states of matter Word Searches

DeeDee & Josh 2026-06-28

38 Items: Go to takeoutCollege mascotBest Mans nameGrooms employerGrooms hometownSons middle nameBrides first jobSons birth monthGrooms middle nameCouples first dateGrooms college jobMother of the brideGrooms favorite beerColor of grooms eyesBrides favorite foodCollege they attendedGrooms favorite sportGrooms favorite colorBrides favorite candy...

Unit 5 (The Judiciary and Bureaucracy) 2025-12-08

11 Items: Federalist78MarburyVMadison___________ Authority_____________ Authority_______________Commission_________________CommissionDepartment of ______________Department of ________________Department of _________________Department of _______________________________ Protection Agency

WEEK 2 SPELLING SEARCH 2026-04-06

20 Items: TO COME INTO BEINGOF THE FIRST IMPORTANCEMADE UP OF SEPARATE PARTSTHE ABJECTIVE CASE OF WHOIN THE MANNER THAT IS MOST USUALA CARDBOARD OR PLASTIC BOX FOR STORAGEPERTAINING TO, OR INHABITING THE TROPICSTHE FEATURES AND TRAITS IN AN INDIVIDUALAN AUTHORITATIVE DIRECTION OR INSTRUCTIONA MOUNTED GUN FOR FIRING HEAVY PROJECTILES...

Riser Word Search 2023-02-23

25 Items: The outer wall of the triangular roofVertical height for each step in the ladderThe tip of the step that sticks out like a noseThe top floor of a building directly under the roofA great way to cover and protect your home from the sunThe lowest part and is in direct contact with the groundA staircase constructed between two floors in a building...

Night Weeks 1-5 Vocabulary 2024-11-19

50 Items: CARRIEDGERMAN SOLDIERSDEEPLY RELIGIOUSWEARING EYEGLASSESTHE JEWISH NEW YEARTHE SOUND OF A BELLSOMETHING BURDENSOMEA RUFFIAN OR HOODLUMA PERIOD OF TWO WEEKSHANDCUFFED OR FETTEREDANOTHER NAME FOR A PIGA FALSE SHOW OR PRETENSETHE CLUB CARRIED BY POLICESEVERE PAIN IN THE ABDOMENA PERIOD OF FORCED ISOLATIONOUTWARD ASPECT OR APPEARANCE...

Year 9: Physics Word Search 1 2026-04-28

17 Items: the ability to cause change.to bounce energy off a surface.to take in energy, such as heat or light.to give off energy, such as heat or light.when energy changes from one type to another type.energy the energy an object has because it is moving.how much mass is packed into a given volume of a substance....

basic electricity 2025-10-11

32 Items: ArcFlashthe rate of doing worka simplified schematic diagramthe unit of measurement for voltagethe bypassing of a load by a conductora coil of wire wrapped around a soft iron corehaving a continuous path for current to followa device that converts AC voltage to DC voltagethe basic unit of measurement for electric current...

Summer Study Guide Part 1 2026-06-22

13 Items: improperly forward or boldhaving a smooth soft surfacea dark purplish-red to dark brownish-red colormarked by uncontrollable, extreme emotion.canteenSomewhere between being a student and a professionala decorative edge made of hanging strings of fabric.When your body has a shortage of healthy red blood cells....

Kathy and Madi Word Search 2025-10-03

15 Items: EggYUHYoyiNOGGAPotatoAvatarBailarArcaneBAF ______Kia Soul NameChristmas SayingWe're Both Gay ForBest Year of HighschoolGreatest game of all timeGreatest Band of All Time

ENGLISH WORDSEARCH 2025-11-06

21 Items: ToyKellyFrankEscapeRenewalMimesisPatrickBiaggioInnocenceof WisdomDiscoveryCatharsisChallengesChallengesof PassageTransformedUnderstandingMetamorphosisOrdinary Worldthe WildernessNew World Order

project 5 2025-08-20

10 Items: A mash-up bandThe capital of GoiasA typical food of GoiasA mash up of horse and lionA city of Mato Grosso Do SulA mash up mythological animalA state of Central West regionA mash up of soccer and voleiballA typical food of Central West regionA mythological figure of Greece and a mash up animal

Business Funding Word Search 2024-12-04

17 Items: A large organisation or institution.Able to be deducted from taxable income.Offered by angel-investors with expertise.Finance from the owner for business purposes.The creation of new ideas, products or methods.The quality of being trusted for loans or grants.When the market has a large number of similar business....

Should Australia have a Bill of Rights? Word Search 2026-05-25

17 Items: HumanCivilRightsAccessEqualityAustraliaDemocracyPoliticalReferendumProtectionRule of LawConstitutionInternationalBill Of RightsLegal DocumentInterpretationFounding Fathers

Indian Literature 2025-09-29

10 Items: He is the author of Shakuntalawho is the author of epic RAMAYANA?collection of written hyms in praise of the godComprising prose prayers and litanies for ritualswhat is the name of Rama's wife who get kidnapped?refers to the collection of ancient religion texts from india...

Unit 9: Climate Change 2025-04-29

15 Items: The warm periods that occur between ice ages.A mixture of gases that surrounds a planet or moon.the removal of large areas of forests for human purposes.the development of towns and cities on previously natural areas.Gases Gases in Earth's atmosphere that trap heat near the surfaceWarming An increase in the average temperature of Earth's surface....

Medical Abbreviations 2 2025-02-04

19 Items: historyfractureafter mealsbefore mealsdate of birthcubic centimeterover the counterdate of admissionlower extremitiesdo not resuscitatenon-weight bearingbathroom privilegeswithin normal limitsdischarge/discontinueagainst medical advicecentral nervous systemactive range of motionactivities of daily livingtemperature, pulse, respiration

Sharecropping Word Search 2024-11-04

16 Items: The ability to read and write.A part of a legal document or contract that has its own meaning.A change or addition to a law or document, like the Constitution.A person who believes that one group of people is better than all others.A person who has served in the military, often someone who has fought in wars....

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

NATURE 2026-03-31

12 Items: What determines the color of light?What is light bouncing off a mirror?What is a push or pull on an object?Where can heat only travel via radiation?What is the amount of matter in an object?What energy is released by splitting atoms?What force opposes motion and creates heat?What study deals with air moving around objects?...

U10 2026-01-12

13 Items: Occurring or appearing once every three months.To have enough money to pay for or buy something.Large or important enough to be worthy of attention.The cost required for something; the money spent on something.An estimate of income and expenditure for a set period of time.A thing given in recognition of one's service, effort, or achievement....

Ophelia + Mikey 2026-02-02

12 Items: Best manProposal cityProposal monthName of our catName of our first carOur favourite cuisineWho’s the coffee drinkerNumber of years togetherOpehlia's favourite hobbyNumber of siblings between usMikey's favourite musical decadeNumber of countries visited together

40 literary terms,elements,& devices 2022-10-07

40 Items: meaningA words literal definitionSomeone who is the voice of the poem.the time and place in which a story is toldA person who tells a story in a film or literatureA figure of speech that is an exaggeration for emphasisAn obstacle that characters have to overcome in a storyThe main message that is being conveyed throughout a story...

MileHigh Vocab 2025-10-29

50 Items: Proof of LossReplacement CostActual Cash ValueContinuing EducationTexas Insurance Codeuncertainty of a loss.Commercial Ocean MarineCommercial Inland MarineRecoverable DepreciationInsurance Service Officelegislative acts or laws.Additional Living ExpensePersonal Injury ProtectionCommercial Property PolicySpecial Investigation Unit...

Los Preposiciones 2026-04-22

11 Items: underbehindbetweennext toin/on/atfar fromclose toon top ofin front ofto the left ofto the right of

Yoto Carnegie 2023 Word Search 2023-05-03

9 Items: The number of shadowers in TeamBerkoThe surname of the author of 'When Shadows Fall'TeamBerko (The name of our school shadowing group)The title of the shortlisted book by Jessie BurtonThe title of the shortlisted book by Patrice LawrenceThe surname of the author of 'The Light in Everything'The month of the year in the title of the 2022 medal winner...

Nervous System 2025-02-11

23 Items: Relating to movementRelating to the synapseAnother term for a neuronUnpleasant sensory experienceStructure that detects stimuliSupporting cells of the nervous systemRelating to sensation or sensory organsThe control center of the nervous systemInsulating layer around some nerve fibersThe fundamental unit of the nervous system...

Emor 5.0 2025-05-11

21 Items: KorbanPesach“HaShem”“set apart”“Commandments”‘priests’, Hebrew.The day of complete rest.The 10th day of the seventh month.Punishment for blasphemy of The Name.Animal korbanot are to be without ______.What kind of oil was used in the menorah?The Haftarah Emor comes from the book of ______.A kohen is to marry a ______ from among his people....

February Word Search 2025-11-24

20 Items: Strong emotion or intense affection.A gentle feeling of fondness or care.To hold someone dear or value deeply.Comfortable and warm during chilly days.Sweet treats commonly gifted in February.To remain in winter rest, nearing its end.Injury caused by extreme cold in late winter.The cold, frosty quality of February weather....

Altar Word Search 2026-02-06

20 Items: – Man's conversation with God.– Help offered to those in need.– Trust in God and His teachings.– A symbol of goodness and truth.Bible – The holy book of Christians.– Following the commandments of God.– A state of tranquility and harmony.– The place where believers pray to God.– The one who watches over and protects....

S 2024-04-09

19 Items: (mystery)(peculiar)(watchful)(captivating)(proper manners)(group of stars)(sad and pensive)(theatrical dance)(science of sound)(calm and peaceful)(related to horses)(related to cooking)(sentimental longing)(art of good cooking)(lively and energetic)(complex musical piece)(ability to bounce back)(study of celestial bodies)...

MAG1 NFS Unit 7 Review 2026-06-16

19 Items: Air that moves.A tool to measure rainfall.Swirling wind storms on land.One of four times of the year.A strong storm with lots of snow.A scientist who tells the forecast.A word to describe the air outside.A chilly season with falling leaves.The coldest season with lots of snow.Low temperature, usually during winter....

ENVIROMENTAL 2023-03-15

20 Items: Worldwideits powerIts all around usIts pure not manmadeDefective or not in useThe industry of buildingRenewable or non renewableThe reusing of old materialsa threat from global warmingIs harmful to the environmentThe release of greenhouse gasesA Hydrocarbon found in the groundThe conversion of sunlight into energy...

Citizen Word Search 2024-12-05

12 Items: a member of a political communitythe care, guardianship, and control exercised by a deitythe principles of virtue as expressed in Judeo-Christian teachingsthe status of a citizen with its attendant duties, rights, and privilegesa rule of conduct or procedure established by custom, agreement, or authority...

PID 2023-01-31

47 Items: shayjulylifetaxespresscolonyvotingspeechstatesnationunitedanarchylibertycabinetfederalarticlesjudicialdictatormonarchycolumbuspropertyfranklinsenatorscitizensreligionassemblybeararmspetitionamendmentexecutivesovereignjeffersonwashingtontabularasademoncracyrevolutionkinggeorgedeclarationlegislativeindependencebillofrightsconstitutionstateofnature...

Child Welfare Information Gateway 2024-03-19

45 Items: kindatachattoolsyouthcourtsequitystatestraumatribeslibraryneglectparentswebsiteadoptionoutreachresearchbelongingdiversityinclusionknowledgewellbeingworkforcecaregiversengagementevaluationfostercarepermanencypreventiontechnologycommunitiespartnershipchildwelfaremaltreatmentpublicationscollaborationgrandfamiliesmodernizationreunificationsubscriptions...

AP World Final 2025-12-09

21 Items: Religious text of IslamHinduism, Buddhism, Islamplace or study in context.Exchange of goods and servicesa follower of the religion of IslamFaith, Prayer, Alms, Fasting, PilgrimageLink North and West Africa. Moved salt and goldcommon goods and luxury goods in large quantitiesa particular attitude or way of considering a matter....

Days, Months, Celebrations 2025-05-22

11 Items: First day of the week.The day you were born.Last month of the year.The beginning of spring.The start of the weekend.The last month of summer.People go to church on the day.The day of love with chocolate.A holy celebration with presents and Santa.Resurrection of Jesus, egg hunt and bunnies.Spooky, monsters, ´trick or treat´, costumes.

States in the Southeast 2020-09-03

10 Items: GeorgiaAlabamaFloridaKentuckyVirginiaTennesseeMississippiWestVirginiaNorthCarolinaSouthCarolina

States and Their Nicknames 2024-09-18

10 Items: AlohaoceanGoldensoonerPelicanbeehivebuckeyeSunshinelonestarevergreen

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: SCARFPARTYPARADETINSELCOOKIESHOLIDAYSNOWFALLPEPPERMINTWINTERTIMENUTCRACKER

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: ICEYULECAROLCLAUSTINSELWINTERSNOWMANPRESENTORNAMENTPOINSETTIA

Musical Genres 2024-03-11

17 Items: suiiimusic popularmade for moviesA sub-genre of pieclub and party musicpopular music of MexicoPopular music of Jamaicapopular music of Argentinahad its "boom" in the 1940'senjoyed in theatres and hallscommonly uses electronic drumsguitars and drums and keyboardscategory of musical compositionmusic that is popular in Colombia...

Reformation 2024-04-18

17 Items: Kings or queens.Church officials.Local church community.Official letter from the Pope.Church tax equal to 10% of income.Church court that punishes heresy.Period of art and learning revival.Major religious change and movement.Group of people gathered for worship.Formal statements of religious belief.Biased information to influence opinion....

6th Grade Review 2025-05-05

20 Items: FCCLA's official flowerWhat the F in FCCLA stands for.The number of teaspoons in a tablespoonThe amount the recipe makes (Ex. 16 cookies)Red, yellow and blue are these types of colors.One of the MyPlate food groups that includes cheeseOne of the MyPlate food groups that includes chickenOne of the MyPlate food groups that includes broccoli....

Video games 2024-10-30

16 Items: manFifaringhalomarioRobloxmarvelof wartetrisof dutypokemonunravelFortnitevalorantminecrafttakes two

Here’S Word Search 2025-03-21

55 Items: Having a clear intention or goalA purpose-driven goal or objectiveWork done to help or benefit othersWorking together towards a common goalA new plan or effort to achieve a goalUnity and mutual support within a groupSomething given or done to help a causeAssistance provided to those in distressHelp or support given to someone in need...

Plankton vocab 2024-01-22

22 Items: respirationother organismsLargersized plankton visible under a microscopeSmall crustaceans that are a common type of zooplanktonExtremely smallsized plankton smaller than microplanktonSmall animals that feed on phytoplankton or other zooplanktonOrganisms that obtain their energy by consuming other organisms...

Askiathegreat Word Search 2024-10-04

24 Items: Africa's largest lakeAfrica's tallest mountainthe world's longest rivertheologian from Alexandriatheologian from AlexandriaAfrica's longest mountain rangegreatest ruler of the MaliEmpirethe largest rift in theearth's surfacegreat early church fathers and martyrs from Carthagegreat early church fathers and martyrs from Carthage...

Attachment Word Search 2026-04-15

14 Items: ______ refers to one main primary attachment figure______ found some infants form multiple attachments______ means attachments increase chances of survival______ theory explains the effects of lacking attachment______ found evidence supporting one main attachment figure______ showed attachments can form after the critical period...

Western Front Key words 2026-06-23

17 Items: Caused by blocked blood flowBattle of ___, April to May 1917Flu like symptoms, caused by liceBattle of the ___, July - November 1916Battle of ___, November - December 1917Types of transport, motor ___ and horse drawn ___Large military guns which can fire bullets longer distancesThree battles took place in this town, in 1914, 1915, and 1917...

Med terms 2026-04-23

12 Items: Inflammation of the pleuraInflammation of the pharynxSurgical removal of all or part of a lungAn accumulation of fluid in the lung tissuesThe diagnostic measurement of physiological activity during sleepSharp chest pain that occurs when inflame pleural membranes rub against each other...

The Southern United States Capitals 2026-04-08

14 Items: AustinAtlantaRaleighJacksonColumbiaRichmondFrankfurtNashvilleLittleRockBatonRougeCharlestonMontgomeryTallahasseeOklahomaCity

Dungeons 2025-10-14

17 Items: itemMagicchainsDragonszombieskingdomof EvilmonstersTreasureand Doomof KingsPrisonersskeletonsadventureLabyrinthand poisonsTreacherous

MIND OVER MATTER 2026-05-29

6 Items: LEADERVICTORYAGILITYINSTINCTSTRENGTHENDURANCE

Thermal Energy Word Search 2024-09-23

40 Items: sunhoticeaircoldfiremasstimewoodmoneymetalstovefrozenenergysystemmattercoppercelsiusplasticsciencemaximizeminimizecriteriaaluminumlavalampradiationconductorinsulatorstyrofoammaterialsconductionconvectionfahrenheitconstraintthermometertemperatureenvironmentheattransferthermalenergykineticenergy

Earth Sci 2025-03-10

41 Items: DNANeonLifeStarFireGlobeWaterArgonFungiStateFluidPlanetOxygenHeliumCarbonTheoryMatterPlantaeGlucoseDioxideHydrogenTungstenAnimaliaOmnivoreCreationMagneticReactionChemicalBacteriaPlanetaryCelestialOxidationDistilledEukaryoteCarnivoreHerbivoreCombustionProkaryoteHypothesisPhotosynthesisChemosynthesis

38 - Physics Terms 2025-07-12

40 Items: atomheatfieldgammalaserlightwavesenergyforcesfusionjoulesleptonmagnetmattermomentphotonplasmaquantascalarspinorstrainvectorvortexzoningbarrierbosoniccoulombcurrentdensitydiffuseelasticentropyfractalinertiaionizedkineticneutronwattagefrictiongraviton

Physical Science - Semester 1 Word Find 2025-12-02

40 Items: gasionmassatomsolidcloudmattervolumeweightliquidplasmaprotonyieldsfusiondensityelementmixtureneutronnucleusformulaproductfissionphysicalchemicalcompoundelectronequationreactantbalancedsubscriptexothermichomogeneousevaporationcoefficientendothermicradioactivecondensationpuresubstanceheterogeneousperiodictable

Word Search Tema 5 Las mezclas 2º ESO 2026-02-16

40 Items: solpuremassvaporsolutemattervolumemixturesolubledensitymeltingboilingsolventcolloidmicelleaerosolTyndallphysicalpropertyvariablevolatilesolutionemulsionsubstancecomponentnanometerfiltrationsolubilityproportionmicroscopemicrometerdecantationcompositionevaporationrefrigeranthomogeneousdistillationcondensationheterogeneouscrystallization

Words search 2026-05-21

40 Items: IceMixCatDogSunSnowAtomTinyMoveLeafRootStemSeedTreeBirdFishFoodRainSpacePlantGrassWaterCloudRiverOceanSteamCycleMatterEnergyObjectAnimalFlowerWeatherHabitatDropletParticleMoleculeEvaporationCondensationPrecipitation

Puzzle 2 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 3 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 12 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 15 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 19 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Puzzle 22 2026-08-18

40 Items: ATOMCELLHEATROCKFORCELASERORBITSOLIDENERGYFOSSILMAGNETMATTERMOTIONNEURONPLANETPLASMATHEORYTISSUEVACUUMVOLUMECLIMATECRYSTALDENSITYGRAVITYPHYSICSSCIENCESPECIESCOMPOUNDGENETICSMOLECULEORGANISMREACTIONRESEARCHSPECTRUMCHEMISTRYRADIATIONEXPERIMENTLABORATORYWAVELENGTHTEMPERATURE

Ramadan 2026-02-10

27 Items: The pre-dawn meal eaten before the fast begins for the day.Voluntary acts of charity and kindness done to help others.The new crescent moon that marks the beginning and end of the month.The Arabic word for fasting, which is one of the Five Pillars of Islam.The meal eaten at sunset to break the fast, often started by eating dates....

Key Word Search 2026-05-18

11 Items: Sacred text of JudaismCommunicating with GodFather of the Jewish peopleSacred book of ChristianityIslamic holy month of fastingOne of the followers of JesusReligion based on the teachings of JesusGiving something important up for a beliefJewish festival celebrating freedom from slaveryAn extraordinary event believed to be caused by God...

Operation Barbarossa 2026-04-01

10 Items: The Soviet Union's armyGermany, Italy, and JapanLeader of Nazi Germany at this timeLeader is the Soviet Union at this timeThe country that invaded the Soviet UnionGerman war strategy known as "lightning war"Non aggression agreement between Germany and the USSRThe German code name for an invasion of the Soviet Union...

The English Renaissance - part 2 (Characters) 2025-11-20

20 Items: mother of Hamletfriend of Sebastianbest friend of Hamletdisguised as a man - Cesariofriend of Toby's; courting Oliviasitting king; murdered his brotherViola's twin brother; thought deadson of Polonius; doesn't like Hamletgood king; ghost; murdered by brotherOlivia ___ Sebastian; Orsino ___ Violasteward (butler) to Olivia; secret crush...

Week 6 Biology Word Search 2025-10-08

11 Items: Maintaining a balanced environment.The movement of water across the membrane.The passive and spontaneous movement of particles across the membrane.The release of large particles in vesicles to the outside of the cell.When the concentration of the solution is lower than the inside of the cell....

Academic vocabulary 2025-12-11

11 Items: The rhythm and intonation of a languageSomeone who regularly travels between work and homeAny of two or more actual representations of a morpheneRelating to the grammatical arrangment of words in a sentenceConnected with the accepted way of spelling and writing wordsConsisting of parts or things that are very different from each other...

brain regions 2026-01-13

19 Items: deals with visiondeals with touch, spatial orientationdeals with planning, speaking, personalityOne of the major subdivisions of the cerebral cortex:deals with auditory processing, language comprehension, memoryA limbic structure critical for forming and consolidating new long-term memories and for spatial navigation....

9th grade Lowery Freshman center biology review 2026-05-11

40 Items: a permanent, heritable change in the DNA sequence of an organismis the hereditary material in humans and almost all living organisms.membrane-bound organelles found in the cytoplasm of almost all eukaryotic cellsan organism whose cells contain a nucleus and other membrane-bound organelles....

Week 18 Thursday 2024-02-04

25 Items: SpyingYoungera choicehelp or supportFor a short timePermitted by lawAt the present timeMoney for investmentMasses of bread or meatthe act of being presentA way of acting or behavingSomeone who repairs machinesA deep, gaping hole; a gorgeTo have said yes to somethingThe reason why something happensA relative who lived in the past...

Medical Terminology 2026-01-29

14 Items: pregnancyBroken boneto destroy the lensChronic liver diseaseinflammation of a nailrefers to sole of the footinflammation of the thyroid glandSensation of spinning or whirling aroundIncreased formation and secretion of urineinvoluntary muscle contraction of a (blood) vesselInhaling fluid or a foreign object into the airways...

Science Word Search 2026-01-11

8 Items: force per unit arearequired medium to travelcontain genetic informationtough, porous and black substanceNumber of oscillations per secondallow electric current to pass through itmatter which allows spontaneous combustionforce exerted by a charged body on another charged or uncharged body

Manatees 2025-04-29

12 Items: Where this takes placeOne place of pollutionAnother example of pollutionAnother example of pollutionPeople that opposed the protectionWhen the plan started to take actionAnother group of people that opposedOrganization involved with protectionA problem with evolution in the futureBeds of this dying leading to starvation...

compliance and Ethics Day 1 Puzzle 2024-10-02

24 Items: AbuseFraudHIPAAhotlineProgramAuditingMedicareEducationWork Planof ConductGovernmentGrievancesMisconductMonitoringSanctionedAntiKickbackInvestigationFalseClaimsActConfidentialityComplianceOfficerComplianceCommitteeConflictsofInterestCorrectiveActionPlanof Inspector General

Insurance and Mail facilities 2023-09-03

10 Items: Direct advertisingRemittance of moneyA range of delightful cardsSafeguard against rising medical costProvide measure of financial support to farmersEffective vehicle for indian corporate to advertise brandReliable delivery ensuring your packages reach destination quicklySum of money is secured to the assured in even of death of bulls cows...

Countries 2026-03-24

22 Items: IranChinaIndiaJapanKrnyaSpainCanadaFranceGreeceMexicoNorwayPanamaRussiaTurkeySwedenTaiwanEnglandGermanyPortugalArgentinaUnited StatesBelgium Brazil

BF10 2.05 Vocabulary Review Word Search 2026-03-09

23 Items: The money that a business spends.The possibility of loss or failure from nature.The possibility of loss or failure from human error.Chances of loss that may result in loss, no change, or gain.Chances of loss that carry with them the possibility of loss or no loss.Rivalry between or among businesses that offer dissimilar goods or services....

May 2026 Word Search 3 2026-02-18

19 Items: degree of heatto turn over soilpredicted weathersoil water removallimited direct sunrelating to springrelating to a seasoncomplete sun exposurea small garden sectionto allow air into soilamount of sun receiveddistance between plantsa line of planted seedsa prepared planting areato prepare and grow soilsmall local climate zone...

Science Word Search 2026-01-11

8 Items: force per unit arearequired medium to travelcontain genetic informationtough, porous and black substanceNumber of oscillations per secondallow electric current to pass through itmatter which allows spontaneous combustionforce exerted by a charged body on another charged or uncharged body

Geometry 2026-01-06

20 Items: conelinecuberatioangleangleproofanglelinesanglescircleanglessegmentcirclesgeometryconversehypothesisproportionof symmetryof a segment

math wordsearch 2022-11-30

31 Items: oddeveneventmarkupinverseoutcomedivisionmarkdownsubtractadditionfractionsinferenceprincipalpopulationproportioncross-sectioninterest-ratepercent-erroradjacent-anglescomplex-fractioncomposite-figurepercent-equationinvalid-inferencepercent-of-changeindependent-eventsisolate-a-variablecomparative-inferenceexperimental-probability...

What's the matter 2026-07-01

6 Items: feverheadachetoothacherunny nosesore throatstomach ache

The Origin of Life 2024-07-10

5 Items: panspermiaprimordialabiogenesiscreationismStates that life originates only from other living things.

Scrum Glossary 2023-07-21

34 Items: 10, See "Product Backlog __________"5-4, A self-managing team consisting of one Scrum Master, one Product Owner, and Developers.8, The selection of items from the Product Backlog Developers deems feasible for implementation in a Sprint....

Chapter 7 Vocab 2025-10-21

14 Items: What are the building blocks of protein?What is the resting phase of hair growth?What is a circular growth pattern of hair?What is the outermost layer of the hair shaft?What elements make up the composition of hair?What is the innermost layer of the hair shaft called?What is the short fine unpigmented hair that appears on the body?...

Red Word Search 2026-06-22

9 Items: the Colour of Some Winethe Colour of Buttercupsthe Colour of a Cue Ballthe Colour of a Beloved Catthe Colour of Spades and Clubsthe Colour Added to Red to Make Purplethe Colour of Delicious Fish Baked with Lemonthe Colour of a Traffic Light When it is Safe to Gothe Colour of a Cardinals Robe, a Symbol of Authority

B&N 2024-07-31

21 Items: Brides first jobBrides occupationBrides birthstoneGrooms middle nameGrooms birth monthName of Grooms gymNumber of bridesmaidsGrooms favorite drinkState the Bride is fromBrides favorite holidayGrooms major in collegeCouples favorite concertName of Brides oldest nieceBride is the queen of theseNumber of tattoos Groom hasVenue of couples first concert...

Daniela and Adam 2024-12-11

24 Items: - Wedding Hotel- Grooms BestMan- Maid of Honour- Name of the Bride- Name of the Groom- Name of their son- Location of Church- Town they live in.- Bride's maiden name- What is in the air?- School Adam attended- Name of their Daughter- First holiday together- The Couples new Surname- School Daniela attended- Favourite Football team...

Humerus Word Search 2026-02-05

21 Items: arms upflex armarms downUpper arm bonejoint (AC joint)opposite of flexjoint (SC joint)term for collar boneterm for shoulder bladeabduction arms straight outrotation one arm pointed uprotation on arm pointed downbony protection feels like a bumpflat vertical bone, center of chestupper end of shoulder bone (proximal)...

CHRISTMAS IN UNITED STATES 2024-12-06

10 Items: ELFTREESNOWGIFTSANTABELLSNORTHFROSTYREINDEERSTOCKING

Criterion Challenge 2025 2025-04-10

52 Items: ThiefGummoCrumbVampyrStalkerDaisiesRoboCopTampopoRepo-ManNashvilleChoose-MeHappinessThe-BeastLa-StradaLa-CienagaFunny-GamesCitizen-KaneSafety-Last!Paris,-TexasPerfect-DaysTaipei-StoryThe-Third-ManPink-FlamingosHeart-Of-A-DogPan's-LabyrinthAce-In-The-HoleThe-CelebrationThe-Burmese-HarpFantastic-PlanetDouble-IndemnityPunch-Drunk-Love...

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

human development 2025-09-04

20 Items: : Connected to feelings and mood: The life stage before adolescence: One's sense of self or who they are: The acquisition of knowledge or skills: The process of becoming fully developed: Physical increase in size or development: Key developmental achievements or stages: The stage of maturity or full development...

Education in Zion Gallery 2025-06-04

15 Items: One of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsOne of BYU’s Four AimsEducation in ______ GalleryThe first permanent principal of Brigham Young Academy“If any of you lack wisdom, let him _____ of God” (James 1:5)The first temple built by the Church of Jesus Christ of Latter-day Saints...

APRIL COVERAGE REVIEW 2024-04-10

34 Items: SIUDOLagentcrocschangeLETTERdutiesREPORTpolicyrentalPHOTOSSEARCHOF SALEcontactOF LOSSPAYMENTinsuredCARRIEROUT UPDwitnessclaimantcoveragemetadatacollisionliabilityINCEPTIONOF RIGHTSSPECIFICSdealershipdeductibleproceduresinvestigateoverlappingcomprehensive