states of matter Word Searches

Travelling Europe 2025-09-25

18 Items: Boat TourCity of LoveBay of SilenceCanel Boat RideCapital of BelgiumCapital of DenmarkCapital for FashionRome Pregnancy TourSwedish Shipyard TownHome of the Royal MileThe Infamous Tube FightFavourite Italian HotelDeclan and Megans WeddingCity of the Magnum DesertFavourite Italian ResterauntDamons Favourite Italian Drink...

Islam and Crusades 2026-02-10

13 Items: holy book QuranLeader of the third CrusadeBuilding where muslims worshipFounder of the religion of IslamMuslim leader of the third crusadeCode of Conduct that all knights followedThe Third crusade ended with a peace (blank)Name of the war fought by Muslims and ChristiansCity the Muslims and Christians wanted control of...

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Chemical Reactions BONUS Word Search 2024-11-08

34 Items: lawplusodormuirarrowatomscolorbondsyieldsmatterchangeokeefemiddleschoolformulacreatedfizzingsciencechemicalreactionequationproductsbalancedmoleculecompoundreactantssubscriptdestroyedsubstancechemistryrearrangedcoefficientprecipitateconservation

Chemistry Word Search 2025-05-22

35 Items: ionssilkplusoxideminussolidarrowmatterprotoncottonoxygenDiamondneutronstripedelementelectronbracketsmixtureshydrogenchlorinechlorinepressureequationreactionsubstancechemistrymetalloidsubscriptlaboratorydecomposedcombustionfertiliserfundamentalevaporationelectrochemistry

Madison & Wyatt 2025-01-21

20 Items: The wedding date.The name of the groom.The name of the bride.The name of the venue.For cards from guests.The month of the wedding.A favorite candy of the groom.What is the groom’s favorite drink.Dessert being served at every table.One of the bride’s favorite candies.Carries a basket during the ceremony.The main entrée for the dinner buffet....

Harry potter 2023-06-12

14 Items: Scared of spidersHeir of slytherinA Hufflepuff girlFriends with GoyleFriends with CrabbeA twin brother of FredHe killed Nagini the snakeA Chinese girl from RavenclawThe main character of the movieA Weasley that died in the last movieThe smartest one out of the group of 3A lovegood member taken by the death eater...

Psychology chapter two 2025-03-07

10 Items: solvingEnables reasoning, planning, creating,Drive vital functions, such as heart rate, breathing, digestionsystem Adds emotions, complex motives, increased memory abilities–Topmost layer of the brain; the bulbous cap over the limbic systemTightly coiled threadlike structures along which the genes are organized...

Pathophysiology Practice 2025-06-15

15 Items: Plantar wartItching sensationMalignant bone tumorOily secretion of integumentFixation or immobility at jointNoise of broken bone rubbing togetherScratching that results in abrasion or woundExcessive forward curvature of thoracic spineInflammatory disease of the eye's uveal tractPlug of keratin and sebum within hair follicle...

JoiningThePak Wedding Word Search 2022-11-01

19 Items: Amber's jobwhere we methoneymoon locationfirst date activitywhere Alex proposedAlex's favorite foodone of Alex's hobbiesname of our first dogsomebody once told mename of our first catAmber's favorite foodone of Amber's hobbiesname of our second dogblue flower red thornsname of our second catmonth we started datingyears we've been together...

Study Guide Crossword 2024-04-17

31 Items: viewed from all sidessoft or workable materialclay is fired once in kilnclay is NOT fired in kiln yetrepetition of one or more elementhigh water content, most workablea single material an artist may useliquid material is poured into moldhard less water, but still workablecompletely air dried & very brittlea difference in the use of two elements...

Trust Word Search 2025-05-28

20 Items: joyjoynowflowsouldeepheartpeacegoingaliveabovefullyjoyfulmatterpeacefullight inyourselfserenitybeautifulresilience

Network security 2025-05-14

16 Items: foreverunaltered infopart of red hatour everyday usewas a macro virusnetworking devicepart of wanna cryiris, fingerprintsgroup of computerspart of the CIA triadmesh, ring and otherssecond part of the wanna cryderived from the work triangleprevents you to access your deviceold device rarely used in networkingdeals with different types of hackers

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

DITA 3 2026-08-26

20 Items: OF KINEFFECTSDECEDENTEXTERNALTRANSFERSECURITYMECHANISMBIOHAZARDINTERVIEWOF CUSTODYEXAMINATIONPOSITIONINGPRESUMPTIVENOTIFICATIONJURISDICTIONCONFIRMATORYPRONOUNCEMENTCONTAMINATIONCIRCUMSTANCESDECONTAMINATION

Biodiversity Vocab 2023-05-16

19 Items: Environment lacking oxygenVariety and variability of lifeSpecies dwindling toward extinctionAmount of organic mass in an ecosystemOrganisms' natural home or environmentSpecies with no living members remainingSpecies indigenous to the given ecosystemLarge, regional habitat of flora and faunaFormation of new species due to env. change...

Executive Branch 2025-10-27

17 Items: A legal act of forgivenessHead of the executive branchSecond in the line of successionCancel or postpone the punishmentGroup of advisors for the presidentReducing a sentence to one less severeThe executive branch is set to ____ laws.Primary location for the executive officesLocation of the outline of the Executive Branch...

Early Industrialization 2023-12-01

24 Items: the "working class"money used to investbusiness organizationinventor of Cotton Ginthe new "middle class"perfected the steam enginemovement of people to citiesprocess of combining farmlandterm meaning country/ farmlandsecond country to industrializemade up most of new middle classprocess of removing iron from its ore...

March 2026 Wordsearch 2026-02-18

20 Items: a light gentle windthe state of floweringa brief period of rainmoderate heat in the airdirect light from the sunto begin growing from a seeda colored segment of a flowera new shoot growing from a seeda field of grass and wildflowerssweet liquid produced by flowersprecipitation in the form of raina plant embryo capable of growing...

Female Inventors Who Changed the World 2023-08-02

15 Items: First name Marie, discovered radioactivity.First name Margaret, creator of the paper bag.First name Mary, creator of the windshield wiper.First name Melitta, creator of the coffee filter.First name Ayla, creator of the Kindling Cracker.First name Maria, creator of the pop up life raft.First name Katharine, created non-reflective glass....

Communication 2025-04-17

20 Items: the information being relayedthe transfer of information between individualsthe person who sends information to someone elsethe recipient of the message given by the senderanything that may inhibit effective communicationcommunication completed via transfer of electronic messagesrelay of information in as clear and concise a method as possibe...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

ATOMS  2020-09-24

35 Items: BOHRWAVEATOMSCLOUDGASESMODELREPELENERGYMATTERPROTONQUARKSATTRACTCOMBINEELEMENTISOTOPELIQUIDSMOSELEYNEUTRALNEUTRONNUCLEUSADHESIONELECTRONMOLECULENEGATIVEPOSITIVEFLAMETESTSUBATOMICATOMICMASSDEMOCRITUSJOHNDALTONRUTHERFORDATOMICNUMBERATOMICWEIGHTSCHROEDINGERQUANTUMTHEORY

MP1 Word Search 2025-10-21

35 Items: AtomMassForceEnergyMatterVolumeMotionFlummoxElementMixtureDensityGravityInertiaErosionHabitatCompoundMoleculeChemicalPhysicalFrictionVelocityRadiationEcosystemConductionConvectionWeatheringAdaptationTemperatureEvaporationEnvironmentAccelerationCondensationSchadenfreudePrecipitationPhotosynthesis

Acts 2025-11-08

35 Items: GodActsLukePaulwillLOWMGhostMosesPetersavedfaithheartJesusPeterchurchburdeneldersgospelmatterChristdebatedfathersSamariawitnesscommandPhenicePulliambrethrenapostlesGentilesBarnabasmiraclesJerusalemPhariseescircumcised

Progressive Era & WWI 2026-07-20

25 Items: the right to votea government's strategy in dealing with other nationsa policy of avoiding political or military involvement with other countriesamendment to the U.S. Constitution (1933) which ended the era of Prohibitionthe political, economic, military, and cultural goals that a nation considers important...

NURSING THEORISTS WORDSEARCH 2025-04-05

13 Items: Conservation ModelEnvironmental Theory14 Basic Needs TheoryHealth Promotion ModelBehavioral System ModelTheory of Goal AttainmentAdaptation Model of NursingTranscultural Nursing TheoryTheory of Transpersonal CaringScience of Unitary Human BeingsSelf-Care Deficit Nursing TheoryFive Stages of Clinical Competence...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Get to the Root of it Unit 16 2026-03-14

29 Items: Eating only meat.A reddish-brown stone.To separate from the body.Relating to abstract ideas.Hostility or strong feeling.Mental calmness or composure.Showing animal-like qualities.The quality of being physical.A scientist who studies physics.The order of meat-eating mammals.The science of matter and energy.An animal that eats other animals....

Pichwai Word Search 2023-05-12

20 Items: The old name of Nathdwara was ___.Deccani or Golconda style of Pichwais originated in _____.A day at Shreenathji ki Haveli is divided into ____ darshans.He was an ardent devotee of Shrinathji and a devotional philosopher.Every Pichwai painting relates to a specific celebration of a ______....

How Well Do You Know Your Model A #5 2023-12-30

20 Items: Charging gaugeA theft deterrent.Leaf spring hanger.______________ bowlA grouping of wires.A vintage brand of tire.pulls air thru the radiator.Center of the wheel assembly.Controls carb and distributorDraws additional gas to start.Original color of radiator hoses.A common brand of updraft carburetor.Wire junction box on top of generator....

Units 6-9 2026-02-24

20 Items: Main cause of civil war, supplies, and international aid.A union strategy to restrict the south of itsAdmendment that gave African Americans equal rights.Admendment that gave All males, colored or not, voting rights.Admendment that officially freed all slaves in the United states...

ART IN EARLY CIVILIZATION (GROUP 2 BSPT 1C) 2025-03-29

20 Items: KaGizaHorusMummyLascauxPharaohPaletteof BullsEgyptianPyramidsNeolithicPaintingsSculptureAfterlifeMesolithicStonehengePaleolithicHieroglyphsTutankhamenof Willendorf

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

Latitude Word Search 2025-01-11

30 Items: A group or chain of islandsWhere the land meets the oceanA body of water surrounded by landA large area covered mainly with treesA cold, treeless region with frozen groundA large area of flat or gently rolling landA nation with its own government and bordersA low area of land between hills or mountainsA piece of land completely surrounded by water...

Grade 8: PHYSICAL SCIENCE 2014-10-19

36 Items: gasmassatompuretablesolidmattervolumeenergyprotonchangechangeliquidsolutedilutenucleusneutronelementmixturecolloidsolventelectroncompoundmoleculeperiodicphysicalchemicalsolutionparticledissolvesubstancepropertiessuspensionhomogeneousconcentrateheterogeneous

Physical Science Vocabulary Words Search 2025-12-05

36 Items: dataatomcellforcesolarorbitenergymotionmattersystemplanetgravityhabitatweatherclimateerosiongeologygravityvariablemoleculechemicalreactionorganismecosystemevolutiondiversityrockcyclehypothesisexperimentconclusionadaptationatmospherewatercycleobservationreproductionphotosynthesis

green 2026-03-18

35 Items: JunekindlakelateleaflightmatchkickedlistenlivingmagnetmarblematterJanuaryjewelrylaughedmachinemammalsmanagermannersmeetingmessagekangarookeyboardknittinglatitudemagazineinvitationkilometersmayonnaiseimaginationimmediatelyingredientsinterviewedindependence

Northeastern United States Capitals 2026-04-08

12 Items: DoverBostonAlbanyAugustaConcordTrentonHartfordAnnapolisMontpelierHarrisburgProvidenceWashingtonDC

Word search science 2026-01-09

12 Items: of overlapping scalesthe central core of a hairthe tough outer covering of a hair that isDNA - genetie material in the nudeus of a cellgranules- bits of pigment found in the cortex of a haira type of fibrous protein that makes up the majority Of the cortex of a hairthe region of hair located atside the medulla that contains granules of pigment...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Manifest Destiny 2025-03-11

30 Items: WarActLineTrailFolly49ersDebateDestinyK. PolkPioneerCessionof 1850PurchasePurchaseRailroadof TearsFrontierDisputesGold RushExpansionAnnexationRemoval ActForty-NinersReservationsAssimilationHomesteadersof the AlamoExpansionismof Guadalupe Hidalgoand Clark Expedition

Watercycle Word Search 2025-12-17

29 Items: bends or curves in a streammaximum load a stream can carrywater within the zone of saturationcourse the water in a stream followsnaturally formed underground chamberupper limit of the zone of saturationunending cycle of Earth's water supplyslope or steepness of a stream channelarea where water fills all pore spaces...

Increasing Word Search 2025-03-10

8 Items: noun of beginnoun of expectadverb of favourverb of desperatenoun of alternateadjective of increaseadjective of mountainnegative adjective of solve

Animals, Colors, Jobs 2023-03-08

20 Items: Animal that barksthe color of dirtThe color of grassThe color of a roseThe color of the skyanimal that slithersThe color of a grapeThe color of the sunThe color of a whiteboardA animal that you can rideA person that likes to singTakes care of people(female)animal that likes to hop(female)A professional at acting(female)...

Term 1 Word Search 2026-03-26

20 Items: pertaining to beautyflowing in abundanceprovide evidence forshort account of eventstate of being uncertainbased on a random choiceclearly express in wordsthe writer's word choiceliteral meaning of a wordnon-literal meaning of a wordto reach an overall agreementto be doubtful or questionableuse of slang in speech or writing...

Akshayam - April 19, 2026 2026-04-18

20 Items: The wise bearSwami's BirthplaceKing of the monkeysPrevious Avatar of SwamiHoly Book of the ChristiansPlace where Sikhs go to praySwami's Divine abode in MumbaiYoungest of the Pandava BrothersBrother who took Sri Rama's SandalsThe divine herb that saved LakshmanaWhere the Mahabharata war was foughtHoliest place for followers of Islam...

Good Friday 2025-04-14

10 Items: tombcrossJesusnailsdeathdarknesssalvationlamb-of-Godking-of-kingscrown-of-thorns

Art Chapter 1-2 2025-11-12

19 Items: ARTMEDIUMOF ARTDESIGNOF ARTSUBJECTCERAMICABSTRACTANALYSISCRITICISMOF DESIGNFORMALISMEXPERIENCEEVALUATIONTRADITIONALDESCRIPTIONCOMPOSITIONINTERPRETATIONEXPRESSIVENESS

Southern Flying Squirrel 2024-10-20

42 Items: FurEyesNutsBirdEggsTreeTallMixedGlideTreesWhiteBellyLargeSeedsNestsTwigsNightTreesFlyingVolansRodentUnitedStatesFruitsLeavesSocialForestCanopyForestsEasternInsectsSouthernSquirrelPatagiumCavitiesGlaucomysNocturnalDeciduousPredatorsOmnivorousInsulationGrayish-brown

Ancient China Word Search 2025-03-26

25 Items: complete disorder and confusionthe sovereign ruler of an empirea class of people of high social ranka sequence of rulers from the same familya white vitrified translucent ceramic; chinaa Hindu or Buddhist temple or sacred buildingan official order or commission to do somethingdecorative handwriting or handwritten lettering...

Blood & Blood Forming Organ Disease Word Find 2026-03-18

20 Items: Increased WBC count.A state abnormally low WBC count.An acronym for Complete Blood CountThe hardness/difficultness of breathing.A genetic condition that causes excessive bleeding.FA; a genetic disease that leads to bone marrow failure.The condition of malignant neoplasm in the blood forming organs....

"Your word is a lamp to my feet and a light to my path" - Psalms 119:105 2025-01-25

15 Items: The MessiahThe Son of GodTalking to GodFollower of JesusComplete trust in GodThe birthplace of JesusUnmerited favor from GodThe good news about JesusEternal dwelling with GodThe first book of the BibleLove and kindness in actionSongs and poems in the BibleThe holy book of ChristianityStory told by Jesus with moral lessons...

Term 1 Vocabulary 2026-03-25

20 Items: pertaining to beautyflowing in abundanceprovide evidence forshort account of eventstate of being uncertainbased on a random choiceclearly express in wordsthe writer's word choiceliteral meaning of a wordnon-literal meaning of a wordto reach an overall agreementto be doubtful or questionableuse of slang in speech or writing...

Toes and Foot Word Search 2024-07-16

20 Items: For an AP foot, the central ray is angled ___ ___ degrees.What part of the 5th metatarsal is on profile on an oblique foot?When positioning for lateral toes the 1st-3rd toes require ___ ____.When positioning for lateral toes the 4th-5th toes require ___ ____.For all positions of the toes how much of the metatarsals in required?...

Algorithms 2026-01-28

27 Items: the largest item in a set of datathe smallest item in a set of datacheck that data entered is accuratethe input data that is used to test a systema diagrammatic representation of an algorithmTaking a system and splitting it into smaller sub systemscomparing the data entered with the original side-by-side...

How Much Do You Know About Katie & Drew? 2026-06-18

16 Items: - Drew's middle name- Honeymoon location- State Drew is from- Katie's cat's name- Katie's middle name- State Katie is fromMonth for the wedding- Drew's field of work- Katie's field of work- Katie's favorite drinkMonth of Drew's birthday- Location of the weddingLocation of the receptionMonth of Katie's birthday- Dress code for the wedding...

States 2024-03-22

4 Items: JuneauPhoenixMontgomeryLittle Rock

Math Vocab 2025-10-08

19 Items: SumSlopeLinearProductSegmentSimplifyQuotientVariableFunctionParallelEquationSolutionConstantExponentof ChangeDifferenceY-Interceptof OperationsPerpendicular

Cognitive Word Search 2019-10-16

35 Items: axonlobegreypinkbrainfoldsshortsmelltastetouchmattermemoryvisionthoughtemotionfrontalbarrierhearingtemporallongtermdopamineamygdalabreathingdendritesoccipitalbrainstempituitaryserotoninprocessingCerebellumneurologistelectricityhemispheresneuroscienceneurotrasmitters

Word Search 1 2024-01-16

35 Items: billfelttestmoonmindloverainbluewishreadydancecellspaintcausetrainmattersquarecenterenergyregionreturnpickedsimplefarmersdividedgeneralsubjectbelievememberssuddenlyanythingexercisesyllablesdirectiondeveloped

Weather, Water Cycle, Atmosphere 2026-02-05

34 Items: icesungasrainsnowhailatomsleetphasecloudsstormsmattervolumeliquidrun-offwarmaircoolairdropletsmoleculecoldfrontwarmfrontwatervaporatmospherewatercycletemperatureairpressurephasechangeKelvinscaleevaporationcondensationinfiltrationprecipitationtranspirationdatacollecting

Following Word Search 2026-04-08

35 Items: baghathanddulldoneovershinybroomshirtsocksshoesbootswaterjuicegroomglorywherenervedoubtmatterdefeatbreathesittingopeningclosingglassesobservefreedomfireboltlatenessstandingsupermanprisonerfollowingreinvention

TERRESTRIAL BIOMES 2025-10-02

20 Items: It is the most arid terrestrial biomeIt protects the Earth from the harmful UVA permanently frozen area of tundra and taigaGrasslands caters for the feeding habit of these animalsIt refers to the amount of water vapor present in the airIt describes the daily climatic condition in an specific area...

Unit IV Review: Abs-sci-ment 2024-05-17

22 Items: ______ the Terrible_______ WollstonecraftThe Index of _____________The belief that one should doubt everythingEmpress of Russia known for her Enlightened ideasThe spread and mixing of various cultures and ideasThe idea that the sun is at the center of the solar systemA child who ascends to the throne following a parent's death...

Executive branch 2025-04-23

17 Items: The spread of a secretCovering of a wrongdoingHighest-ranking diplomatic officerlead staff member of an administrationWritten directive, signed by the president,Process of electing president & vice presidentResponsible for the day-to-day management of the governmentOversees the performance of federal agencies, and administers...

Vocabulary Vines 63-66 (Enright) 2026-08-21

12 Items: of a shiplike a startoward a shipthe wrong namethe act of namingwritten with lighta particle of lightsailor of the starsnaming of the starssailor of the universeput together with lightdistribution in the environment

Science Word Search 2025-11-21

14 Items: Everything.Transfer of heat in a fluid.Movement of air due to convection.Heat source for convection on Earth.Daily conditions of the air around us.Last stage of a main sequence star's life.Average weather conditions over a long period.Movement of water in the ocean due to convection.Area of gas and dust in space where stars can form....

VOCAB 2023-05-15

11 Items: the moisture in the air.a weather instrument that measures air pressure.the weight of the molecules in a large mass of air.forms when colder air mass moves a warmer air mass.rapitly,whriling,funnel shaped could that reaches down from storm.steady winds that flow from west to east between latitudes 30N and 60N...

Kinetic Word Search 2025-12-04

17 Items: soundkineticelasticthermalnuclearradiantchemicalpotentialradiationmechanicalelectricalconductionconvectiongravitationaltransformationelectromagneticof conservation of energy

Genetics Word Search 2025-02-18

25 Items: The study of heredityDifferent versions of a genePassing of traits from parents to offspringAn organism's physical appearance, or visible traitsAn organism's genetic makeup, or allele combinationsAn organism that has two identical alleles for a traitAn organism that has two different alleles for a trait...

g4.4.Matter in Ecosystems 2023-02-22

10 Items: decaylitterhazardcompostnutrientpollutantscavengerdecomposerecotourismbiodegradable

Taxonomy Word Search 2024-01-22

24 Items: organisms.relationships.characteristics.characteristics.The study of the form and structure of organisms.The study of evolutionary relationships among organisms.Structures in different species that share a common ancestry.The science of classification, organizing and naming living organisms....

Force and Motion 2025-05-15

27 Items: speed in a directionan object changes its positiona push or pull acting on an objecta force that pulls objects toward each other\a measure of the amount of matter in a samplethe process of energy changing from one form to anothera force that acts in the opposite direction to movementfor every action, there is an equal and opposite reaction...

Force Word Search 2026-04-22

29 Items: A push or pull on an object.How fast something is moving.A unit used to measure force.When two objects touch each other.The amount of matter in an object.The path an object is moving along.The amount of motion an object has.The total force acting on an object.A force applied through a string or rope.How heavy something is because of gravity....

You Word Search 2025-05-28

20 Items: realmindmorecarefullsoulflowsrootsheartmattergoldenhopefulmindfulforwardgot thislight inserenitycheerfulthoughtshappiness

Ancient Greece 2025-07-02

20 Items: God of WarThe countryThe languageGod of the seaAlexander the ...Half man, Half goatHalf man, Half bullThe symbol of PoseidonQueen of the underworldLeader of the Greek godsFlew too close to the sunThe colour of Greek easter eggsCity with the fiercest warriorsThe games that started in GreeceGod villain in the Hercules myth...

Skeletal Word Search 2026-04-20

50 Items: — the kneecap— the tailbone— a broken bone— the thigh bone— the collarbone— the breastbone— bending a joint— the upper arm bone— the shoulder blade— relating to muscles— injury to a ligament— straightening a joint— the hip bone structure— turning around an axis— wasting away of muscle— inflammation of a joint— inflammation of a bursa...

Documents & Correspondence - Glossary and more 2024-12-18

31 Items: Consecutive hoursConsectutive daysReceiver of the cargoStowage plan for containersAlternative term for insurerSynonym for Bare Boat CharterDuplicate of a bill of ladingType of grain; Barley and oatsArchaic term for charter partyVessel sailing along a fixed routeAdditional sum of money to be paidType of grain; wheat, rye and corn...

Unit 1 Vocab 2025-09-03

15 Items: mass/volumesolute + solvent =not shiny, true for non-metalsshiny, characteristic of metals2 or more different elements bondedwhat dissolves in solvent, example: saltWhat something dissolves in, example: watertype of mixture where you can pick out parts1 type of atom, defined by number of protonsproperty of metals, can be shaped into wires...

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Anatomy & Physiology: N 2026-02-12

22 Items: Opening of the nostrilsSupportive neural cellsCell's central organelleMonomer of nucleic acidsAccidental death of cells/tissuesReceptor cell that sense pain stimuliBrush border enzyme that digests nucleotidesRod-like structure along dorsal side of the early embryoInactivation of a virus by the binding of specific antibody...

EA 2026-04-28

30 Items: MinK-popHaikuOsakaTokyoEuropeJingxiDaoismShintoKoreanKhalkaNagoyaAmericaTai-ChiEnglishBuddhismJapaneseMandarinYokohamaCantoneseGuangdongTae-Kwon-DoConfucianismKuril-IslandsUnited-StatesSpring-FestivalChinese-New-YearThanksgiving-DaySichuan-ProvinceHarvest-Moon-Festival

Lewis & Clark Expedition 2026-06-02

37 Items: WestbeardogsLewisClarktradewagonPointPercemagpieStatesTimberhorsescanoesPacificsoldiernativesbuffalogrizzlyMontanahistoryAtlanticexplorerMarylandPresidentJeffersonSacagaweaadventureToussaintBaltimoreGreycliffMeriwetherexpeditionCharbonneauYellowstonejackrabbitsNewfoundland

Energy Forms 2026-03-31

15 Items: Another unit for measuring heat.Heat transfer occurring in fluids.A unit used to measure heat energy.Sum of kinetic and potential energy.Heat transfer through solid material.Energy due to the motion of an object.Energy stored due to position or state.Energy stored in the bonds of compounds.Movement of electrons through a conductor....

dog man colton's 2026-09-04

26 Items: boomevil catmain herodogs feetdogs wag itnews reporterhead of policedogs hate thissaves the citya type of housea type of medalmans best friendopposite of dogsdad of dad or momnews reporters dognicer clone of peteysame thing as policesomething you live indogs love chasing themsomethings dogs live inpart of the five sensespart of the five senses...

Feel Word Search 2025-05-28

20 Items: bigjoyfreedeepdownmoresoulcarecheckheartheartflowsheartmatterbelievebalancekindnesslight inyourselfresilience

Cohesion Word Search 2025-02-14

15 Items: - Regard and consideration for others.- The ability to guide and direct others.- The act or state of forming a unified whole.- The state of being united or joined as a whole.- To defeat or prevail over challenges or obstacles.- The state of having different elements or qualities.- The process of teaching or learning specific skills....

Happy Birthday, Michael!! 2025-08-02

14 Items: FunMexicoEnsenadaAdultsonlyto the leftto the righta great leapgroup of twomonth of loveseven of themmost of Earthbackwards loopdrive with easebefore an audience

Channel Islands Word Hunt 2026-05-07

20 Items: Nocturnal animalon Santa Cruz Islandhome to point Bennetholds the twin peaksmechanism of evolutionhome to the painted caveContains Torrey pine treesorganisms that create foodconsisting of volcanic flowscomposed of the Earth's crustmost common rock on the islandfundamental geological processcontains the 40-foot-tall arch...

The Western United States 2026-04-08

12 Items: UtahIdahoOregonAlaskaHawaiiNevadaPacificMontanaWyomingColoradoCaliforniaWashington

Stephen ministry 2025-09-16

28 Items: Provide ______ supportTake the ________ seriously.Remain ______ on the process.______ with the CR, as appropriate.Or continued ________ and instability.Be _______, consistent and dependable.Help the CR to ______ in the crucible.Begin by _______ care as soon as possible.A state of crisis is referred as a _________....

WFS 2025-04-02

25 Items: FREE FRY FRIDAYTHEY GOT THE MEATWHERE YOU CAN BUY A BLAZERMORE, GREAT BAKERY AND TACO DIPHARDWARE, HELPFUL HARDWARE FOLKSBELL, FOUNDED IN 1962 BY GLEN BELLHARLEY, SOUND OF SUMMER ON 2 WHEELSFAMILY-OWNED MIDWEST FURNITURE STOREWHERE MOST OF THE LOCAL LADIES FASHION COMES FROMCONSTRUCTION, WE CASH THE MOST PAYROLL CHECKS FOR...

Individuals Word Search 2026-02-24

15 Items: Which method uses propaganda?What color represents communism?What is the symbol of communism?What is one advantage of communism?What is one advantage of capitalism?What drives innovation in capitalism?What is one disadvantage of communism?system aims to eliminate class divide?What is one disadvantage of capitalism?...

Nursing Shortage 2026-04-11

15 Items: A lack of staff nursesNursing leadership teamNurse-to-patient ______Known for their code of ethicsLevel of care needed for a patientTerm for keeping nurses in their jobsThe desired degree for registered nursesThe rate of deaths per x number of patientsWorking beyond the regular full time scheduleThe amount of money that a nurse makes a year...

Year 9 English 2024-07-05

35 Items: The ____ Plot 1605______ kills Duncan'half-formed ______''Be the ____ under't'Tennyson was Poet _______Genre of Macbeth: ________'I carving out me _______'Who kills Macbeth? ___________A commanding verb is an ______Poem by Carole Rumes 'The ____'Post __________ Stress Disorder'Straight I unloosed her ______'Playwright of 'Macbeth': _________...

Video Games 2025-11-10

34 Items: GTAPeakPUBGFIFABlurSkateRobloxMaddenPortalBurnoutDestinyFar-CryFortniteThe-SimsValorantMinecraftOverwatchHelldiversBattlefieldAngry-BirdsClash-RoyaleNo-Man's-SkyHollow-KnightPath-of-ExileMarvel-RivalsCounter-StrikeNeed-for-SpeedThe-Last-of-UsCrash-BandicootMetal-Gear-SolidLeague-of-LegendsKirby's-Dream-LandRed-Dead-RedemptionThe-Legend-of-Zelda