a virus or bacteria....

Command Economy 2025-01-16

14 Items: ~ Physical money~ Plan for managing money~ Buyer of goods or services~ Creating goods and services~ Group that governs a country~ Creator of goods or services~ Activity or condition of competing.~ Economy controlled by the government~ An authoritarian country in East Asia~ Choices made after considering options...

Eco Chapters 12 & 13 Extra Credit 2022-12-15

15 Items: The Great _______A general increase in priceThe business cycle has ___ phasesGross National Product abbreviated isIn 2008 the U.S. experienced a ________A period of economic growth in the business cycleA period of economic decline in the business cyclebusiness cycle phase that is a recession/depression...

AHA SLEEPOVER 2025 2025-12-11

15 Items: Mr Suleiman’s surnameUstadh Adam’s 3rd son’s nameName of Class of 2024 head boyWhat is Aliyu Tanko’s full nickname?Number of houses in Al-Hidaayah AcademyThis family have enrolled 5 kids in AHAWhat book do AHA students read in Year 8?The male companion green house is named after2026 is AHA’s ___________ year since opening....

Beacon Primary Eco Stewardship Puzzle 2025-08-19

9 Items: To work jointly towards the same end.Growing a mix of crops in the same area.The science of managing farms as ecosystemsThe activity or business of growing crops and raising livestock.the state or quality of being dedicated to a cause, activity, etc.An effect caused when something is missing and the whole world is affected....

Human Interaction 2025-02-27

18 Items: the cutting down of foreststhe gases that surround the earth (close to earth)hazy air that contains smoke or particles or other pollutants.all the waters on the earth's surface (e.g., rivers, lakes, oceans)Gases in the Earth's atmosphere trap infra-red heat near the Earth.the hard, solid part of the earth (e.g., the soil and rock near the surface)...

Popula YA Novels 2024-07-12

17 Items: meWingThiefQueenPotterU GiveRunnercaravalhatchetof Glassof Crowsdivergentin the Ryein Our Starshunger Gamesheartstoppersummer I turned Pretty

Wants Word Search 2026-03-04

19 Items: Video conferencingThese are the needs for personalA multilingual online dictionary.It always begins with an equal sign.Combinations of operand and operators.This is the amount of interest given to aBuyer and seller relationship that buildsTravel guide that provides information ofPersons who purchase products or services....

Energy Word Search 2024-01-08

8 Items: The ability to do work.The energy of a moving object.The energy of an object at height.The energy stored in chemical bonds.A ... is an object or group of objects.What is the standard measure of energy?Baking in an oven is an example of ... energy.Magnetic, kinetic and elastic potential are all examples of...

Cor Chronicle Word Search 2026-04-28

16 Items: The Cor _Graduating!Dumb Ox party.Food supplier.Church of the _Printed writings.Graduate college.The man in charge!Undergrad college.Official UD mascot.Unofficial UD mascot._ College of Business.Natives to UD's trees.Renowned history prof.Beloved Dean of Students.Major that can't stop thinking.

festivals 2024-12-12

7 Items: Parsi New Yearcelebrated in Keralathe festival of lightthe festival of colourscelebrated at the end of Ramzancelebrating the birth of Jesus Christcelebrated to mark the birth of Guru Nanak Dev

4thmix2 2026-08-11

8 Items: To notice or seeA way of doing somethingThe ability of a substance to dissolveThe material that something is made ofWhen a substance becomes too small to be seenWhen all parts are still present and not lostA combination of 2 or more substances where one of the substances dissolves...

Chapter 17 Part 2 2023-08-30

33 Items: Recording of financial transactionsAn individual's or business's net worthSelling goods for use rather than for resaleSelling goods for use rather than for resaleA single statment of a business's purpose (2 words)An image or phrase that identifies your goods or servicesServices offered to consumers for little or no cost (3 words)...

Central-West Region Word Search 2025-08-20

7 Items: ________ is a mash-up food________ is the capital of Mato GrossoThe vegetation of Mato Grosso is ________________ is the capital of the main state of BrazilThe name of the artists that play mash up is ________Main economy of the central-west region is the ________...

ANCIENT ROME 2023-11-23

11 Items: a court or tribunal.an inhabitant of the ancient African city.an inhabitant of a particular town or city.a semicircular seating gallery in a theatre.an ancient city in Italy, southeast of Naples.a member of one of the original citizen families.a person who was in someone's family in past times....

Command Economy 2025-01-16

14 Items: ~ Physical money~ Plan for managing money~ Buyer of goods or services~ Creating goods and services~ Group that governs a country~ Creator of goods or services~ Activity or condition of competing.~ Economy controlled by the government~ An authoritarian country in East Asia~ Choices made after considering options...

Command Economy 2025-01-16

14 Items: ~ Physical money~ Plan for managing money~ Buyer of goods or services~ Creating goods and services~ Group that governs a country~ Creator of goods or services~ Activity or condition of competing.~ Economy controlled by the government~ An authoritarian country in East Asia~ Choices made after considering options...

Reconstruction's Impact 2025-08-29

11 Items: taxTestb Hayesof 1877b wellsRedeemerCrow Lawswashingtonw.e.b.duboisgrandfatherclauseRights Act of 1875

unit 19 word search 2024-03-26

12 Items: a married woman.the murder of a father.having to do with a son.children or descendants.a founder of a line or race.having the qualities of a father.one related to or associated with.the study of families and descendants.To regularly visit or give business to.having the qualities of a mother, motherly.person living outside his or her native country...

Review Word Search 2025-12-08

12 Items: 25 kDa50 kDaLiquid portion of bloodEnzyme Linked Immunosorbent AssayMost abundant immunoglobulin in serumProduct of ammonium sulfate precipitationMethod of analyzing protein concentrationObtained after centrifugation during session 2Fraction obtained by using an anion exchange columnUsing a semipermeable membrane salts were gradually removed...

Unidad 2B 2024-02-01

30 Items: ofmyflagdeskdooryourclocktablechairtherein/onposterscreenwindowbehindWhere?it's abookbagnext tonext tocomputerkeyboardon top ofunderneathwastebasketin front ofWhat is this?computer mousepencil sharpenerthere is/there are

Unidad 2B 2024-02-01

30 Items: ofmyflagdeskdooryourclocktablechairtherein/onposterscreenwindowbehindWhere?it's abookbagnext tonext tocomputerkeyboardon top ofunderneathwastebasketin front ofWhat is this?computer mousepencil sharpenerthere is/there are

Hesitate Word Search 2025-11-03

29 Items: exactly the same in every detail.physical or mental damage or injury.relating to a large company or group.to make someone feel afraid or scared.a feeling of wanting what someone else has.to make someone slightly angry or irritated.to say no to something; to reject or decline.a set of parts in a machine that work together....

Vocabulary Puzzles 2024-04-26

14 Items: a short crya faint cryan evergreen busha force against youtired and exhaustedfighting or arguing noisilythe feeling of regret sadnessmove swiftly and fast smoothlyvery quiet barely hearing the sounda quiet and soft speech of somethinga land outside of the main part of landNot being able to tell what's happening next...

Command Economy 2025-01-16

14 Items: ~ Physical money~ Plan for managing money~ Buyer of goods or services~ Creating goods and services~ Group that governs a country~ Creator of goods or services~ Activity or condition of competing.~ Economy controlled by the government~ An authoritarian country in East Asia~ Choices made after considering options...

Q4, Weeks 35-40 (Last Set of Vocabulary!) 2026-05-12

15 Items: offensiveto make impossiblea lot of somethingwords of admirationrequiring hard laborconcise; to the pointa remedy for all illsharmless; not offensiveinexperienced and immaturelacking color and seeming illhaving or showing good judgementdeveloping intelligence ahead of timea strong inclination toward something...

Bud, Not Buddy pages 1-50 2024-03-07

16 Items: to begindefying authoritycustomary or usualcautious or watchfulto be sad, down in the dumpsfeeling or showing gratitude or thanksthe estimation in which a person is heldan advertisement intended to distributionto say something quietly in an unclear wayto import or export goods without permissioncare for the future; an act of looking forward...

Health Game 2024-04-12

17 Items: food high in fiberdrink high in calciumA food high in proteinVitamin good for energyA really unhealthy sugarA unit of measure of energyUnhealthy way to cook food-apples are a good source ofSugar molecules can be calledWhat do you need to stay hydrated and wellfood without any added preservatives is called...

Beha’alotcha 2024-06-15

17 Items: PesachShalomanointed“Yeshua”“Chanukkah”Beha’alotcha“korban”, Hebrew; “to draw near”The prophet of Haftarah Beha’alotcha.The Children of Israel’s first stop after Sinai.All the tribes brought gifts (Numbers 7) except this tribe.what material were the trumpets of Numbers 10 to be made of?How many ate from the five loaves and two fish? (Matthew 14)...

Equine Equipment and Facilities 2025-04-21

17 Items: near at handcapable of being reachedof the utmost importanceable to exist for along timeartificially produced materialto clean or disinfect and objectact or process of removing liquidsan established way of doing thingssufficient for specific requirementsystem or means of providing fresh airsomething built to serve a particular purpose...

Boxing 2025-09-14

20 Items: Filipino boxer nicknamed “Pac-Man”Famous heavyweight champion of the 1920sDefeated Jack Dempsey twice in the 1920sRetired American boxer with a 50–0 recordBorn Cassius Clay, nicknamed “The Greatest”Became the youngest heavyweight champion in 1986Panamanian lightweight nicknamed “Hands of Stone”Lost to Muhammad Ali in their famous 1964 title fight...

Wayaye 2025-12-04

11 Items: Liv's manBen's favourite ciderWhat is Hoz's first name?What street does Cryer live on?Price in £ of a drink on TuesdayName of girls uni WhatsApp groupName of strip club next to SwingersName of fish shack on Tynemouth BeachBest bar on Osborne Road - contentiousInstrument Joel plays (afters circa 2018)Object Brown threw at the wall of the boys house

A Fun Word Search 🤩🤩🤩 2026-06-13

11 Items: English or Spanish?A province in ThailandTryta gettin’ strongerA country, not far from here(v.) to study a lot (KVIS slang)The most wonderful dish ever createdThe highest area of the mountain rangeA good source of protein, unique to KVISAnother favorite subject of พี่รหัสน้องคิดดีOne of the favorite subjects of พี่รหัสน้องคลัง...

Spelling Crossword 3.4 2026-05-04

17 Items: — Very bad or unpleasant.— More than two but not many; some.— Not able to occur, exist, or be done.— Relating to the law; permitted by law.— An insect with a hard shell and wings.— Relating to the human voice; outspoken.— To trip or momentarily lose one's balance.— A metal disk awarded as a prize or a mark of honor....

Martinluthor Word Search 2024-10-08

16 Items: practicefrom 1618-1648red ninja turtwrote 95 thesesmade the monalisaorange ninja turttoo rid of witchesttrade started hereway of seeing peoplewritten by martin luthorestablished for calvinismdivorced beheaded and diedart technique during the renaissancetwo acts passed by parliament of englandeuropean history during 14-16th centuries...

BABY SEARCH 2026-01-24

16 Items: favorite carfirst movie datefavorite pokemonmy favorite colorfavorite superheroyour favorite dessertour anniversary monthone of our favorite foodsone of your favorite animeour first anniversary tripwhat we drink in the morningfavorite character of all timeour favorite activity togetherwhere you realized you loved mewhat you get after you eat a lot...

World Safety Month Word Search 2 2024-04-08

20 Items: I wear my _____I _____ the joblikelihood x consequenceI follow my lifting _____I _____ myself against fallsabsolute way of life at TerexI _____ myself in a safe zonethe most effective hazard controlset of behaviors that prevent SIFsthe least effective hazard controlthink _____, work _____, home _____set of behaviors that prevent common injuries...

Saints 2025-11-20

20 Items: son of Jacobjesus' motherwife of NabelJesus' apostlecatholic italian teenagerknown as "the little flower"has her own book in the biblewiped Jesus' face with a clothteenage student of St John Boscoa French peasant heroine and saintQueen, who saves the Jewish peoplean Italian mystic and pious laywomanItalian Catholic martyr who died at age 11...

Spelling Lesson 2: General Words 2025-11-20

23 Items: ancestorswild, unrulyto understandfull of emotionone who teachesto figure out; discovernot depending on anyonethat which displays harmonyin a kind and courteous mannerinspiring wonder, very excitingheavy; difficult; like a burdenthe part of the face above the eyesone who appears before someone elseto tell what will happen in the future...

Mega Science Vocabulary Puzzle 2025-12-16

22 Items: seemtake inwhen light bendsa form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasspin in a circle around an axisa noncontact force of attractionwhen light bounces off a surfaceforces that have the same strengthforces that have different strengthsan imaginary line from North to South...

Spring, March, April, May 2026-03-22

23 Items: Help!A time of chaosA natural drink.An egg based saucePerhaps. Buzz, BuzzMaybe she's born with itNot a good day for Julius.The head of a town or cityDaffodils, tulips and crocusA singer nicknamed 'the boss'Max Dymek's favourite vegetable.Alice met him with the Mad Hatter.A time get rid of the winter dust.Can you eat these snacks in Saigon?...

Possibly Word Search 2024-08-20

14 Items: waaaaapossiblypositionparallelparagraphpneumoniapoke borbpopulationparaphernaliameow of alolathe very besthello internetthe god of burger landmy favorite Mario character

Possibly Word Search 2024-08-20

14 Items: waaaaapossiblypositionparallelparagraphpneumoniapoke borbpopulationparaphernaliameow of alolathe very besthello internetthe god of burger landmy favorite Mario character

Chemistry Chapter 2 2025-11-17

12 Items: Electrons in the outermost shellThe counting term used in chemistryAn element with 1 proton in its NucleusThe name of each row in the periodic tableThe name of each column in the periodic tableWhat happens when a neutral atom gains electrons?Gold, iron, silver, and copper are all examples ofWhat type of ions are formed when atoms lose electrons?...

Ecology Review 2026-03-03

12 Items: 13-mile layer around planet EarthOfficial name of a living thing’s home.Nonliving factors influencing an environment.The name for the category of land ecosystems.Long-term relationship between 2 different speciesA group of the same kind of organisms in one place.A large geographic region w/ characteristic plants & animals....

M4 IGCSE P3 and P4 vocabulary 2023-12-13

10 Items: SI unit of massSI unit of forcealso known as net forceThe pull of gravity on an objectThe fixed point about which an object turns.A state in which opposing forces are balanced.a push or a pull on an object to make it move.The upward push of a liquid or gas on an object.movement in reverse of the direction of a clock....

Invertebrate vocab 2024-01-22

27 Items: cucumbers.and clams.echinoderms.respiration.pollination.in arthropods.identical to the parent.Organisms that primarily feed on plants.Animals lacking a backbone or vertebral column.Organisms that primarily feed on other animals.The variety of life within a specific ecosystem or habitat....